RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780339|ref|YP_003064752.1| hypothetical protein CLIBASIA_01120 [Candidatus Liberibacter asiaticus str. psy62] (88 letters) >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 33.1 bits (74), Expect = 0.016 Identities = 9/42 (21%), Positives = 21/42 (50%), Gaps = 16/42 (38%) Query: 11 KEAITNNRVEIANIR--ADMSGTSMKIQSEINNMSWKILTTM 50 K+A+ +++ A+++ AD S ++ I++ TM Sbjct: 19 KQAL--KKLQ-ASLKLYADDSAPALAIKA-----------TM 46 >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, cytoplasm, DNA damage, DNA recombination; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Length = 349 Score = 24.8 bits (54), Expect = 4.7 Identities = 8/43 (18%), Positives = 21/43 (48%) Query: 22 ANIRADMSGTSMKIQSEINNMSWKILTTMIGCSSAMLGTINQV 64 A I +M + + +Q+ + + + + +T + S IN++ Sbjct: 155 AEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINEL 197 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.314 0.124 0.344 Gapped Lambda K H 0.267 0.0618 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 631,973 Number of extensions: 21615 Number of successful extensions: 39 Number of sequences better than 10.0: 1 Number of HSP's gapped: 39 Number of HSP's successfully gapped: 4 Length of query: 88 Length of database: 5,693,230 Length adjustment: 55 Effective length of query: 33 Effective length of database: 4,359,810 Effective search space: 143873730 Effective search space used: 143873730 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.3 bits)