RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780340|ref|YP_003064753.1| proline/glycine betaine ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] (348 letters) >gnl|CDD|33915 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]. Length = 386 Score = 351 bits (901), Expect = 2e-97 Identities = 149/336 (44%), Positives = 207/336 (61%), Gaps = 8/336 (2%) Query: 5 AVKFRDVDIVFGETSNKIRKRSRYSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLS 64 ++ ++V +FG+ + K K + + + G+V V A+L+V++GEI V+MGLS Sbjct: 4 KIEIKNVYKIFGKNPKRALKLLDQGKSKAEILKKTGLVVGVNDASLDVEEGEIFVIMGLS 63 Query: 65 GAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLP 124 G+GKSTL+R +N L RGE+LVD + A LR+LR +SMVFQ FALLP Sbjct: 64 GSGKSTLVRLLNRLIEPTRGEILVDGK----DIAKLSAAELRELRRKKISMVFQSFALLP 119 Query: 125 WRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAF 184 RTV NV GLE +P ER+ R E LE+V L +AD N LSGGM+QRVG ARA Sbjct: 120 HRTVLENVAFGLEVQGVPKAEREERALEALELVGLEGYADKYPNELSGGMQQRVGLARAL 179 Query: 185 ATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIME 244 A ILLMDE FS+LDPLIR +QDELL LQ KLKKTIVF++HD++EA R+G+RIAIM+ Sbjct: 180 ANDPDILLMDEAFSALDPLIRTEMQDELLELQAKLKKTIVFITHDLDEALRIGDRIAIMK 239 Query: 245 GGRIIQCGTPQEIILHPANCYVSEFIQKLNPITALVAADVMRVCSIDDESNIVHKISRQM 304 G I+Q GTP+EI+L+PAN YV +F++ ++ L A D+MR D ++ Sbjct: 240 DGEIVQVGTPEEILLNPANDYVRDFVRNVDRSRVLTAKDIMR--RPDLLIRKTPGDGPRV 297 Query: 305 PLIDIIDMVADNLGKIGVVEDDRIVGIITAIDIVRG 340 L + D + V ++ VG+++ +V+ Sbjct: 298 ALKLLRDEGREYG--YAVDRGNKFVGVVSIDSLVKA 331 >gnl|CDD|73053 cd03294, ABC_Pro_Gly_Bertaine, This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 269 Score = 304 bits (779), Expect = 3e-83 Identities = 134/270 (49%), Positives = 176/270 (65%), Gaps = 4/270 (1%) Query: 6 VKFRDVDIVFGETSNKIRKRSRYSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSG 65 +K + + +FG+ K K K + + + G V +L+V++GEI V+MGLSG Sbjct: 1 IKIKGLYKIFGKNPQKAFKLLAKGKSKEEILKKTGQTVGVNDVSLDVREGEIFVIMGLSG 60 Query: 66 AGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLPW 125 +GKSTLLR IN L G+VL+D + A LR+LR +SMVFQ FALLP Sbjct: 61 SGKSTLLRCINRLIEPTSGKVLIDGQ----DIAAMSRKELRELRRKKISMVFQSFALLPH 116 Query: 126 RTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFA 185 RTV NV GLE +P ER+ R AE LE+V L W + LSGGM+QRVG ARA A Sbjct: 117 RTVLENVAFGLEVQGVPRAEREERAAEALELVGLEGWEHKYPDELSGGMQQRVGLARALA 176 Query: 186 TGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEG 245 ILLMDE FS+LDPLIR +QDELL LQ +L+KTIVF++HD++EA RLG+RIAIM+ Sbjct: 177 VDPDILLMDEAFSALDPLIRREMQDELLRLQAELQKTIVFITHDLDEALRLGDRIAIMKD 236 Query: 246 GRIIQCGTPQEIILHPANCYVSEFIQKLNP 275 GR++Q GTP+EI+ +PAN YV EF + ++ Sbjct: 237 GRLVQVGTPEEILTNPANDYVREFFRGVDR 266 >gnl|CDD|31322 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]. Length = 309 Score = 225 bits (575), Expect = 1e-59 Identities = 120/316 (37%), Positives = 179/316 (56%), Gaps = 18/316 (5%) Query: 30 IKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD 89 I+ + YG AV NL +++GE LVL+G SG+GK+T L+ IN L GE+L+D Sbjct: 2 IEFENVSKRYGNKKAVDDVNLTIEEGEFLVLIGPSGSGKTTTLKMINRLIEPTSGEILID 61 Query: 90 TDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSR 149 +D + +LR + V QQ L P TVA N+ + L K R Sbjct: 62 ------GEDISDLDP-VELRRK-IGYVIQQIGLFPHLTVAENIATVPKLLGWDKERIKKR 113 Query: 150 VAEHLEIVNL--TKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMR 207 E L++V L +++AD + LSGG +QRVG ARA A PILLMDEPF +LDP+ R + Sbjct: 114 ADELLDLVGLDPSEYADRYPHELSGGQQQRVGVARALAADPPILLMDEPFGALDPITRKQ 173 Query: 208 LQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVS 267 LQ+E+ LQ++L KTIVFV+HDI+EA +L +RIA+M+ G I+Q TP EI+ +PAN +V Sbjct: 174 LQEEIKELQKELGKTIVFVTHDIDEALKLADRIAVMDAGEIVQYDTPDEILANPANDFVE 233 Query: 268 EFI----QKLNPITALVAADVMRVCSIDDESNIVHKISRQMPLIDIIDMVADNLGKIGVV 323 +F + L ++ + AD +R D ++ + + D +A + VV Sbjct: 234 DFFGESERGLRLLSLVSVADAVRRGEPADGEPLLEGFVDRD---ALSDFLARGRSVLPVV 290 Query: 324 EDD-RIVGIITAIDIV 338 ++D R +G +T D++ Sbjct: 291 DEDGRPLGTVTRADLL 306 >gnl|CDD|73054 cd03295, ABC_OpuCA_Osmoprotection, OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment. ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 242 Score = 219 bits (559), Expect = 1e-57 Identities = 107/231 (46%), Positives = 143/231 (61%), Gaps = 10/231 (4%) Query: 44 AVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADAN 103 AV NLE+ KGE LVL+G SG+GK+T ++ IN L GE+ +D + D Sbjct: 16 AVNNLNLEIAKGEFLVLIGPSGSGKTTTMKMINRLIEPTSGEIFIDG----EDIREQDPV 71 Query: 104 VLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNL--TK 161 LR+ + V QQ L P TV N+ L + L P + + R E L +V L + Sbjct: 72 ELRR----KIGYVIQQIGLFPHMTVEENIALVPKLLKWPKEKIRERADELLALVGLDPAE 127 Query: 162 WADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKK 221 +AD + LSGG +QRVG ARA A P+LLMDEPF +LDP+ R +LQ+E LQ++L K Sbjct: 128 FADRYPHELSGGQQQRVGVARALAADPPLLLMDEPFGALDPITRDQLQEEFKRLQQELGK 187 Query: 222 TIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEFIQK 272 TIVFV+HDI+EAFRL +RIAIM+ G I+Q GTP EI+ PAN +V+EF+ Sbjct: 188 TIVFVTHDIDEAFRLADRIAIMKNGEIVQVGTPDEILRSPANDFVAEFVGA 238 >gnl|CDD|31313 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 248 Score = 215 bits (550), Expect = 1e-56 Identities = 94/214 (43%), Positives = 123/214 (57%), Gaps = 15/214 (7%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPY 98 +G V + NL V+KGE + ++G SG GKSTLLR I GL GEVL+D V Sbjct: 13 FGGVEVLEDINLSVEKGEFVAILGPSGCGKSTLLRLIAGLEKPTSGEVLLDGRP--VTGP 70 Query: 99 AADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVN 158 D + VFQ+ ALLPW TV NV LGLE E + R E LE+V Sbjct: 71 GPD-----------IGYVFQEDALLPWLTVLDNVALGLELRGKSKAEARERAKELLELVG 119 Query: 159 LTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRK 218 L + D + LSGGM+QRV ARA AT +LL+DEPF +LD L R LQDELL L + Sbjct: 120 LAGFEDKYPHQLSGGMRQRVAIARALATRPKLLLLDEPFGALDALTREELQDELLRLWEE 179 Query: 219 LKKTIVFVSHDINEAFRLGNRIAIMEG--GRIIQ 250 +KT++ V+HD++EA L +R+ ++ GRI + Sbjct: 180 TRKTVLLVTHDVDEAVYLADRVVVLSNRPGRIGE 213 >gnl|CDD|33633 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]. Length = 352 Score = 214 bits (545), Expect = 4e-56 Identities = 104/247 (42%), Positives = 141/247 (57%), Gaps = 13/247 (5%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD-TDKGFVNP 97 +G +AV +L++KKGE + L+G SG GK+TLLR I G GE+L+D D V P Sbjct: 15 FGDFTAVDDISLDIKKGEFVTLLGPSGCGKTTLLRMIAGFEQPSSGEILLDGEDITDVPP 74 Query: 98 YAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFL-DIPDVERKSRVAEHLEI 156 + MVFQ +AL P TV NV GL+ + E K+RV E LE+ Sbjct: 75 EKRP-----------IGMVFQSYALFPHMTVEENVAFGLKVRKKLKKAEIKARVEEALEL 123 Query: 157 VNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQ 216 V L +AD K + LSGG +QRV ARA +LL+DEP S+LD +R +++ EL LQ Sbjct: 124 VGLEGFADRKPHQLSGGQQQRVALARALVPEPKVLLLDEPLSALDAKLREQMRKELKELQ 183 Query: 217 RKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEFIQKLNPI 276 R+L T V+V+HD EA + +RIA+M GRI Q GTP+EI PA +V++FI + N Sbjct: 184 RELGITFVYVTHDQEEALAMSDRIAVMNDGRIEQVGTPEEIYERPATRFVADFIGESNIF 243 Query: 277 TALVAAD 283 V Sbjct: 244 EGKVVER 250 >gnl|CDD|73052 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 220 Score = 213 bits (544), Expect = 6e-56 Identities = 96/213 (45%), Positives = 128/213 (60%), Gaps = 15/213 (7%) Query: 40 GMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYA 99 G V+A+ +L V++GE + L+G SG GKSTLLR I GL GEVLVD + V Sbjct: 15 GAVTALEDISLSVEEGEFVALVGPSGCGKSTLLRIIAGLERPTSGEVLVDGEP--VTGPG 72 Query: 100 ADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNL 159 D VFQQ ALLPW TV NV LGLE +P E + R E LE+V L Sbjct: 73 PD-----------RGYVFQQDALLPWLTVLDNVALGLELQGVPKAEARERAEELLELVGL 121 Query: 160 TKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKL 219 + + + + LSGGM+QRV ARA A +LL+DEPFS+LD L R +LQ+ELL + R+ Sbjct: 122 SGFENAYPHQLSGGMRQRVALARALAVDPDVLLLDEPFSALDALTREQLQEELLDIWRET 181 Query: 220 KKTIVFVSHDINEAFRLGNRIAIMEG--GRIIQ 250 KT++ V+HDI+EA L +R+ ++ GRI+ Sbjct: 182 GKTVLLVTHDIDEAVFLADRVVVLSARPGRIVA 214 >gnl|CDD|73018 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and Solute Transporters-like subgroup. This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 213 Score = 212 bits (541), Expect = 1e-55 Identities = 94/215 (43%), Positives = 126/215 (58%), Gaps = 12/215 (5%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD-TDKGFVNP 97 YG V A+ +L V+ GE L L+G SG GK+TLLR I GL GE+L+D D V P Sbjct: 10 YGSVRALDDLSLTVEPGEFLALLGPSGCGKTTLLRLIAGLERPDSGEILIDGRDVTGVPP 69 Query: 98 YAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIV 157 + + MVFQ +AL P TVA N+ GL+ +P E ++RV E LE+V Sbjct: 70 ERRN-----------IGMVFQDYALFPHLTVAENIAFGLKLRGVPKAEIRARVRELLELV 118 Query: 158 NLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQR 217 L + + LSGG +QRV ARA A +LL+DEP S+LD +R L++EL LQR Sbjct: 119 GLEGLLNRYPHELSGGQQQRVALARALAREPSLLLLDEPLSALDAKLREELREELKELQR 178 Query: 218 KLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCG 252 +L T ++V+HD EA L +RIA+M GRI+Q G Sbjct: 179 ELGITTIYVTHDQEEALALADRIAVMNEGRIVQVG 213 >gnl|CDD|33631 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]. Length = 338 Score = 203 bits (517), Expect = 7e-53 Identities = 102/293 (34%), Positives = 151/293 (51%), Gaps = 19/293 (6%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD-TDKGFVNP 97 +G + NL+++ GE +VL+G SG GKSTLLR I GL GE+L+D D + P Sbjct: 13 FGSFEVLKDVNLDIEDGEFVVLLGPSGCGKSTLLRMIAGLEEPTSGEILIDGRDVTDLPP 72 Query: 98 YAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIV 157 ++MVFQ +AL P TV N+ GL+ +P E RV E +++ Sbjct: 73 EKRG-----------IAMVFQNYALYPHMTVYENIAFGLKLRGVPKAEIDKRVKEVAKLL 121 Query: 158 NLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQR 217 L + K LSGG +QRV ARA + L+DEP S+LD +R+ ++ E+ L Sbjct: 122 GLEHLLNRKPLQLSGGQRQRVALARALVRKPKVFLLDEPLSNLDAKLRVLMRSEIKKLHE 181 Query: 218 KLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEFI--QKLNP 275 +L T ++V+HD EA L +RI +M GRI Q GTP E+ PAN +V+ FI +N Sbjct: 182 RLGTTTIYVTHDQVEAMTLADRIVVMNDGRIQQVGTPLELYERPANLFVAGFIGSPPMNF 241 Query: 276 ITALVAADVMRVCSIDDESNIVHKIS---RQMPLIDIIDMVADNLGKIGVVED 325 + A V AD + +D+ + ++ R + + LG + VVE Sbjct: 242 LKAEVKADGNGLSIPEDKKVALEQVILGIRPEHI--SLSASGIILGTVEVVEP 292 >gnl|CDD|31330 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 339 Score = 190 bits (485), Expect = 3e-49 Identities = 99/242 (40%), Positives = 134/242 (55%), Gaps = 5/242 (2%) Query: 30 IKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD 89 + K + G V+A+ +LE+ KGEI ++G SGAGKSTLLR IN L G V VD Sbjct: 7 VSKTFGQTGTGTVTALDDVSLEIPKGEIFGIIGYSGAGKSTLLRLINLLERPTSGSVFVD 66 Query: 90 TDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSR 149 A LR+LR + M+FQ F LL RTV NV LE +P E K R Sbjct: 67 GQDLT----ALSEAELRQLR-QKIGMIFQHFNLLSSRTVFENVAFPLELAGVPKAEIKQR 121 Query: 150 VAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQ 209 VAE LE+V L+ AD LSGG KQRV ARA A ILL DE S+LDP + Sbjct: 122 VAELLELVGLSDKADRYPAQLSGGQKQRVAIARALANNPKILLCDEATSALDPETTQSIL 181 Query: 210 DELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEF 269 + L + R+L TIV ++H++ R+ +R+A+++ GR+++ GT E+ +P + EF Sbjct: 182 ELLKDINRELGLTIVLITHEMEVVKRICDRVAVLDQGRLVEEGTVSEVFANPKHAITQEF 241 Query: 270 IQ 271 I Sbjct: 242 IG 243 >gnl|CDD|31315 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]. Length = 345 Score = 189 bits (482), Expect = 7e-49 Identities = 100/266 (37%), Positives = 146/266 (54%), Gaps = 9/266 (3%) Query: 28 YSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVL 87 SI+ ++ +G A+ +L++K GE++ L+G SGAGKSTLLR I GL G + Sbjct: 1 MSIRINNVKKRFGAFGALDDISLDIKSGELVALLGPSGAGKSTLLRIIAGLETPDAGRIR 60 Query: 88 VDTDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEF--LDIPDVE 145 ++ F D + L +R V VFQ +AL P TVA N+ GL+ + E Sbjct: 61 LNGRVLF------DVSNLA-VRDRKVGFVFQHYALFPHMTVADNIAFGLKVRKERPSEAE 113 Query: 146 RKSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIR 205 ++RV E L +V L AD LSGG +QRV ARA A +LL+DEPF +LD +R Sbjct: 114 IRARVEELLRLVQLEGLADRYPAQLSGGQRQRVALARALAVEPKVLLLDEPFGALDAKVR 173 Query: 206 MRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCY 265 L+ L L +L T VFV+HD EA L +R+ ++ GRI Q G P E+ HPA+ + Sbjct: 174 KELRRWLRKLHDRLGVTTVFVTHDQEEALELADRVVVLNQGRIEQVGPPDEVYDHPASRF 233 Query: 266 VSEFIQKLNPITALVAADVMRVCSID 291 V+ F+ ++N + V ++V + D Sbjct: 234 VARFLGEVNVLPGEVILGQLQVGAHD 259 >gnl|CDD|73059 cd03300, ABC_PotA_N, PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D. PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 232 Score = 188 bits (480), Expect = 2e-48 Identities = 100/235 (42%), Positives = 135/235 (57%), Gaps = 14/235 (5%) Query: 38 EYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVN- 96 YG A+ +L++K+GE L+G SG GK+TLLR I G GE+L+D K N Sbjct: 9 FYGGFVALDGVSLDIKEGEFFTLLGPSGCGKTTLLRLIAGFETPTSGEILLD-GKDITNL 67 Query: 97 -PYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLE 155 P+ N VFQ +AL P TV N+ GL +P E K RVAE L+ Sbjct: 68 PPHKRPVN-----------TVFQNYALFPHLTVFENIAFGLRLKKLPKAEIKERVAEALD 116 Query: 156 IVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLAL 215 +V L +A+ K + LSGG +QRV ARA +LL+DEP +LD +R +Q EL L Sbjct: 117 LVQLEGYANRKPSQLSGGQQQRVAIARALVNEPKVLLLDEPLGALDLKLRKDMQLELKRL 176 Query: 216 QRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEFI 270 Q++L T VFV+HD EA + +RIA+M G+I Q GTP+EI PAN +V++FI Sbjct: 177 QKELGITFVFVTHDQEEALTMSDRIAVMNKGKIQQIGTPEEIYEEPANRFVADFI 231 >gnl|CDD|73017 cd03258, ABC_MetN_methionine_transporter, MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport. Other members of this system include the MetP permease and the MetQ substrate binding protein. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 233 Score = 179 bits (456), Expect = 1e-45 Identities = 97/223 (43%), Positives = 129/223 (57%), Gaps = 7/223 (3%) Query: 40 GMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD-TDKGFVNPY 98 G V+A+ +L V KGEI ++G SGAGKSTL+R INGL G VLVD TD ++ Sbjct: 16 GKVTALKDVSLSVPKGEIFGIIGRSGAGKSTLIRCINGLERPTSGSVLVDGTDLTLLSGK 75 Query: 99 AADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVN 158 LRK R + M+FQ F LL RTV NV L LE +P E + RV E LE+V Sbjct: 76 E-----LRKARRR-IGMIFQHFNLLSSRTVFENVALPLEIAGVPKAEIEERVLELLELVG 129 Query: 159 LTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRK 218 L AD LSGG KQRVG ARA A +LL DE S+LDP + L + R+ Sbjct: 130 LEDKADAYPAQLSGGQKQRVGIARALANNPKVLLCDEATSALDPETTQSILALLRDINRE 189 Query: 219 LKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHP 261 L TIV ++H++ R+ +R+A+ME G +++ GT +E+ +P Sbjct: 190 LGLTIVLITHEMEVVKRICDRVAVMEKGEVVEEGTVEEVFANP 232 >gnl|CDD|31326 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms]. Length = 293 Score = 174 bits (443), Expect = 3e-44 Identities = 86/289 (29%), Positives = 140/289 (48%), Gaps = 11/289 (3%) Query: 30 IKKHDKVSEYGMVSAVIK-ANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLV 88 I+ + +YG + + EV+ GEI L+G +GAGK+TLL+ + GL GE+LV Sbjct: 5 IEVRNLTKKYGGDKTALDGVSFEVEPGEIFGLLGPNGAGKTTLLKILAGLLKPTSGEILV 64 Query: 89 DTDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKS 148 P K+R + V Q+ +L P TV N+E + E + Sbjct: 65 LGYDVVKEP--------AKVRRR-IGYVPQEPSLYPELTVRENLEFFARLYGLSKEEAEE 115 Query: 149 RVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRL 208 R+ E LE+ L A+ K+ LSGGMKQR+ A A +L++DEP S LDP R + Sbjct: 116 RIEELLELFGLEDKANKKVRTLSGGMKQRLSIALALLHDPELLILDEPTSGLDPESRREI 175 Query: 209 QDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSE 268 + L L ++ TI+ +H + EA L +R+ I+ G+II GTP+E+ V E Sbjct: 176 WELLRELAKEGGVTILLSTHILEEAEELCDRVIILNDGKIIAEGTPEELKEKFGGKGVIE 235 Query: 269 FIQKLNPITALVAADVMRVCSIDDESNIVHKISRQMPLIDIIDMVADNL 317 + + L+ + V ++ + I+ + + I+ I++ +L Sbjct: 236 LEPERLELAELL-EGLKLVKGEEELAEILEALLEEGVKIESIEVKEPSL 283 >gnl|CDD|31323 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]. Length = 240 Score = 173 bits (441), Expect = 5e-44 Identities = 87/239 (36%), Positives = 128/239 (53%), Gaps = 15/239 (6%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPY 98 +G + +L V+KGE++V++G SG+GKSTLLR +NGL G + VD G Sbjct: 12 FGDKEVLKGISLSVEKGEVVVIIGPSGSGKSTLLRCLNGLEEPDSGSITVD---GEDVGD 68 Query: 99 AADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGL-EFLDIPDVERKSRVAEHLEIV 157 D LR+ V MVFQQF L P TV NV L + + E + + E LE V Sbjct: 69 KKDILKLRRK----VGMVFQQFNLFPHLTVLENVTLAPVKVKKLSKAEAREKALELLEKV 124 Query: 158 NLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQR 217 L AD LSGG +QRV ARA A ++L DEP S+LDP L E+L + + Sbjct: 125 GLADKADAYPAQLSGGQQQRVAIARALAMDPKVMLFDEPTSALDP----ELVGEVLDVMK 180 Query: 218 KLKK---TIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEFIQKL 273 L + T++ V+H++ A + +R+ M+ G+II+ G P+E +P + +F+ K+ Sbjct: 181 DLAEEGMTMIIVTHEMGFAREVADRVIFMDQGKIIEEGPPEEFFDNPKSERTRQFLSKI 239 >gnl|CDD|73020 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 235 Score = 171 bits (436), Expect = 2e-43 Identities = 86/222 (38%), Positives = 125/222 (56%), Gaps = 7/222 (3%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 +L+V++GEIL ++G SG+GKSTLLR I GL GEVL+D + L +L Sbjct: 20 DLDVRRGEILAIIGPSGSGKSTLLRLIVGLLRPDSGEVLIDG----EDISGLSEAELYRL 75 Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGL-EFLDIPDVERKSRVAEHLEIVNLTKWADCKI 167 R + M+FQ AL TV NV L E + + E + V E LE V L D Sbjct: 76 RRR-MGMLFQSGALFDSLTVFENVAFPLREHTRLSEEEIREIVLEKLEAVGLRGAEDLYP 134 Query: 168 NMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVS 227 LSGGMK+RV ARA A +LL DEP + LDP+ + D + +L+++L T + V+ Sbjct: 135 AELSGGMKKRVALARALALDPELLLYDEPTAGLDPIASGVIDDLIRSLKKELGLTSIMVT 194 Query: 228 HDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEF 269 HD++ AF + +RIA++ G+I+ GTP+E+ + V +F Sbjct: 195 HDLDTAFAIADRIAVLYDGKIVAEGTPEELRASD-DPLVRQF 235 >gnl|CDD|73060 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK. ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles. ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP. In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.. Length = 213 Score = 168 bits (428), Expect = 2e-42 Identities = 79/223 (35%), Positives = 121/223 (54%), Gaps = 10/223 (4%) Query: 30 IKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD 89 ++ + +G V+A+ NL++ GE +VL+G SG GK+T LR I GL G + + Sbjct: 1 VELENVTKRFGNVTALDDLNLDIADGEFVVLLGPSGCGKTTTLRMIAGLEEPTSGRIYIG 60 Query: 90 TDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSR 149 + + D ++ +MVFQ +AL P TV N+ GL+ +P E R Sbjct: 61 -GRDVTDLPPKDRDI---------AMVFQNYALYPHMTVYDNIAFGLKLRKVPKDEIDER 110 Query: 150 VAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQ 209 V E E++ + D K LSGG +QRV RA + LMDEP S+LD +R++++ Sbjct: 111 VREVAELLQIEHLLDRKPKQLSGGQRQRVALGRAIVREPKVFLMDEPLSNLDAKLRVQMR 170 Query: 210 DELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCG 252 EL LQ++L T ++V+HD EA + +RIA+M G+I Q G Sbjct: 171 AELKRLQQRLGTTTIYVTHDQVEAMTMADRIAVMNDGQIQQIG 213 >gnl|CDD|31320 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]. Length = 539 Score = 168 bits (428), Expect = 2e-42 Identities = 87/249 (34%), Positives = 135/249 (54%), Gaps = 10/249 (4%) Query: 27 RYSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEV 86 RY +K V E G V AV + ++++GE L L+G SG+GKSTL R + GL P G + Sbjct: 289 RYGSRKGLFVRERGEVKAVDDVSFDLREGETLGLVGESGSGKSTLARILAGLLPPSSGSI 348 Query: 87 LVDTDKGFVNPYAADANVLRKLRMHTVSMVFQ--QFALLPWRTVARNVELGLEF-LDIPD 143 + D LR+LR + MVFQ +L P TV + L Sbjct: 349 IFDGQ-----DLDLTGGELRRLR-RRIQMVFQDPYSSLNPRMTVGDILAEPLRIHGGGSG 402 Query: 144 VERKSRVAEHLEIVNL-TKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDP 202 ER++RVAE LE+V L ++ D + LSGG +QRV ARA A +L++DEP S+LD Sbjct: 403 AERRARVAELLELVGLPPEFLDRYPHELSGGQRQRVAIARALALEPKLLILDEPVSALDV 462 Query: 203 LIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPA 262 ++ ++ + L LQ +L T +F+SHD+ + +R+A+M GRI++ G +++ +P Sbjct: 463 SVQAQVLNLLKDLQEELGLTYLFISHDLAVVRYIADRVAVMYDGRIVEEGPTEKVFENPQ 522 Query: 263 NCYVSEFIQ 271 + Y + + Sbjct: 523 HPYTRKLLA 531 Score = 147 bits (372), Expect = 5e-36 Identities = 80/251 (31%), Positives = 128/251 (50%), Gaps = 13/251 (5%) Query: 37 SEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAP----VVRGEVLVDTDK 92 ++ G V AV + EV+ GEIL ++G SG+GKSTL ++ GL P + GEV++D Sbjct: 17 TDGGRVPAVRDVSFEVEPGEILGIVGESGSGKSTLALALMGLLPEGGRITSGEVILDG-- 74 Query: 93 GFVNPYAADANVLRKLRMHTVSMVFQ-QFALL-PWRTVARNVELGLEFLDIPDV-ERKSR 149 + +RKLR ++M+FQ L P T+ + L E + R Sbjct: 75 --RDLLGLSEREMRKLRGKRIAMIFQDPMTSLNPVMTIGDQIREALRLHGKGSRAEARKR 132 Query: 150 VAEHLEIVNL--TKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMR 207 E LE V L + D + LSGGM+QRV A A A +L+ DEP ++LD + + Sbjct: 133 AVELLEQVGLPDPERRDRYPHQLSGGMRQRVMIAMALALKPKLLIADEPTTALDVTTQAQ 192 Query: 208 LQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVS 267 + D L LQR+L ++F++HD+ L +R+ +M G I++ G +EI+ +P + Y Sbjct: 193 ILDLLKDLQRELGMAVLFITHDLGVVAELADRVVVMYKGEIVETGPTEEILSNPQHPYTR 252 Query: 268 EFIQKLNPITA 278 + + + Sbjct: 253 GLLAAVPRLGD 263 >gnl|CDD|73055 cd03296, ABC_CysA_sulfate_importer, Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 239 Score = 166 bits (422), Expect = 9e-42 Identities = 92/247 (37%), Positives = 131/247 (53%), Gaps = 14/247 (5%) Query: 28 YSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVL 87 SI+ + +G A+ +L++ GE++ L+G SG+GK+TLLR I GL G +L Sbjct: 1 MSIEVRNVSKRFGDFVALDDVSLDIPSGELVALLGPSGSGKTTLLRLIAGLERPDSGTIL 60 Query: 88 VDTDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDI----PD 143 + DA ++ V VFQ +AL TV NV GL P+ Sbjct: 61 FGGE---------DATD-VPVQERNVGFVFQHYALFRHMTVFDNVAFGLRVKPRSERPPE 110 Query: 144 VERKSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPL 203 E +++V E L++V L AD LSGG +QRV ARA A +LL+DEPF +LD Sbjct: 111 AEIRAKVHELLKLVQLDWLADRYPAQLSGGQRQRVALARALAVEPKVLLLDEPFGALDAK 170 Query: 204 IRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPAN 263 +R L+ L L +L T VFV+HD EA + +R+ +M GRI Q GTP E+ HPA+ Sbjct: 171 VRKELRRWLRRLHDELHVTTVFVTHDQEEALEVADRVVVMNKGRIEQVGTPDEVYDHPAS 230 Query: 264 CYVSEFI 270 +V F+ Sbjct: 231 PFVYSFL 237 >gnl|CDD|73014 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.. Length = 218 Score = 166 bits (421), Expect = 1e-41 Identities = 75/200 (37%), Positives = 100/200 (50%), Gaps = 5/200 (2%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 +L ++KGE + ++G SG+GKSTLL + GL GEV VD + L Sbjct: 24 SLSIEKGEFVAIVGPSGSGKSTLLNILGGLDRPTSGEVRVDG----TDISKLSEKELAAF 79 Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKIN 168 R + VFQ F LLP T NVEL L +P ER+ R E LE V L + + Sbjct: 80 RRRHIGFVFQSFNLLPDLTALENVELPLLLAGVPKKERRERAEELLERVGLGDRLNHYPS 139 Query: 169 MLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSH 228 LSGG +QRV ARA A I+L DEP +LD + + L L ++ TIV V+H Sbjct: 140 ELSGGQQQRVAIARALANDPKIILADEPTGNLDSETGKEVMELLRELNKEAGTTIVVVTH 199 Query: 229 DINEAFRLGNRIAIMEGGRI 248 D A +RI + G+I Sbjct: 200 DPELA-EYADRIIELRDGKI 218 >gnl|CDD|73058 cd03299, ABC_ModC_like, Archeal protein closely related to ModC. ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 235 Score = 164 bits (416), Expect = 4e-41 Identities = 78/223 (34%), Positives = 129/223 (57%), Gaps = 12/223 (5%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD-TDKGFVNPYAADANVLRK 107 +LEV++G+ V++G +G+GKS LL +I G G++L++ D + P Sbjct: 19 SLEVERGDYFVILGPTGSGKSVLLETIAGFIKPDSGKILLNGKDITNLPP---------- 68 Query: 108 LRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKI 167 +S V Q +AL P TV +N+ GL+ + E + +V E E++ + + K Sbjct: 69 -EKRDISYVPQNYALFPHMTVYKNIAYGLKKRKVDKKEIERKVLEIAEMLGIDHLLNRKP 127 Query: 168 NMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVS 227 LSGG +QRV ARA ILL+DEPFS+LD + +L++EL ++++ T++ V+ Sbjct: 128 ETLSGGEQQRVAIARALVVNPKILLLDEPFSALDVRTKEKLREELKKIRKEFGVTVLHVT 187 Query: 228 HDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEFI 270 HD EA+ L +++AIM G++IQ G P+E+ P N +V+EF+ Sbjct: 188 HDFEEAWALADKVAIMLNGKLIQVGKPEEVFKKPKNEFVAEFL 230 >gnl|CDD|72988 cd03229, ABC_Class3, This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 178 Score = 162 bits (412), Expect = 1e-40 Identities = 75/218 (34%), Positives = 110/218 (50%), Gaps = 40/218 (18%) Query: 30 IKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD 89 ++ + YG + + +L ++ GEI+ L+G SG+GKSTLLR I GL G +L+D Sbjct: 1 LELKNVSKRYGQKTVLNDVSLNIEAGEIVALLGPSGSGKSTLLRCIAGLEEPDSGSILID 60 Query: 90 TDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSR 149 + + L LR + MVFQ FAL P TV N+ LGL Sbjct: 61 GE-----DLTDLEDELPPLRRR-IGMVFQDFALFPHLTVLENIALGL------------- 101 Query: 150 VAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQ 209 SGG +QRV ARA A +LL+DEP S+LDP+ R ++ Sbjct: 102 ---------------------SGGQQQRVALARALAMDPDVLLLDEPTSALDPITRREVR 140 Query: 210 DELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGR 247 L +LQ +L T+V V+HD++EA RL +R+ ++ G+ Sbjct: 141 ALLKSLQAQLGITVVLVTHDLDEAARLADRVVVLRDGK 178 >gnl|CDD|34177 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 259 Score = 156 bits (397), Expect = 6e-39 Identities = 76/215 (35%), Positives = 113/215 (52%), Gaps = 15/215 (6%) Query: 42 VSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAAD 101 SA+ +L + GE++V++G SG GK+TLL I G RG + ++ + P A Sbjct: 18 RSALEDVSLTIASGELVVVLGPSGCGKTTLLNLIAGFVTPSRGSIQLN-GRRIEGPGAER 76 Query: 102 ANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTK 161 +VFQ ALLPW V NV GL+ I +R+ + L +V L Sbjct: 77 G------------VVFQNEALLPWLNVIDNVAFGLQLRGIEKAQRREIAHQMLALVGLEG 124 Query: 162 WADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKK 221 I LSGGM+QRVG ARA A +LL+DEPF +LD L R ++Q+ LL L ++ K Sbjct: 125 AEHKYIWQLSGGMRQRVGIARALAVEPQLLLLDEPFGALDALTREQMQELLLDLWQETGK 184 Query: 222 TIVFVSHDINEAFRLGNRIAIMEG--GRIIQCGTP 254 ++ ++HDI EA L R+ ++ GR+++ Sbjct: 185 QVLLITHDIEEALFLATRLVVLSPGPGRVVERLPL 219 >gnl|CDD|31324 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]. Length = 263 Score = 156 bits (397), Expect = 6e-39 Identities = 83/225 (36%), Positives = 128/225 (56%), Gaps = 10/225 (4%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 +L+V +GEIL ++G SG+GKSTLLR I GL +GE+L+D + + L ++ Sbjct: 28 DLDVPRGEILAILGGSGSGKSTLLRLILGLLRPDKGEILIDGE----DIPQLSEEELYEI 83 Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGL-EFLDIPDVERKSRVAEHLEIVNLT-KWADCK 166 R + ++FQQ AL TV NV L E +P+ + V LE+V L AD Sbjct: 84 RKR-MGVLFQQGALFSSLTVFENVAFPLREHTKLPESLIRELVLMKLELVGLRGAAADLY 142 Query: 167 INMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLA-LQRKLKKTIVF 225 + LSGGM++RV ARA A +L +DEP S LDP I + DEL+ L L T++ Sbjct: 143 PSELSGGMRKRVALARAIALDPELLFLDEPTSGLDP-ISAGVIDELIRELNDALGLTVIM 201 Query: 226 VSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEFI 270 V+HD++ + +R+A++ G++I GTP+E++ + +V +F Sbjct: 202 VTHDLDSLLTIADRVAVLADGKVIAEGTPEELLASD-DPWVRQFF 245 >gnl|CDD|30793 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]. Length = 316 Score = 155 bits (394), Expect = 1e-38 Identities = 81/249 (32%), Positives = 132/249 (53%), Gaps = 18/249 (7%) Query: 38 EYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAP-----VVRGEVLVDTDK 92 + G+V AV + E+KKGEIL ++G SG+GKS L ++I GL P +V GE+L D Sbjct: 14 DAGVVKAVDGVSFELKKGEILGIVGESGSGKSVLAKAIMGLLPKPNARIVGGEILFDGK- 72 Query: 93 GFVNPYAADANVLRKLRMHTVSMVFQ--QFALLPWRTVARNVELGLE--FLDIPDVERKS 148 + + LRK+R ++M+FQ +L P T+ + L + E K Sbjct: 73 ---DLLSLSEKELRKIRGKEIAMIFQDPMTSLNPVMTIGDQIAEVLRLHGKGLSKKEAKE 129 Query: 149 RVAEHLEIVNLTKWADCKINM----LSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLI 204 R E LE+V + + ++ LSGGM+QRV A A A +L+ DEP ++LD + Sbjct: 130 RAIELLELVGIPD-PERRLKSYPHELSGGMRQRVMIAMALALNPKLLIADEPTTALDVTV 188 Query: 205 RMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANC 264 + ++ D L LQR+ ++ ++HD+ + +R+A+M GRI++ G +EI +P + Sbjct: 189 QAQILDLLKELQREKGTALILITHDLGVVAEIADRVAVMYAGRIVEEGPVEEIFKNPKHP 248 Query: 265 YVSEFIQKL 273 Y + L Sbjct: 249 YTRGLLNSL 257 >gnl|CDD|31331 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]. Length = 226 Score = 155 bits (393), Expect = 2e-38 Identities = 76/208 (36%), Positives = 106/208 (50%), Gaps = 6/208 (2%) Query: 42 VSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAAD 101 V A+ NLE++ GE + ++G SG+GKSTLL + GL GEVL++ + Sbjct: 18 VEALKDVNLEIEAGEFVAIVGPSGSGKSTLLNLLGGLDKPTSGEVLING----KDLTKLS 73 Query: 102 ANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTK 161 L KLR + VFQ F LLP TV NVEL L RK E LE++ L Sbjct: 74 EKELAKLRRKKIGFVFQNFNLLPDLTVLENVELPLLIAGKSAGRRKRAAEELLEVLGLED 133 Query: 162 WADCK-INMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLK 220 K + LSGG +QRV ARA I+L DEP +LD + + L L ++ Sbjct: 134 RLLKKKPSELSGGQQQRVAIARALINNPKIILADEPTGNLDSKTAKEVLELLRELNKERG 193 Query: 221 KTIVFVSHDINEAFRLGNRIAIMEGGRI 248 KTI+ V+HD E + +R+ ++ G+I Sbjct: 194 KTIIMVTHD-PELAKYADRVIELKDGKI 220 >gnl|CDD|31319 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 235 Score = 154 bits (390), Expect = 4e-38 Identities = 86/217 (39%), Positives = 117/217 (53%), Gaps = 14/217 (6%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 +LE++KGE ++L+G +G+GKSTLL+ +NGL GEVLVD G LR+ Sbjct: 24 SLEIEKGERVLLIGPNGSGKSTLLKLLNGLLKPTSGEVLVD---GLDTSSEKSLLELRQ- 79 Query: 109 RMHTVSMVFQ----QFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWAD 164 V +VFQ Q TV V GLE L +P E + RVAE LE+V L + D Sbjct: 80 ---KVGLVFQNPDDQLFG---PTVEDEVAFGLENLGLPREEIEERVAEALELVGLEELLD 133 Query: 165 CKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIV 224 LSGG KQRV A A G ILL+DEP + LDP R L + L L+ + KTI+ Sbjct: 134 RPPFNLSGGQKQRVAIAGVLAMGPEILLLDEPTAGLDPKGRRELLELLKKLKEEGGKTII 193 Query: 225 FVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHP 261 V+HD+ +R+ +++ G+I+ G P EI Sbjct: 194 IVTHDLELVLEYADRVVVLDDGKILADGDPAEIFNDA 230 >gnl|CDD|31317 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]. Length = 258 Score = 154 bits (390), Expect = 4e-38 Identities = 78/224 (34%), Positives = 117/224 (52%), Gaps = 12/224 (5%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPY 98 YG + + + KGEI ++G +G+GKSTLL+ + GL GEVL+D + Sbjct: 12 YGGKPILDDLSFSIPKGEITGILGPNGSGKSTLLKCLAGLLKPKSGEVLLDG----KDIA 67 Query: 99 AADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELG----LEFLDIPDVERKSRVAEHL 154 + L K ++ V Q + TV V LG L P E + V E L Sbjct: 68 SLSPKELAK----KLAYVPQSPSAPFGLTVYELVLLGRYPHLGLFGRPSKEDEEIVEEAL 123 Query: 155 EIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLA 214 E++ L AD ++ LSGG +QRV ARA A PILL+DEP S LD ++ + + L Sbjct: 124 ELLGLEHLADRPVDELSGGERQRVLIARALAQETPILLLDEPTSHLDIAHQIEVLELLRD 183 Query: 215 LQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEII 258 L R+ T+V V HD+N A R + + +++ G+I+ GTP+E++ Sbjct: 184 LNREKGLTVVMVLHDLNLAARYADHLILLKDGKIVAQGTPEEVL 227 >gnl|CDD|72984 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.. Length = 211 Score = 153 bits (389), Expect = 5e-38 Identities = 82/203 (40%), Positives = 112/203 (55%), Gaps = 16/203 (7%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 +L +KKGE ++++G +G+GKSTLLR +NGL GEVLVD L++L Sbjct: 21 SLTIKKGEFVLIVGPNGSGKSTLLRLLNGLLGPTSGEVLVD-------GKDLTKLSLKEL 73 Query: 109 RMHTVSMVFQ----QFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWAD 164 R V +VFQ QF TV V GLE L +P+ E + RV E LE+V L D Sbjct: 74 RRK-VGLVFQNPDDQFFGP---TVEEEVAFGLENLGLPEEEIEERVEEALELVGLEGLRD 129 Query: 165 CKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIV 224 LSGG KQRV A A ILL+DEP + LDP R L + L L+ + KTI+ Sbjct: 130 RSPFTLSGGQKQRVAIAGVLAMDPDILLLDEPTAGLDPAGRRELLELLKKLKAE-GKTII 188 Query: 225 FVSHDINEAFRLGNRIAIMEGGR 247 V+HD++ L +R+ ++E G+ Sbjct: 189 IVTHDLDLLLELADRVIVLEDGK 211 >gnl|CDD|73021 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively. Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP. HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM. The two HisP subunits form a homodimer within the complex. The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems. All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria. The best-studied member of the PAAT (polar amino acid transport) family is the HisJQMP system of S. typhimurium, where HisJ is the extracellular solute binding proteins and HisP is the ABC protein.. Length = 213 Score = 151 bits (384), Expect = 2e-37 Identities = 83/223 (37%), Positives = 118/223 (52%), Gaps = 14/223 (6%) Query: 30 IKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD 89 I+ + +G + +L VKKGE++V++G SG+GKSTLLR IN L G +++D Sbjct: 1 IEIKNLHKSFGDFHVLKGIDLTVKKGEVVVIIGPSGSGKSTLLRCINLLEEPDSGTIIID 60 Query: 90 TDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGL-EFLDIPDVERKS 148 K D + +LR V MVFQQF L P TV N+ L + + E + Sbjct: 61 GLK-----LTDDKKNINELRQK-VGMVFQQFNLFPHLTVLENITLAPIKVKGMSKAEAEE 114 Query: 149 RVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRL 208 R E LE V L AD LSGG +QRV ARA A ++L DEP S+LDP L Sbjct: 115 RALELLEKVGLADKADAYPAQLSGGQQQRVAIARALAMNPKVMLFDEPTSALDP----EL 170 Query: 209 QDELLALQRKLKK---TIVFVSHDINEAFRLGNRIAIMEGGRI 248 E+L + + L + T+V V+H++ A + +R+ M+ GRI Sbjct: 171 VGEVLDVMKDLAEEGMTMVVVTHEMGFAREVADRVIFMDDGRI 213 >gnl|CDD|33436 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 258 Score = 150 bits (381), Expect = 4e-37 Identities = 78/217 (35%), Positives = 116/217 (53%), Gaps = 13/217 (5%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 NLE+ +GE++ ++G SGAGKSTLLRS+NGL GE+L + V LRKL Sbjct: 24 NLEINQGEMVAIIGPSGAGKSTLLRSLNGLVDPTSGEILFNG----VQITKLKGKELRKL 79 Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGL--------EFLDIPDVERKSRVAEHLEIVNLT 160 R + M+FQQF L+P +V NV LG + E K++ + LE V + Sbjct: 80 RRD-IGMIFQQFNLVPRLSVLENVLLGRLGYTSTWRSLFGLFSKEDKAQALDALERVGIL 138 Query: 161 KWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLK 220 A + + LSGG +QRV ARA I+L DEP +SLDP ++ D L + ++ Sbjct: 139 DKAYQRASTLSGGQQQRVAIARALVQQPKIILADEPVASLDPESAKKVMDILKDINQEDG 198 Query: 221 KTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEI 257 T++ H ++ A + +RI ++ GRI+ G E+ Sbjct: 199 ITVIVNLHQVDLAKKYADRIIGLKAGRIVFDGPASEL 235 >gnl|CDD|73016 cd03257, ABC_NikE_OppD_transporters, The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE). The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE). The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis. The molecular mechanism of nickel uptake in many bacteria and most archaea is not known. Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides. The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.. Length = 228 Score = 149 bits (379), Expect = 9e-37 Identities = 74/218 (33%), Positives = 114/218 (52%), Gaps = 10/218 (4%) Query: 40 GMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYA 99 G V A+ + +KKGE L L+G SG+GKSTL R+I GL G ++ D Sbjct: 16 GSVKALDDVSFSIKKGETLGLVGESGSGKSTLARAILGLLKPTSGSIIFDG-----KDLL 70 Query: 100 ADANVLRKLRMHTVSMVFQ--QFALLPWRTVARNVELGLEFLDIPDVE--RKSRVAEHLE 155 + LRK+R + MVFQ +L P T+ + L + RK V L Sbjct: 71 KLSRRLRKIRRKEIQMVFQDPMSSLNPRMTIGEQIAEPLRIHGKLSKKEARKEAVLLLLV 130 Query: 156 IVNLTK-WADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLA 214 V L + + + LSGG +QRV ARA A +L+ DEP S+LD ++ ++ D L Sbjct: 131 GVGLPEEVLNRYPHELSGGQRQRVAIARALALNPKLLIADEPTSALDVSVQAQILDLLKK 190 Query: 215 LQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCG 252 LQ +L T++F++HD+ ++ +R+A+M G+I++ G Sbjct: 191 LQEELGLTLLFITHDLGVVAKIADRVAVMYAGKIVEEG 228 >gnl|CDD|73022 cd03263, ABC_subfamily_A, The ABCA subfamily mediates the transport of a variety of lipid compounds. Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders. The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis. The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle. The ABCA genes are not present in yeast. However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.. Length = 220 Score = 149 bits (378), Expect = 9e-37 Identities = 73/229 (31%), Positives = 115/229 (50%), Gaps = 11/229 (4%) Query: 29 SIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLV 88 I+ K + G AV +L V KGEI L+G +GAGK+T L+ + G G Sbjct: 2 QIRNLTKTYKKGTKPAVDDLSLNVYKGEIFGLLGHNGAGKTTTLKMLTGELRPTSGTA-- 59 Query: 89 DTDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKS 148 ++N Y+ + + R + Q AL TV ++ +P E K Sbjct: 60 -----YINGYSIRTD-RKAARQS-LGYCPQFDALFDELTVREHLRFYARLKGLPKSEIKE 112 Query: 149 RVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRL 208 V L ++ LT A+ + LSGGMK+++ A A G +LL+DEP S LDP R + Sbjct: 113 EVELLLRVLGLTDKANKRARTLSGGMKRKLSLAIALIGGPSVLLLDEPTSGLDPASRRAI 172 Query: 209 QDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEI 257 D +L +++ ++I+ +H ++EA L +RIAIM G++ G+PQE+ Sbjct: 173 WDLILEVRK--GRSIILTTHSMDEAEALCDRIAIMSDGKLRCIGSPQEL 219 >gnl|CDD|73015 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosphonate transport system. Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond. Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond. Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 241 Score = 149 bits (377), Expect = 1e-36 Identities = 78/218 (35%), Positives = 110/218 (50%), Gaps = 15/218 (6%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLV-DTDKGFVNPYAADANVLRK 107 +L + GE + L+G SGAGKSTLLR +NGL G VL+ TD + A LR+ Sbjct: 21 SLSINPGEFVALIGPSGAGKSTLLRCLNGLVEPTSGSVLIDGTDINKLKGKA-----LRQ 75 Query: 108 LRMHTVSMVFQQFALLPWRTVARNVELGL--------EFLDIPDVERKSRVAEHLEIVNL 159 LR + M+FQQF L+ +V NV G + E K R LE V L Sbjct: 76 LRRQ-IGMIFQQFNLIERLSVLENVLSGRLGRRSTWRSLFGLFPKEEKQRALAALERVGL 134 Query: 160 TKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKL 219 A + + LSGG +QRV ARA ++L DEP +SLDP ++ D L + R+ Sbjct: 135 LDKAYQRADQLSGGQQQRVAIARALMQQPKLILADEPVASLDPASSRQVMDLLKRINREE 194 Query: 220 KKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEI 257 T++ H ++ A +RI ++ GRI+ G P E+ Sbjct: 195 GITVIVSLHQVDLAREYADRIVGLKDGRIVFDGPPAEL 232 >gnl|CDD|73019 cd03260, ABC_PstB_phosphate_transporter, Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient. The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes. The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system. PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein. PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).. Length = 227 Score = 148 bits (374), Expect = 3e-36 Identities = 82/228 (35%), Positives = 124/228 (54%), Gaps = 17/228 (7%) Query: 38 EYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPV-----VRGEVLVDTDK 92 YG A+ +L++ KGEI L+G SG GKSTLLR +N L + GEVL+D Sbjct: 9 YYGDKHALKDISLDIPKGEITALIGPSGCGKSTLLRLLNRLNDLIPGAPDEGEVLLDGK- 67 Query: 93 GFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDI-PDVERKSRVA 151 + Y D +VL LR V MVFQ+ P ++ NV GL I E RV Sbjct: 68 ---DIYDLDVDVLE-LRR-RVGMVFQKPNPFP-GSIYDNVAYGLRLHGIKLKEELDERVE 121 Query: 152 EHLEIVNLTKWADCKINM--LSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQ 209 E L L +++ LSGG +QR+ ARA A +LL+DEP S+LDP+ +++ Sbjct: 122 EALRKAALWDEVKDRLHALGLSGGQQQRLCLARALANEPEVLLLDEPTSALDPISTAKIE 181 Query: 210 DELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEI 257 + + L+++ TIV V+H++ +A R+ +R A + GR+++ G ++I Sbjct: 182 ELIAELKKEY--TIVIVTHNMQQAARVADRTAFLLNGRLVEFGPTEQI 227 >gnl|CDD|31321 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]. Length = 252 Score = 147 bits (372), Expect = 5e-36 Identities = 78/232 (33%), Positives = 130/232 (56%), Gaps = 12/232 (5%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 +LE+++GE L ++G SG+GKSTL R + GL G +L+D P A K Sbjct: 27 SLEIERGETLGIVGESGSGKSTLARLLAGLEKPSSGSILLDG-----KPLAPKKR--AKA 79 Query: 109 RMHTVSMVFQ--QFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNL-TKWADC 165 V MVFQ +L P RTV R + L + ++ R+AE L+ V L + D Sbjct: 80 FYRPVQMVFQDPYSSLNPRRTVGRILSEPLRPHGLSKSQQ--RIAELLDQVGLPPSFLDR 137 Query: 166 KINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVF 225 + + LSGG +QR+ ARA +L++DEP S+LD ++ ++ + LL L+++ T +F Sbjct: 138 RPHELSGGQRQRIAIARALIPEPKLLILDEPTSALDVSVQAQILNLLLELKKERGLTYLF 197 Query: 226 VSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEFIQKLNPIT 277 +SHD+ + +RIA+M+ G+I++ G +E++ HP++ Y E ++ + I Sbjct: 198 ISHDLALVEHMCDRIAVMDNGQIVEIGPTEELLSHPSHPYTRELLEAVPSID 249 >gnl|CDD|73056 cd03297, ABC_ModC_molybdenum_transporter, ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 214 Score = 144 bits (364), Expect = 4e-35 Identities = 77/205 (37%), Positives = 109/205 (53%), Gaps = 18/205 (8%) Query: 54 KGEILVLMGLSGAGKSTLLRSINGLAPVVRGE------VLVDTDKGFVNPYAADANVLRK 107 E+ + G SGAGKSTLLR I GL G VL D+ K P Sbjct: 22 NEEVTGIFGASGAGKSTLLRCIAGLEKPDGGTIVLNGTVLFDSRKKINLP---------- 71 Query: 108 LRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKI 167 + + +VFQQ+AL P V N+ GL+ + E + V E L+++ L + Sbjct: 72 PQQRKIGLVFQQYALFPHLNVRENLAFGLKRKR--NREDRISVDELLDLLGLDHLLNRYP 129 Query: 168 NMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVS 227 LSGG KQRV ARA A +LL+DEPFS+LD +R++L EL +++ L ++FV+ Sbjct: 130 AQLSGGEKQRVALARALAAQPELLLLDEPFSALDRALRLQLLPELKQIKKNLNIPVIFVT 189 Query: 228 HDINEAFRLGNRIAIMEGGRIIQCG 252 HD++EA L +RI +ME GR+ G Sbjct: 190 HDLSEAEYLADRIVVMEDGRLQYIG 214 >gnl|CDD|31325 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism]. Length = 500 Score = 136 bits (344), Expect = 8e-33 Identities = 68/221 (30%), Positives = 117/221 (52%), Gaps = 24/221 (10%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDK-GFVNP 97 +G V A+ +L V+ GE+ L+G +GAGKSTL++ ++G+ P GE+L+D F +P Sbjct: 18 FGGVKALDGVSLTVRPGEVHALLGENGAGKSTLMKILSGVYPPDSGEILIDGKPVAFSSP 77 Query: 98 YAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLE------FLDIPDVERKSRVA 151 A ++ V Q+ +L+P +VA N+ LG E +D + R++R Sbjct: 78 RDA--------LAAGIATVHQELSLVPNLSVAENIFLGREPTRRFGLIDRKAMRRRAREL 129 Query: 152 EHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDE 211 L + L D + LS +Q V ARA + A +L++DEP ++L + + Sbjct: 130 --LARLGLDIDPDTLVGDLSIAQRQMVEIARALSFDARVLILDEPTAALTV----KETER 183 Query: 212 LLALQRKLKK---TIVFVSHDINEAFRLGNRIAIMEGGRII 249 L L R+LK I+++SH ++E F + +RI ++ GR++ Sbjct: 184 LFDLIRRLKAQGVAIIYISHRLDEVFEIADRITVLRDGRVV 224 Score = 86.7 bits (215), Expect = 8e-18 Identities = 62/223 (27%), Positives = 102/223 (45%), Gaps = 17/223 (7%) Query: 35 KVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGF 94 +V V + V+ GEIL + GL GAG++ L R++ G P GE+L+D K Sbjct: 265 EVRNLSGGGKVRDVSFTVRAGEILGIAGLVGAGRTELARALFGARPASSGEILLD-GKPV 323 Query: 95 VNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELG-----LEFLDIPDVERKSR 149 DA K + V + L+ ++A N+ L I + ++ Sbjct: 324 RIRSPRDA---IKAGIAYVPEDRKSEGLVLDMSIAENITLASLRRFSRRGLIDRRKERAL 380 Query: 150 VAEHLEIVNL-TKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRL 208 ++ + + T + I LSGG +Q+V AR AT +L++DEP +D + Sbjct: 381 AERYIRRLRIKTPSPEQPIGTLSGGNQQKVVLARWLATDPKVLILDEPTRGID----VGA 436 Query: 209 QDELLALQRKLK---KTIVFVSHDINEAFRLGNRIAIMEGGRI 248 + E+ L R+L K I+ +S ++ E L +RI +M GRI Sbjct: 437 KAEIYRLIRELAAEGKAILMISSELPELLGLSDRILVMREGRI 479 >gnl|CDD|33632 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]. Length = 231 Score = 134 bits (338), Expect = 4e-32 Identities = 75/211 (35%), Positives = 109/211 (51%), Gaps = 12/211 (5%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLV-DTDKGFVNPYAADANVLRK 107 +L V GEI+ ++G SGAGKSTLL I G GE+L+ D P Sbjct: 19 DLTVPAGEIVAILGPSGAGKSTLLNLIAGFETPASGEILINGVDHTASPPAE-------- 70 Query: 108 LRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKI 167 VSM+FQ+ L TVA+N+ LGL + E++ +V V L + Sbjct: 71 ---RPVSMLFQENNLFAHLTVAQNIGLGLSPGLKLNAEQREKVEAAAAQVGLAGFLKRLP 127 Query: 168 NMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVS 227 LSGG +QRV AR PILL+DEPFS+LDP +R + + L + K T++ V+ Sbjct: 128 GELSGGQRQRVALARCLVREQPILLLDEPFSALDPALRAEMLALVSQLCDERKMTLLMVT 187 Query: 228 HDINEAFRLGNRIAIMEGGRIIQCGTPQEII 258 H +A R+ +R+ ++ GRI G+ QE++ Sbjct: 188 HHPEDAARIADRVVFLDNGRIAAQGSTQELL 218 >gnl|CDD|31314 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 253 Score = 132 bits (335), Expect = 1e-31 Identities = 82/243 (33%), Positives = 125/243 (51%), Gaps = 22/243 (9%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSIN---GLAPVVR--GEVLVDTDKG 93 YG A+ NL++ K ++ L+G SG GKSTLLR +N L P R GEVL+D Sbjct: 17 YGDKHALKDINLDIPKNKVTALIGPSGCGKSTLLRCLNRMNDLIPGARVEGEVLLDGKN- 75 Query: 94 FVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEH 153 + D LR+ V MVFQ+ P ++ NV GL I D E V Sbjct: 76 -IYDPKVDVVELRR----RVGMVFQKPNPFP-MSIYDNVAYGLRLHGIKDKELDEIVESS 129 Query: 154 LEIVNLTKWADCKINM------LSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMR 207 L+ L W + K + LSGG +QR+ ARA A +LLMDEP S+LDP+ ++ Sbjct: 130 LKKAAL--WDEVKDRLHKSALGLSGGQQQRLCIARALAVKPEVLLMDEPTSALDPISTLK 187 Query: 208 LQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVS 267 +++ + L++K TIV V+H++ +A R+ + A G +++ G +I +P + Sbjct: 188 IEELITELKKKY--TIVIVTHNMQQAARVSDYTAFFYLGELVEFGPTDKIFTNPKHKRTE 245 Query: 268 EFI 270 ++I Sbjct: 246 DYI 248 >gnl|CDD|31318 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]. Length = 254 Score = 132 bits (334), Expect = 1e-31 Identities = 73/230 (31%), Positives = 113/230 (49%), Gaps = 21/230 (9%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPY 98 YG + +L V+KGEI L+G +GAGKSTLL++I GL GE+ + Sbjct: 14 YGNRPVLEDISLSVEKGEITALIGPNGAGKSTLLKAILGLLKPSSGEIKIF--------- 64 Query: 99 AADANVLRKLRMHTVSMVFQQFAL---LPWRTVARNVELGLE----FLDIPDVERKSRVA 151 V ++ + + V Q+ ++ P TV V LG + + + K +V Sbjct: 65 --GKPVRKRRKRLRIGYVPQKSSVDRSFP-ITVKDVVLLGRYGKKGWFRRLNKKDKEKVD 121 Query: 152 EHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDE 211 E LE V + D +I LSGG KQRV ARA A +LL+DEPF+ +D + + D Sbjct: 122 EALERVGMEDLRDRQIGELSGGQKQRVLLARALAQNPDLLLLDEPFTGVDVAGQKEIYD- 180 Query: 212 LLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHP 261 LL R+ KT++ V+HD+ +R+ + +I G P+E++ Sbjct: 181 LLKELRQEGKTVLMVTHDLGLVMAYFDRVICLN-RHLIASGPPEEVLTEE 229 >gnl|CDD|72973 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea. Only very few species lack representatives of the siderophore family transporters. The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake. The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA. The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme. A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.. Length = 180 Score = 129 bits (327), Expect = 8e-31 Identities = 71/214 (33%), Positives = 107/214 (50%), Gaps = 42/214 (19%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPY 98 YG + + +L ++ GEI+ ++G +GAGKSTLL+++ GL GE+L+D Sbjct: 9 YGGRTVLDDLSLSIEAGEIVGILGPNGAGKSTLLKTLAGLLKPSSGEILLDG-------- 60 Query: 99 AADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVN 158 + A L + +AR + + V + LE++ Sbjct: 61 -------------------KDLASLSPKELARKI---------------AYVPQALELLG 86 Query: 159 LTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRK 218 L AD N LSGG +QRV ARA A PILL+DEP S LD ++ L + L L R+ Sbjct: 87 LAHLADRPFNELSGGERQRVLLARALAQEPPILLLDEPTSHLDIAHQIELLELLRRLARE 146 Query: 219 LKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCG 252 KT+V V HD+N A R +R+ +++ GRI+ G Sbjct: 147 RGKTVVMVLHDLNLAARYADRVILLKDGRIVAQG 180 >gnl|CDD|73024 cd03265, ABC_DrrA, DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin. In addition to DrrA, the complex includes an integral membrane protein called DrrB. DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called P-glycoprotein. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 220 Score = 128 bits (323), Expect = 2e-30 Identities = 69/230 (30%), Positives = 118/230 (51%), Gaps = 13/230 (5%) Query: 30 IKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD 89 I+ + V +YG AV + V++GEI L+G +GAGK+T ++ + L G Sbjct: 1 IEVENLVKKYGDFEAVRGVSFRVRRGEIFGLLGPNGAGKTTTIKMLTTLLKPTSGR---- 56 Query: 90 TDKGFVNPYAA--DANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERK 147 V + + +R+ + +VFQ ++ T N+ + +P ER+ Sbjct: 57 ---ATVAGHDVVREPREVRR----RIGIVFQDLSVDDELTGWENLYIHARLYGVPGAERR 109 Query: 148 SRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMR 207 R+ E L+ V L + AD + SGGM++R+ AR+ +L +DEP LDP R Sbjct: 110 ERIDELLDFVGLLEAADRLVKTYSGGMRRRLEIARSLVHRPEVLFLDEPTIGLDPQTRAH 169 Query: 208 LQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEI 257 + + + L+ + TI+ +H + EA +L +R+AI++ GRII GTP+E+ Sbjct: 170 VWEYIEKLKEEFGMTILLTTHYMEEAEQLCDRVAIIDHGRIIAEGTPEEL 219 >gnl|CDD|32710 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning]. Length = 223 Score = 128 bits (323), Expect = 3e-30 Identities = 73/201 (36%), Positives = 106/201 (52%), Gaps = 6/201 (2%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 + + KGE + L G SGAGKSTLL+ I G RG++LV+ + LR+ Sbjct: 22 SFHIPKGEFVFLTGPSGAGKSTLLKLIYGEERPTRGKILVN-GHDLSRLKGREIPFLRR- 79 Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKIN 168 + +VFQ F LLP RTV NV L L + P E + RV+E L++V L A + Sbjct: 80 ---QIGVVFQDFRLLPDRTVYENVALPLRVIGKPPREIRRRVSEVLDLVGLKHKARALPS 136 Query: 169 MLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSH 228 LSGG +QRV ARA +LL DEP +LDP + + + R L T++ +H Sbjct: 137 QLSGGEQQRVAIARAIVNQPAVLLADEPTGNLDPDLSWEIMRLFEEINR-LGTTVLMATH 195 Query: 229 DINEAFRLGNRIAIMEGGRII 249 D+ R+ +R+ +E GR++ Sbjct: 196 DLELVNRMRHRVLALEDGRLV 216 >gnl|CDD|73178 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]. Length = 268 Score = 125 bits (316), Expect = 1e-29 Identities = 71/246 (28%), Positives = 112/246 (45%), Gaps = 48/246 (19%) Query: 27 RYSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEV 86 + + K Y V AV + +K+GE L L+G SG GKSTL R I GL GE+ Sbjct: 13 YFPVGKGFGKKRY--VKAVDGVSFSIKEGETLGLVGESGCGKSTLGRLILGLEEPTSGEI 70 Query: 87 LVDTDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVER 146 L + G + + ER Sbjct: 71 LFE---------------------------------------------GKDITKLSKEER 85 Query: 147 KSRVAEHLEIVNLTK-WADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIR 205 + RV E LE V L + + + LSGG +QR+G ARA A +++ DEP S+LD ++ Sbjct: 86 RERVLELLEKVGLPEEFLYRYPHELSGGQRQRIGIARALALNPKLIVADEPVSALDVSVQ 145 Query: 206 MRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCY 265 ++ + L LQ +L T +F+SHD++ + +RIA+M G+I++ G +E+ +P + Y Sbjct: 146 AQILNLLKDLQEELGLTYLFISHDLSVVRYISDRIAVMYLGKIVEIGPTEEVFSNPLHPY 205 Query: 266 VSEFIQ 271 + Sbjct: 206 TKALLS 211 >gnl|CDD|72989 cd03230, ABC_DR_subfamily_A, This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity. In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins. Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family. The ATP-binding domain shows the highest similarity between all members of the ABC transporter family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 173 Score = 125 bits (315), Expect = 2e-29 Identities = 65/210 (30%), Positives = 98/210 (46%), Gaps = 46/210 (21%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPY 98 YG +A+ +L V+KGEI L+G +GAGK+TL++ I GL GE+ V + Sbjct: 10 YGKKTALDDISLTVEKGEIYGLLGPNGAGKTTLIKIILGLLKPDSGEIKVL----GKDIK 65 Query: 99 AADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVN 158 V R+ + + ++ +L TV N++L Sbjct: 66 KEPEEVKRR-----IGYLPEEPSLYENLTVRENLKL------------------------ 96 Query: 159 LTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRK 218 SGGMKQR+ A+A +L++DEP S LDP R + L L+++ Sbjct: 97 ------------SGGMKQRLALAQALLHDPELLILDEPTSGLDPESRREFWELLRELKKE 144 Query: 219 LKKTIVFVSHDINEAFRLGNRIAIMEGGRI 248 KTI+ SH + EA RL +R+AI+ GRI Sbjct: 145 -GKTILLSSHILEEAERLCDRVAILNNGRI 173 >gnl|CDD|33907 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism]. Length = 242 Score = 125 bits (314), Expect = 2e-29 Identities = 75/216 (34%), Positives = 112/216 (51%), Gaps = 4/216 (1%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPY 98 YG A+ L+ +GE LVL+G SGAGKS+LLR +N L G + + + + Sbjct: 12 YGAHQALFDITLDCPEGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLNIAGNHFDFSKT 71 Query: 99 AADANVLRKLRMHTVSMVFQQFALLPWRTVARN-VELGLEFLDIPDVERKSRVAEHLEIV 157 +D + R LR V MVFQQ+ L P TV N +E L + + +R + L+ + Sbjct: 72 PSDKAI-RDLR-RNVGMVFQQYNLWPHLTVQENLIEAPCRVLGLSKDQALARAEKLLKRL 129 Query: 158 NLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQR 217 L +AD LSGG +QRV ARA +LL DEP ++LDP I ++ + L Sbjct: 130 RLKPYADRYPLHLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQIVSIIKELA- 188 Query: 218 KLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGT 253 + T V V+H++ A + +R+ ME G I++ G Sbjct: 189 ETGITQVIVTHEVEVARKTASRVVYMENGHIVEQGD 224 >gnl|CDD|32455 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]. Length = 709 Score = 124 bits (313), Expect = 3e-29 Identities = 63/215 (29%), Positives = 112/215 (52%), Gaps = 19/215 (8%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD-TDKGFVNPYAADANVLRK 107 +LE+ GE + ++G SG+GKSTLL+ + GL +G +L+D D ++ + LR+ Sbjct: 493 SLEIPPGEKVAIVGRSGSGKSTLLKLLLGLYKPQQGRILLDGVDLNDIDLAS-----LRR 547 Query: 108 LRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAE-HLEIVNLTKWADCK 166 V V Q L ++ N+ LG ++ +++A H I NL D Sbjct: 548 Q----VGYVLQD-PFLFSGSIRENIALGNPEATDEEIIEAAQLAGAHEFIENLPMGYDTP 602 Query: 167 I----NMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKT 222 + LSGG +QR+ ARA + ILL+DE S+LDP + LL + + +T Sbjct: 603 VGEGGANLSGGQRQRLALARALLSKPKILLLDEATSALDPETEAIILQNLLQILQ--GRT 660 Query: 223 IVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEI 257 ++ ++H ++ R +RI +++ G+I++ G+ +E+ Sbjct: 661 VIIIAHRLS-TIRSADRIIVLDQGKIVEQGSHEEL 694 >gnl|CDD|72978 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).. Length = 236 Score = 124 bits (312), Expect = 5e-29 Identities = 72/235 (30%), Positives = 111/235 (47%), Gaps = 20/235 (8%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD-TDKGFVNP 97 +G + A+ + V+ GEI L+G +GAGK+TL I+G G VL D D + P Sbjct: 10 FGGLVALDDVSFSVRPGEIHGLIGPNGAGKTTLFNLISGFLRPTSGSVLFDGEDITGLPP 69 Query: 98 YAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLE------FLDIPDVERKS--- 148 + ++ + FQ L P TV NV + + L + Sbjct: 70 H--------EIARLGIGRTFQIPRLFPELTVLENVMVAAQARTGSGLLLARARREEREAR 121 Query: 149 -RVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMR 207 R E LE V L AD LS G ++R+ ARA AT +LL+DEP + L+P Sbjct: 122 ERAEELLERVGLADLADRPAGELSYGQQRRLEIARALATDPKLLLLDEPAAGLNPEETEE 181 Query: 208 LQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPA 262 L + + L R+ T++ V HD++ L +R+ +++ GR+I GTP E+ +P Sbjct: 182 LAELIREL-RERGITVLLVEHDMDVVMSLADRVTVLDQGRVIAEGTPDEVRNNPR 235 >gnl|CDD|72994 cd03235, ABC_Metallic_Cations, ABC component of the metal-type transporters. This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc. The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor. The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri. Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.. Length = 213 Score = 123 bits (311), Expect = 5e-29 Identities = 68/215 (31%), Positives = 102/215 (47%), Gaps = 22/215 (10%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPY 98 YG + + EVK GE L ++G +GAGKSTLL++I GL G + V Sbjct: 9 YGGHPVLEDVSFEVKPGEFLAIVGPNGAGKSTLLKAILGLLKPTSGSIRVFGKP------ 62 Query: 99 AADANVLRKLRMHTVSMVFQQFALLPWR---TVARNVELGL----EFLDIPDVERKSRVA 151 L K R + V Q + +V V +GL K++V Sbjct: 63 ------LEKER-KRIGYV-PQRRSIDRDFPISVRDVVLMGLYGHKGLFRRLSKADKAKVD 114 Query: 152 EHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDE 211 E LE V L++ AD +I LSGG +QRV ARA +LL+DEPF+ +DP + + + Sbjct: 115 EALERVGLSELADRQIGELSGGQQQRVLLARALVQDPDLLLLDEPFAGVDPKTQEDIYEL 174 Query: 212 LLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGG 246 L L+R+ TI+ V+HD+ +R+ ++ Sbjct: 175 LRELRRE-GMTILVVTHDLGLVLEYFDRVLLLNRT 208 >gnl|CDD|30760 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]. Length = 250 Score = 123 bits (311), Expect = 7e-29 Identities = 77/237 (32%), Positives = 117/237 (49%), Gaps = 21/237 (8%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD-TDKGFVNP 97 +G ++AV +LEV+ GEI+ L+G +GAGK+TL I G G V+ D + P Sbjct: 14 FGGLTAVNDVSLEVRPGEIVGLIGPNGAGKTTLFNLITGFYKPSSGTVIFRGRDITGLPP 73 Query: 98 YAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLE-------FLDIPDVERKSRV 150 + R R+ ++ FQ L P TV NV +G L P ++ R Sbjct: 74 H-------RIARL-GIARTFQITRLFPGLTVLENVAVGAHARLGLSGLLGRPRARKEERE 125 Query: 151 A-----EHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIR 205 A E LE V L + AD LS G ++R+ ARA AT +LL+DEP + L+P Sbjct: 126 ARERARELLEFVGLGELADRPAGNLSYGQQRRLEIARALATQPKLLLLDEPAAGLNPEET 185 Query: 206 MRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPA 262 L + + L+ + TI+ + HD+ L +RI ++ G +I GTP+E+ +P Sbjct: 186 EELAELIRELRDRGGVTILLIEHDMKLVMGLADRIVVLNYGEVIAEGTPEEVRNNPR 242 >gnl|CDD|73057 cd03298, ABC_ThiQ_thiamine_transporter, ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP. Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 211 Score = 122 bits (307), Expect = 1e-28 Identities = 73/206 (35%), Positives = 103/206 (50%), Gaps = 14/206 (6%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD-TDKGFVNPYAADANVLRK 107 +L +GEI ++G SG+GKSTLL I G G VL++ D P Sbjct: 18 DLTFAQGEITAIVGPSGSGKSTLLNLIAGFETPQSGRVLINGVDVTAAPPAD-------- 69 Query: 108 LRMHTVSMVFQQFALLPWRTVARNVELGLE-FLDIPDVERKSRVAEHLEIVNLTKWADCK 166 VSM+FQ+ L TV +NV LGL L + +R+ + L V L Sbjct: 70 ---RPVSMLFQENNLFAHLTVEQNVGLGLSPGLKLTAEDRQ-AIEVALARVGLAGLEKRL 125 Query: 167 INMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFV 226 LSGG +QRV AR P+LL+DEPF++LDP +R + D +L L + K T++ V Sbjct: 126 PGELSGGERQRVALARVLVRDKPVLLLDEPFAALDPALRAEMLDLVLDLHAETKMTVLMV 185 Query: 227 SHDINEAFRLGNRIAIMEGGRIIQCG 252 +H +A RL R+ ++ GRI G Sbjct: 186 THQPEDAKRLAQRVVFLDNGRIAAQG 211 >gnl|CDD|34233 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism]. Length = 256 Score = 122 bits (307), Expect = 2e-28 Identities = 77/258 (29%), Positives = 130/258 (50%), Gaps = 15/258 (5%) Query: 26 SRYSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGE 85 + +++ D YG + +L+ G+++ ++G SG+GKST LR IN L G Sbjct: 3 AENALEVEDLHKRYGEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSAGS 62 Query: 86 VLVDTDKGFVNP------YAADANVLRKLRMHTVSMVFQQFALLPWRTVARNV-ELGLEF 138 + V+ ++ + AD L++LR + MVFQ F L TV NV E + Sbjct: 63 IRVNGEEIRLKRDKDGQLKPADKRQLQRLRTR-LGMVFQHFNLWSHMTVLENVIEAPVHV 121 Query: 139 LDIPDVERKSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFS 198 L + E R ++L V + + AD LSGG +QRV ARA A ++L DEP S Sbjct: 122 LGVSKAEAIERAEKYLAKVGIAEKADAYPAHLSGGQQQRVAIARALAMEPEVMLFDEPTS 181 Query: 199 SLDPLIRMRLQDELLALQRKLK---KTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQ 255 +LDP L E+L + + L +T+V V+H++ A + + + + G+I + G P+ Sbjct: 182 ALDP----ELVGEVLKVMQDLAEEGRTMVVVTHEMGFARDVSSHVIFLHQGKIEEEGPPE 237 Query: 256 EIILHPANCYVSEFIQKL 273 ++ +P + + +F+ L Sbjct: 238 QVFGNPQSPRLKQFLSSL 255 >gnl|CDD|33636 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only]. Length = 501 Score = 120 bits (303), Expect = 5e-28 Identities = 75/231 (32%), Positives = 117/231 (50%), Gaps = 19/231 (8%) Query: 26 SRYSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGE 85 +++ + V A +L VKKGEI L+G +GAGKSTL++ + GL GE Sbjct: 1 MEPALEMRGITKRFPGVVANDDVSLSVKKGEIHALLGENGAGKSTLMKILFGLYQPDSGE 60 Query: 86 VLVDTDK-GFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDV 144 + VD + +P A + MV Q F L+P TVA N+ LGLE + Sbjct: 61 IRVDGKEVRIKSPRDA--------IRLGIGMVHQHFMLVPTLTVAENIILGLEPSKGGLI 112 Query: 145 ERK---SRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLD 201 +R+ +R+ E E L D K+ LS G +QRV +A GA +L++DEP + L Sbjct: 113 DRRQARARIKELSERYGLPVDPDAKVADLSVGEQQRVEILKALYRGARLLILDEPTAVLT 172 Query: 202 PLIRMRLQDELLALQRKLK---KTIVFVSHDINEAFRLGNRIAIMEGGRII 249 P DEL + R+L KTI+F++H + E + +R+ ++ G+++ Sbjct: 173 PQ----EADELFEILRRLAAEGKTIIFITHKLKEVMAIADRVTVLRRGKVV 219 Score = 82.5 bits (204), Expect = 2e-16 Identities = 62/240 (25%), Positives = 108/240 (45%), Gaps = 24/240 (10%) Query: 32 KHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTD 91 + V + V+AV + EV+ GEI+ + G++G G+S L+ +I+GL G +L++ Sbjct: 261 EDLSVKDRRGVTAVKDVSFEVRAGEIVGIAGVAGNGQSELVEAISGLRKPASGRILLN-- 318 Query: 92 KGFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELG---------LEFLDIP 142 G R+L + V L+ ++A N+ LG FLD Sbjct: 319 -GKDVLGRLSPRERRRLGLAYVPEDRHGHGLVLDLSLAENLVLGRHDKKPFSRGGFLDRR 377 Query: 143 DVERKS-RVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLD 201 + + + + E ++ + A LSGG +Q++ AR A +L+ +P LD Sbjct: 378 AIRKFARELIEEFDVRAPSPDA--PARSLSGGNQQKLILARELARRPDLLIAAQPTRGLD 435 Query: 202 ----PLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEI 257 I RL + R K ++ +S D++E L +RIA++ GRI+ P+E Sbjct: 436 VGAIEFIHERLLEL-----RDAGKAVLLISEDLDEILELSDRIAVIYEGRIVGIVPPEEA 490 >gnl|CDD|30759 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]. Length = 237 Score = 120 bits (302), Expect = 6e-28 Identities = 63/225 (28%), Positives = 110/225 (48%), Gaps = 9/225 (4%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPY 98 YG + A+ +LEV++GEI+ L+G +GAGK+TLL++I GL G ++ D + + Sbjct: 13 YGKIQALRGVSLEVERGEIVALLGRNGAGKTTLLKTIMGLVRPRSGRIIFDGED--ITGL 70 Query: 99 AADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIV- 157 + + V + + P TV N+ LG ++ + E E+ Sbjct: 71 PPHERARLGI-----AYVPEGRRIFPRLTVEENLLLGAYARR-DKEAQERDLEEVYELFP 124 Query: 158 NLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQR 217 L + + + LSGG +Q + ARA + +LL+DEP L P I + + + L++ Sbjct: 125 RLKERRNQRAGTLSGGEQQMLAIARALMSRPKLLLLDEPSEGLAPKIVEEIFEAIKELRK 184 Query: 218 KLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPA 262 + TI+ V + A + +R ++E GRI+ GT E++ P Sbjct: 185 EGGMTILLVEQNARFALEIADRGYVLENGRIVLSGTAAELLADPD 229 >gnl|CDD|72983 cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids. The E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.. Length = 222 Score = 117 bits (295), Expect = 5e-27 Identities = 66/221 (29%), Positives = 105/221 (47%), Gaps = 13/221 (5%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD-TDKGFVNP 97 YG + +L V +GEI+ L+G +GAGK+TLL++I GL P G + D D + P Sbjct: 10 YGKSQILFGVSLTVPEGEIVALLGRNGAGKTTLLKTIMGLLPPRSGSIRFDGRDITGLPP 69 Query: 98 YAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIV 157 + + R + V + + P TV N+ LG +RK+R+ E+ Sbjct: 70 H-------ERARA-GIGYVPEGRRIFPELTVEENLLLGAYAR--RRAKRKARLERVYELF 119 Query: 158 -NLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQ 216 L + LSGG +Q + ARA + +LL+DEP L P I + + + L Sbjct: 120 PRLKERRKQLAGTLSGGEQQMLAIARALMSRPKLLLLDEPSEGLAPKIVEEIFEAIREL- 178 Query: 217 RKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEI 257 R TI+ V + A + +R ++E GR++ GT E+ Sbjct: 179 RDEGVTILLVEQNARFALEIADRAYVLERGRVVLEGTAAEL 219 >gnl|CDD|33900 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 352 Score = 117 bits (294), Expect = 5e-27 Identities = 68/224 (30%), Positives = 106/224 (47%), Gaps = 24/224 (10%) Query: 46 IKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAP------VVRGEVLVDTDKG-FVNPY 98 + AN + I L G SG+GK++L+ I GL + G VLVD +KG F+ P Sbjct: 15 LDANFTLPARGITALFGPSGSGKTSLINMIAGLTRPDEGRIELNGRVLVDAEKGIFLPPE 74 Query: 99 AADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVN 158 R+ + VFQ L P TV N+ G+ ++ + ++ Sbjct: 75 ------KRR-----IGYVFQDARLFPHYTVRGNLRYGMWKSMRAQFDQL------VALLG 117 Query: 159 LTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRK 218 + D LSGG KQRV RA T +LLMDEP +SLD + + L L+ + Sbjct: 118 IEHLLDRYPGTLSGGEKQRVAIGRALLTAPELLLMDEPLASLDLPRKREILPYLERLRDE 177 Query: 219 LKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPA 262 + I++VSH ++E RL +R+ ++E G++ G +E+ P Sbjct: 178 INIPILYVSHSLDEVLRLADRVVVLENGKVKASGPLEEVWGSPD 221 >gnl|CDD|33919 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]. Length = 228 Score = 114 bits (287), Expect = 3e-26 Identities = 76/212 (35%), Positives = 103/212 (48%), Gaps = 7/212 (3%) Query: 40 GMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEV-LVDTDKGFVNPY 98 G +S + L VK+GE + ++G SG+GKSTLL + GL GEV L+ Sbjct: 21 GELSILKGVELVVKRGETVAIVGPSGSGKSTLLAVLAGLDDPSSGEVRLLGQPLH----- 75 Query: 99 AADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVN 158 D + LR V VFQ F L+P T NV L LE + ++ LE V Sbjct: 76 KLDEDARAALRARHVGFVFQSFHLIPNLTALENVALPLELRGESSADSRAGAKALLEAVG 135 Query: 159 LTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRK 218 L K LSGG +QRV ARAFA +L DEP +LD ++ D L AL R+ Sbjct: 136 LGKRLTHYPAQLSGGEQQRVALARAFAGRPDVLFADEPTGNLDRATGDKIADLLFALNRE 195 Query: 219 LKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQ 250 T+V V+HD A R +R + GR+++ Sbjct: 196 RGTTLVLVTHDPQLAARC-DRQLRLRSGRLVE 226 >gnl|CDD|72971 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 157 Score = 112 bits (282), Expect = 1e-25 Identities = 59/209 (28%), Positives = 88/209 (42%), Gaps = 60/209 (28%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPY 98 YG +A+ +L +K GEI+ L+G +G+GKSTLLR+I GL GE+L+D Sbjct: 9 YGGRTALDNVSLTLKAGEIVALVGPNGSGKSTLLRAIAGLLKPTSGEILIDG-------- 60 Query: 99 AADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVN 158 A + + + V Q Sbjct: 61 KDIAKLPLEELRRRIGYVPQ---------------------------------------- 80 Query: 159 LTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRK 218 LSGG +QRV ARA +LL+DEP S LDP R RL + L L + Sbjct: 81 -----------LSGGQRQRVALARALLLNPDLLLLDEPTSGLDPASRERLLELLRELAEE 129 Query: 219 LKKTIVFVSHDINEAFRLGNRIAIMEGGR 247 +T++ V+HD A +R+ +++ G+ Sbjct: 130 -GRTVIIVTHDPELAELAADRVIVLKDGK 157 >gnl|CDD|73027 cd03268, ABC_BcrA_bacitracin_resist, The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance. Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis. The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC. Bacitracin has potent antibiotic activity against gram-positive bacteria. The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin. The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC. B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.. Length = 208 Score = 111 bits (280), Expect = 2e-25 Identities = 66/211 (31%), Positives = 102/211 (48%), Gaps = 15/211 (7%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPY 98 YG + +L VKKGEI +G +GAGK+T ++ I GL GE+ D K + Sbjct: 10 YGKKRVLDDISLHVKKGEIYGFLGPNGAGKTTTMKIILGLIKPDSGEITFD-GKSYQKNI 68 Query: 99 AADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVN 158 A + + + P T N+ L L I K R+ E L++V Sbjct: 69 EALRRI---------GALIEAPGFYPNLTARENLRLLARLLGIR----KKRIDEVLDVVG 115 Query: 159 LTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRK 218 L A K+ S GMKQR+G A A +L++DEP + LDP L++ +L+L R Sbjct: 116 LKDSAKKKVKGFSLGMKQRLGIALALLGNPDLLILDEPTNGLDPDGIKELRELILSL-RD 174 Query: 219 LKKTIVFVSHDINEAFRLGNRIAIMEGGRII 249 T++ SH ++E ++ +RI I+ G++I Sbjct: 175 QGITVLISSHLLSEIQKVADRIGIINKGKLI 205 >gnl|CDD|73051 cd03292, ABC_FtsE_transporter, FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane. The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.. Length = 214 Score = 111 bits (280), Expect = 2e-25 Identities = 68/209 (32%), Positives = 97/209 (46%), Gaps = 6/209 (2%) Query: 40 GMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYA 99 +A+ N+ + GE + L+G SGAGKSTLL+ I G + V+ + Sbjct: 12 NGTAALDGINISISAGEFVFLVGPSGAGKSTLLKLIYKEELPTSGTIRVNG----QDVSD 67 Query: 100 ADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNL 159 + LR + +VFQ F LLP R V NV LE +P E + RV LE+V L Sbjct: 68 LRGRAIPYLRRK-IGVVFQDFRLLPDRNVYENVAFALEVTGVPPREIRKRVPAALELVGL 126 Query: 160 TKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKL 219 + LSGG +QRV ARA IL+ DEP +LDP + + LL K Sbjct: 127 SHKHRALPAELSGGEQQRVAIARAIVNSPTILIADEPTGNLDPDTTWEIMN-LLKKINKA 185 Query: 220 KKTIVFVSHDINEAFRLGNRIAIMEGGRI 248 T+V +H +R+ +E G++ Sbjct: 186 GTTVVVATHAKELVDTTRHRVIALERGKL 214 >gnl|CDD|73023 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component. The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 211 Score = 111 bits (278), Expect = 4e-25 Identities = 74/221 (33%), Positives = 114/221 (51%), Gaps = 26/221 (11%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPY 98 YG A+ +L + G + L+G +GAGK+TL+R + L P G + +D P Sbjct: 10 YGKKRALDGVSLTLGPG-MYGLLGPNGAGKTTLMRILATLTPPSSGTIRIDGQDVLKQP- 67 Query: 99 AADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLD-------IPDVERKSRVA 151 +KLR + + Q+F + P TV EFLD IP E K+RV Sbjct: 68 -------QKLRRR-IGYLPQEFGVYPNFTV-------REFLDYIAWLKGIPSKEVKARVD 112 Query: 152 EHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDE 211 E LE+VNL A KI LSGGM++RVG A+A IL++DEP + LDP R+R ++ Sbjct: 113 EVLELVNLGDRAKKKIGSLSGGMRRRVGIAQALVGDPSILIVDEPTAGLDPEERIRFRNL 172 Query: 212 LLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCG 252 L L + ++ +H + + L N++A++ G+++ G Sbjct: 173 LSELGE--DRIVILSTHIVEDVESLCNQVAVLNKGKLVFEG 211 >gnl|CDD|72977 cd03218, ABC_YhbG, The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids. The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis. YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein. Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli. The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.. Length = 232 Score = 110 bits (276), Expect = 7e-25 Identities = 69/229 (30%), Positives = 116/229 (50%), Gaps = 18/229 (7%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPY 98 YG V +L VK+GEI+ L+G +GAGK+T I GL G++L+D Sbjct: 10 YGKRKVVNGVSLSVKQGEIVGLLGPNGAGKTTTFYMIVGLVKPDSGKILLD--------- 60 Query: 99 AADANVLRKLRMHT-----VSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEH 153 + KL MH + + Q+ ++ TV N+ LE + ER+ ++ E Sbjct: 61 ---GQDITKLPMHKRARLGIGYLPQEASIFRKLTVEENILAVLEIRGLSKKEREEKLEEL 117 Query: 154 LEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELL 213 LE ++T K + LSGG ++RV ARA AT LL+DEPF+ +DP+ +Q +++ Sbjct: 118 LEEFHITHLRKSKASSLSGGERRRVEIARALATNPKFLLLDEPFAGVDPIAVQDIQ-KII 176 Query: 214 ALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPA 262 + + ++ H++ E + +R I+ G+++ GTP+EI + Sbjct: 177 KILKDRGIGVLITDHNVRETLSITDRAYIIYEGKVLAEGTPEEIAANEL 225 >gnl|CDD|31329 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane]. Length = 249 Score = 110 bits (276), Expect = 7e-25 Identities = 66/254 (25%), Positives = 101/254 (39%), Gaps = 21/254 (8%) Query: 5 AVKFRDVDIVFGETSNKIRKRSRYSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLS 64 +K +V F K + + A+ + E+ KGE + ++G + Sbjct: 3 VIKVSNVSKKFRIYHEKSYSLKKRLKGLAKGGRKVAEFWALKDISFEIYKGERVGIIGHN 62 Query: 65 GAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLP 124 GAGKSTLL+ I G+ G+V V A P Sbjct: 63 GAGKSTLLKLIAGIYKPTSGKVKVTGK--VAPLIELGA------------------GFDP 102 Query: 125 WRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAF 184 T N+ L L + E +V E +E L + D + S GM R+ F+ A Sbjct: 103 ELTGRENIYLRGLILGLTRKEIDEKVDEIIEFAELGDFIDQPVKTYSSGMYARLAFSVAT 162 Query: 185 ATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIME 244 ILL+DE + D + + + L L K KTIV VSHD+ + +R +E Sbjct: 163 HVEPDILLLDEVLAVGDAAFQEKCLERLNELVEK-NKTIVLVSHDLGAIKQYCDRAIWLE 221 Query: 245 GGRIIQCGTPQEII 258 G+I G+P+E+I Sbjct: 222 HGQIRMEGSPEEVI 235 >gnl|CDD|34593 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]. Length = 559 Score = 109 bits (275), Expect = 8e-25 Identities = 64/213 (30%), Positives = 102/213 (47%), Gaps = 16/213 (7%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 NL +K G++ L+G SGAGKSTLL + G +GE+ V+ ++ RK Sbjct: 341 NLTIKAGQLTALVGASGAGKSTLLNLLLGFLAPTQGEIRVNG----IDLRDLSPEAWRK- 395 Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKI- 167 +S V Q L T+ N+ L ++ A LE V D I Sbjct: 396 ---QISWVSQNPYLFA-GTIRENILLARPDASDEEIIAALDQAGLLEFVPKPDGLDTVIG 451 Query: 168 ---NMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIV 224 LSGG QR+ ARA + A +LL+DEP + LD + L L + +KT++ Sbjct: 452 EGGAGLSGGQAQRLALARALLSPASLLLLDEPTAHLDAETEQIILQALQELAK--QKTVL 509 Query: 225 FVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEI 257 ++H + +A +RI +++ GR+++ GT +E+ Sbjct: 510 VITHRLEDA-ADADRIVVLDNGRLVEQGTHEEL 541 >gnl|CDD|73028 cd03269, ABC_putative_ATPase, This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity. In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs. Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 210 Score = 109 bits (274), Expect = 1e-24 Identities = 63/214 (29%), Positives = 107/214 (50%), Gaps = 13/214 (6%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPY 98 +G V+A+ + V+KGEI L+G +GAGK+T +R I G+ GEVL D P Sbjct: 10 FGRVTALDDISFSVEKGEIFGLLGPNGAGKTTTIRMILGIILPDSGEVLFDG-----KPL 64 Query: 99 AADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVN 158 A + + + ++ L P V + + + E + R+ E LE + Sbjct: 65 DIAAR-------NRIGYLPEERGLYPKMKVIDQLVYLAQLKGLKKEEARRRIDEWLERLE 117 Query: 159 LTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRK 218 L+++A+ ++ LS G +Q+V F A +L++DEPFS LDP+ L+D + L R Sbjct: 118 LSEYANKRVEELSKGNQQKVQFIAAVIHDPELLILDEPFSGLDPVNVELLKDVIRELARA 177 Query: 219 LKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCG 252 KT++ +H + L +R+ ++ GR + G Sbjct: 178 -GKTVILSTHQMELVEELCDRVLLLNKGRAVLYG 210 >gnl|CDD|35282 KOG0059, KOG0059, KOG0059, Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism, General function prediction only]. Length = 885 Score = 109 bits (273), Expect = 1e-24 Identities = 65/218 (29%), Positives = 101/218 (46%), Gaps = 8/218 (3%) Query: 40 GMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYA 99 G AV + V GE L+G++GAGK+T + + G GE L+ V+ Sbjct: 576 GKDGAVRGLSFAVPPGECFGLLGVNGAGKTTTFKMLTGETKPTSGEALIKGHDITVSTDF 635 Query: 100 ADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNL 159 + Q AL T ++E +P + S + + L +V L Sbjct: 636 QQV-------RKQLGYCPQFDALWEELTGREHLEFYARLRGLPRSDIGSAIEKLLRLVGL 688 Query: 160 TKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKL 219 +A+ ++ SGG K+R+ FA A ++L+DEP + LDP R R +++A RK Sbjct: 689 GPYANKQVRTYSGGNKRRLSFAIALIGDPSVILLDEPSTGLDPKAR-RHLWDIIARLRKN 747 Query: 220 KKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEI 257 K I+ SH + EA L R AIM G++ G+PQE+ Sbjct: 748 GKAIILTSHSMEEAEALCTRTAIMVIGQLRCIGSPQEL 785 >gnl|CDD|35278 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]. Length = 1228 Score = 107 bits (270), Expect = 3e-24 Identities = 64/215 (29%), Positives = 105/215 (48%), Gaps = 17/215 (7%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 +L++ G+ + L+G SG+GKSTL++ + GEVL+D + + LR Sbjct: 373 SLKIPSGQTVALVGPSGSGKSTLIQLLARFYDPTSGEVLIDGEDIRN----LNLKWLRS- 427 Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAE-HLEIVNLTKWADCKI 167 + +V Q+ L T+ N+ G ++E ++ A H I+ L D + Sbjct: 428 ---QIGLVSQEPVLFA-TTIRENIRYGKPDATREEIEEAAKAANAHDFILKLPDGYDTLV 483 Query: 168 N----MLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTI 223 LSGG KQR+ ARA ILL+DE S+LD +Q+ L +T Sbjct: 484 GERGVQLSGGQKQRIAIARALVRNPKILLLDEATSALDAESERVVQEALDKA--SKGRTT 541 Query: 224 VFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEII 258 + V+H ++ R ++IA+ME G+I++ GT E+I Sbjct: 542 IVVAHRLST-IRNADKIAVMEEGKIVEQGTHDELI 575 Score = 81.4 bits (201), Expect = 4e-16 Identities = 60/217 (27%), Positives = 111/217 (51%), Gaps = 21/217 (9%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD-TDKGFVNPYAADANVLRK 107 +L ++ G+ + L+G SG+GKST++ + G+V +D D +N L+ Sbjct: 1010 SLSIRAGQTVALVGPSGSGKSTVISLLERFYDPDAGKVKIDGVDIKDLN--------LKW 1061 Query: 108 LRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAE-HLEIVNLTKWADCK 166 LR + +V Q+ L T+ N+ G E + ++ +++A H I +L + D + Sbjct: 1062 LRKQ-IGLVSQEPVLFN-GTIRENIAYGSEEVSEEEIIEAAKLANAHNFISSLPQGYDTR 1119 Query: 167 INM----LSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQR-KLKK 221 + LSGG KQR+ ARA ILL+DE S+LD +Q+ AL R + Sbjct: 1120 VGERGVQLSGGQKQRIAIARAILRNPKILLLDEATSALDSESERVVQE---ALDRAMEGR 1176 Query: 222 TIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEII 258 T + ++H ++ + + IA+++ G++++ GT E++ Sbjct: 1177 TTIVIAHRLS-TIQNADVIAVLKNGKVVEQGTHDELL 1212 >gnl|CDD|34199 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]. Length = 245 Score = 107 bits (269), Expect = 4e-24 Identities = 65/216 (30%), Positives = 110/216 (50%), Gaps = 10/216 (4%) Query: 42 VSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAAD 101 V AV + E ++GEI L+G +GAGK+TLLR I L G+V +D V+ Sbjct: 15 VQAVRDVSFEAEEGEITGLLGENGAGKTTLLRMIATLLIPDSGKVTIDG----VDTVRDP 70 Query: 102 ANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTK 161 + V RK + ++F + L T N++ + E K+R+AE + + L + Sbjct: 71 SFVRRK-----IGVLFGERGLYARLTARENLKYFARLNGLSRKEIKARIAELSKRLQLLE 125 Query: 162 WADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKK 221 + D ++ S GMKQ+V ARA IL++DEP S LD R + D + L+ + + Sbjct: 126 YLDRRVGEFSTGMKQKVAIARALVHDPSILVLDEPTSGLDIRTRRKFHDFIKQLKNE-GR 184 Query: 222 TIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEI 257 ++F SH + E L +R+ ++ G ++ G+ + + Sbjct: 185 AVIFSSHIMQEVEALCDRVIVLHKGEVVLEGSIEAL 220 >gnl|CDD|33913 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only]. Length = 534 Score = 106 bits (267), Expect = 7e-24 Identities = 75/248 (30%), Positives = 125/248 (50%), Gaps = 11/248 (4%) Query: 28 YSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVL 87 + IK + AV +L +++G+ L L+G SG+GKSTL ++ L P +GE+ Sbjct: 286 FPIKGGFLRRTVDHLRAVDGISLTLRRGQTLGLVGESGSGKSTLGLALLRLIPS-QGEIR 344 Query: 88 VDTDKGFVNPYAADANVLRKLRMHTVSMVFQQ--FALLPWRTVARNVELGLEFLD--IPD 143 D + +R LR + +VFQ +L P TV + +E GL + + Sbjct: 345 FDGQ----DIDGLSRKEMRPLR-RRMQVVFQDPYGSLSPRMTVGQIIEEGLRVHEPKLSA 399 Query: 144 VERKSRVAEHLEIVNLTKWADCKI-NMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDP 202 ER RV E LE V L + + SGG +QR+ ARA ++L+DEP S+LD Sbjct: 400 AERDQRVIEALEEVGLDPATRNRYPHEFSGGQRQRIAIARALILKPELILLDEPTSALDR 459 Query: 203 LIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPA 262 ++ ++ D L LQ+K + +F+SHD+ L +R+ +M G+I++ G + + +P Sbjct: 460 SVQAQVLDLLRDLQQKHGLSYLFISHDLAVVRALCHRVIVMRDGKIVEQGPTEAVFANPQ 519 Query: 263 NCYVSEFI 270 + Y + Sbjct: 520 HEYTRALL 527 Score = 106 bits (266), Expect = 9e-24 Identities = 71/245 (28%), Positives = 124/245 (50%), Gaps = 13/245 (5%) Query: 37 SEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAP---VVRGEVLVDTDKG 93 E G V AV + +++ GE L L+G SG+GKS SI GL P + D Sbjct: 18 QEGGTVEAVKGISFDIEAGETLALVGESGSGKSVTALSILGLLPSPAAAHPSGSILFDG- 76 Query: 94 FVNPYAADANVLRKLRMHTVSMVFQQ--FALLPWRTVARNVELGLEF-LDIPDVERKSRV 150 + AA LR +R + + M+FQ+ +L P T+ + + L + ++R Sbjct: 77 -EDLLAASERQLRGVRGNKIGMIFQEPMTSLNPLHTIGKQLAEVLRLHRGLSRAAARARA 135 Query: 151 AEHLEIVNLTKWADCKIN----MLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRM 206 E LE+V + + + +++ LSGG +QRV A A A +L+ DEP ++LD ++ Sbjct: 136 LELLELVGIPE-PEKRLDAYPHELSGGQRQRVMIAMALANEPDLLIADEPTTALDVTVQA 194 Query: 207 RLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYV 266 ++ D L LQ +L I+F++HD+ + +R+ +M+ G I++ GT + + P + Y Sbjct: 195 QILDLLKELQAELGMAILFITHDLGIVRKFADRVYVMQHGEIVETGTTETLFAAPQHPYT 254 Query: 267 SEFIQ 271 + + Sbjct: 255 RKLLA 259 >gnl|CDD|72979 cd03220, ABC_KpsT_Wzt, ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.. Length = 224 Score = 105 bits (264), Expect = 2e-23 Identities = 68/247 (27%), Positives = 107/247 (43%), Gaps = 23/247 (9%) Query: 6 VKFRDVDIVFGETSNKIRKRSRYSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSG 65 ++ +V + + K S + + E G A+ + EV +GE + L+G +G Sbjct: 1 IELENVSKSYP--TYKGGSSSLKKLGILGRKGEVGEFWALKDVSFEVPRGERIGLIGRNG 58 Query: 66 AGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLPW 125 AGKSTLLR + G+ P G V +R S++ P Sbjct: 59 AGKSTLLRLLAGIYPPDSGTV--------------------TVRGRVSSLLGLGGGFNPE 98 Query: 126 RTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFA 185 T N+ L L + E ++ E +E L + D + S GMK R+ FA A A Sbjct: 99 LTGRENIYLNGRLLGLSRKEIDEKIDEIIEFSELGDFIDLPVKTYSSGMKARLAFAIATA 158 Query: 186 TGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEG 245 ILL+DE + D + + Q L L ++ KT++ VSHD + RL +R ++E Sbjct: 159 LEPDILLIDEVLAVGDAAFQEKCQRRLRELLKQ-GKTVILVSHDPSSIKRLCDRALVLEK 217 Query: 246 GRIIQCG 252 G+I G Sbjct: 218 GKIRFDG 224 >gnl|CDD|31327 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]. Length = 567 Score = 105 bits (263), Expect = 2e-23 Identities = 63/215 (29%), Positives = 110/215 (51%), Gaps = 17/215 (7%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 + ++ GE + ++G SG+GKSTL++ + L GE+L+D ++ + LRK Sbjct: 349 SFSIEPGEKVAIVGPSGSGKSTLIKLLLRLYDPTSGEILIDG----IDIRDISLDSLRK- 403 Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAE-HLEIVNLTKWADCKI 167 + +V Q L T+ N+ LG ++E ++A H I NL D + Sbjct: 404 ---RIGIVSQDPLLFS-GTIRENIALGRPDATDEEIEEALKLANAHEFIANLPDGYDTIV 459 Query: 168 N----MLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTI 223 LSGG +QR+ ARA PIL++DE S+LD +QD L L + +T Sbjct: 460 GERGVNLSGGQRQRLAIARALLRNPPILILDEATSALDTETEALIQDALKKLLK--GRTT 517 Query: 224 VFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEII 258 + ++H ++ + +RI +++ GRI++ GT +E++ Sbjct: 518 LIIAHRLSTI-KNADRIIVLDNGRIVERGTHEELL 551 >gnl|CDD|72987 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export. They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 171 Score = 105 bits (264), Expect = 2e-23 Identities = 57/199 (28%), Positives = 89/199 (44%), Gaps = 49/199 (24%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 +L +K GE + ++G SG+GKSTLL+ + L GE+L+D V+ D LRK Sbjct: 22 SLTIKPGEKVAIVGPSGSGKSTLLKLLLRLYDPTSGEILIDG----VDLRDLDLESLRK- 76 Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKIN 168 ++ V Q L T+ N+ Sbjct: 77 ---NIAYVPQDPFLFS-GTIRENI------------------------------------ 96 Query: 169 MLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSH 228 LSGG +QR+ ARA PIL++DE S+LDP + + L AL + KT++ ++H Sbjct: 97 -LSGGQRQRIAIARALLRDPPILILDEATSALDPETEALILEALRALAK--GKTVIVIAH 153 Query: 229 DINEAFRLGNRIAIMEGGR 247 + R +RI +++ GR Sbjct: 154 RL-STIRDADRIIVLDDGR 171 >gnl|CDD|33909 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]. Length = 267 Score = 102 bits (255), Expect = 2e-22 Identities = 59/224 (26%), Positives = 115/224 (51%), Gaps = 12/224 (5%) Query: 42 VSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAAD 101 V AV + +++G+ L ++G +G+GKSTL + + G+ GE+L++ Y+ Sbjct: 26 VEAVKPVSFTLREGQTLAIIGENGSGKSTLAKMLAGMIEPTSGEILINDHPLHFGDYSFR 85 Query: 102 ANVLRKLRMHTVSMVFQ--QFALLPWRTVARNVELGLEF-LDIPDVERKSRVAEHLEIVN 158 + +R M+FQ +L P + + ++ L D+ +R+ ++ E L +V Sbjct: 86 SKRIR--------MIFQDPNTSLNPRLRIGQILDFPLRLNTDLEPEQRRKQIFETLRMVG 137 Query: 159 L-TKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQR 217 L A+ +ML+ G KQRV ARA I++ DE +SLD +R +L + +L LQ Sbjct: 138 LLPDHANYYPHMLAPGQKQRVALARALILRPKIIIADEALASLDMSMRSQLINLMLELQE 197 Query: 218 KLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHP 261 K + ++V+ I + +++ +M G +++ G+ +++ P Sbjct: 198 KQGISYIYVTQHIGMIKHISDQVLVMHEGEVVERGSTADVLASP 241 >gnl|CDD|72975 cd03216, ABC_Carb_Monos_I, This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos). The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. Pentoses include xylose, arabinose, and ribose. Important hexoses include glucose, galactose, and fructose. In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter.. Length = 163 Score = 102 bits (255), Expect = 2e-22 Identities = 56/215 (26%), Positives = 96/215 (44%), Gaps = 67/215 (31%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDK-GFVNP 97 +G V A+ +L V++GE+ L+G +GAGKSTL++ ++GL GE+LVD + F +P Sbjct: 10 FGGVKALDGVSLSVRRGEVHALLGENGAGKSTLMKILSGLYKPDSGEILVDGKEVSFASP 69 Query: 98 YAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIV 157 A ++MV+Q Sbjct: 70 RDARR--------AGIAMVYQ--------------------------------------- 82 Query: 158 NLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQR 217 LS G +Q V ARA A A +L++DEP ++L P + L + R Sbjct: 83 ------------LSVGERQMVEIARALARNARLLILDEPTAALTP----AEVERLFKVIR 126 Query: 218 KLKK---TIVFVSHDINEAFRLGNRIAIMEGGRII 249 +L+ ++F+SH ++E F + +R+ ++ GR++ Sbjct: 127 RLRAQGVAVIFISHRLDEVFEIADRVTVLRDGRVV 161 >gnl|CDD|34592 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]. Length = 573 Score = 101 bits (253), Expect = 3e-22 Identities = 68/236 (28%), Positives = 108/236 (45%), Gaps = 31/236 (13%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 NL + +GE + ++G SG+GKSTLL+ + G +G + ++ V + D LR Sbjct: 358 NLTLAQGEKVAILGRSGSGKSTLLQLLAGAWDPQQGSITLNG----VEIASLDEQALR-- 411 Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTK------- 161 T+S++ Q+ L T+ N+ L D D E + L+ V L K Sbjct: 412 --ETISVLTQRVHLFS-GTLRDNLRLANP--DASDEE----LWAALQQVGLEKLLESAPD 462 Query: 162 ----WADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQR 217 W LSGG ++R+ ARA AP+ L+DEP LDP+ ++ L Sbjct: 463 GLNTWLGEGGRRLSGGERRRLALARALLHDAPLWLLDEPTEGLDPITERQVLALLFEHAE 522 Query: 218 KLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEFIQKL 273 KT++ V+H + R+ +RI +++ G+II+ GT E L N Q Sbjct: 523 --GKTLLMVTHRLRGLERM-DRIIVLDNGKIIEEGTHAE--LLANNGRYKRLYQLD 573 >gnl|CDD|31332 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only]. Length = 243 Score = 101 bits (252), Expect = 4e-22 Identities = 68/230 (29%), Positives = 114/230 (49%), Gaps = 20/230 (8%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPY 98 Y V +LEV GEI+ L+G +GAGK+T I GL G++L+D Sbjct: 14 YKKRKVVNDVSLEVNSGEIVGLLGPNGAGKTTTFYMIVGLVRPDSGKILLD--------- 64 Query: 99 AADANVLRKLRMHT-----VSMVFQQFALLPWRTVARNVELGLEF--LDIPDVERKSRVA 151 D ++ KL MH + + Q+ ++ TV N+ LE D+ ERK + Sbjct: 65 --DEDI-TKLPMHKRARLGIGYLPQEASIFRKLTVEDNIMAVLEIREKDLKKAERKEELD 121 Query: 152 EHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDE 211 LE ++T D K LSGG ++RV ARA A +L+DEPF+ +DP+ + +Q Sbjct: 122 ALLEEFHITHLRDSKAYSLSGGERRRVEIARALAANPKFILLDEPFAGVDPIAVIDIQ-R 180 Query: 212 LLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHP 261 ++ + ++ H++ E + +R I+ G+++ G+P+EI+ + Sbjct: 181 IIKHLKDRGIGVLITDHNVRETLDICDRAYIISDGKVLAEGSPEEIVNNE 230 >gnl|CDD|72985 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.. Length = 205 Score = 100 bits (251), Expect = 5e-22 Identities = 54/205 (26%), Positives = 95/205 (46%), Gaps = 23/205 (11%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 +L++ GEI+ L G +GAGK+TL + + GL G +L++ + K Sbjct: 20 SLDLYAGEIIALTGKNGAGKTTLAKILAGLIKESSGSILLN-----------GKPIKAKE 68 Query: 109 RMHTVSMVFQ----QFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWAD 164 R ++ V Q Q +V + LGL+ LD + L+ ++L + Sbjct: 69 RRKSIGYVMQDVDYQLFT---DSVREELLLGLKELD----AGNEQAETVLKDLDLYALKE 121 Query: 165 CKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIV 224 LSGG KQR+ A A +G +L+ DEP S LD R+ + + L + K ++ Sbjct: 122 RHPLSLSGGQKQRLAIAAALLSGKDLLIFDEPTSGLDYKNMERVGELIRELAAQ-GKAVI 180 Query: 225 FVSHDINEAFRLGNRIAIMEGGRII 249 ++HD ++ +R+ ++ G I+ Sbjct: 181 VITHDYEFLAKVCDRVLLLANGAIV 205 >gnl|CDD|34201 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 259 Score = 100 bits (250), Expect = 7e-22 Identities = 68/220 (30%), Positives = 108/220 (49%), Gaps = 23/220 (10%) Query: 50 LEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKLR 109 L+++ GE+L ++G +GAGKSTLL++++G GEV ++ P A L Sbjct: 22 LDLRPGEVLAILGPNGAGKSTLLKALSGELSPDSGEVTLNGVPLNSWPPEELARHRAVLP 81 Query: 110 MHTVSMVFQQFALLPWRTVARNVELGLEFLDIP-DVERKSRVAEH-LEIVNLTKWADCKI 167 ++ S+ F P+ TV V++G + E R+A L +L+ A Sbjct: 82 QNS-SLAF------PF-TVQEVVQMGRIPHRSGREPEEDERIAAQALAATDLSGLAGRDY 133 Query: 168 NMLSGGMKQRVGFARAFA------TGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKK 221 LSGG +QRV AR A L +DEP S+LD Q L L R+L + Sbjct: 134 RTLSGGEQQRVQLARVLAQLWPPVPSGRWLFLDEPTSALDI----AHQHHTLRLARQLAR 189 Query: 222 ---TIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEII 258 ++ V HD+N A + +RI ++ GR+I G+PQ+++ Sbjct: 190 EGGAVLAVLHDLNLAAQYADRIVLLHQGRVIASGSPQDVL 229 >gnl|CDD|34224 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only]. Length = 325 Score = 99 bits (249), Expect = 8e-22 Identities = 75/300 (25%), Positives = 135/300 (45%), Gaps = 14/300 (4%) Query: 38 EYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNP 97 + + AV + E+ KGEI+ +G +GAGKST L+ + GL G+V V+ G P Sbjct: 33 KERSIEAVQDISFEIPKGEIVGFLGANGAGKSTTLKMLTGLLLPTSGKVRVN---GKD-P 88 Query: 98 YAADANVLRKLRMHTVSMVFQQFALLPW-RTVARNVELGLEFLDIPDVERKSRVAEHLEI 156 + LR + +V Q L W ++E+ +IPD E R+ EI Sbjct: 89 FRRREEYLRSI-----GLVMGQKLQLWWDLPALDSLEVLKLIYEIPDDEFAERLDFLTEI 143 Query: 157 VNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQ 216 ++L + + LS G + R A A +L +DEP LD + +++ L Sbjct: 144 LDLEGFLKWPVRKLSLGQRMRAELAAALLHPPKVLFLDEPTVGLDVNAQANIREFLKEYN 203 Query: 217 RKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEFIQKLNPI 276 + + T++ +H ++ L +R+ +++ G+++ GT ++ EF +L Sbjct: 204 EERQATVLLTTHIFDDIATLCDRVLLIDQGQLVFDGTLAQLQEQFGP--YKEFSVELKQA 261 Query: 277 TALVAADVMRVCSIDDESNIVHKISRQMPLIDIIDMVADNLGKIGV-VEDDRIVGIITAI 335 +L ++ +I++ NI + +SR+ DII + + VED I +I I Sbjct: 262 KSLSQLALLGDVTIEEGLNIKNDVSREE-SADIIAKLLAEFEVRDLTVEDPEIEDVIRRI 320 >gnl|CDD|73025 cd03266, ABC_NatA_sodium_exporter, NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.. Length = 218 Score = 99 bits (249), Expect = 9e-22 Identities = 63/213 (29%), Positives = 98/213 (46%), Gaps = 10/213 (4%) Query: 40 GMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYA 99 V AV + VK GE+ L+G +GAGK+T LR + GL G VD P Sbjct: 16 KTVQAVDGVSFTVKPGEVTGLLGPNGAGKTTTLRMLAGLLEPDAGFATVDGFDVVKEPAE 75 Query: 100 ADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNL 159 A + V L T N+E + E +R+ E + + + Sbjct: 76 ARRRL---------GFVSDSTGLYDRLTARENLEYFAGLYGLKGDELTARLEELADRLGM 126 Query: 160 TKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKL 219 + D ++ S GM+Q+V ARA P+LL+DEP + LD + L++ + L R L Sbjct: 127 EELLDRRVGGFSTGMRQKVAIARALVHDPPVLLLDEPTTGLDVMATRALREFIRQL-RAL 185 Query: 220 KKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCG 252 K I+F +H + E RL +R+ ++ GR++ G Sbjct: 186 GKCILFSTHIMQEVERLCDRVVVLHRGRVVYEG 218 >gnl|CDD|73008 cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1. In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD. MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.. Length = 238 Score = 97.5 bits (243), Expect = 4e-21 Identities = 65/216 (30%), Positives = 110/216 (50%), Gaps = 19/216 (8%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 +L + G+ + L+G SG GKST++ + GE+L+D D N LR L Sbjct: 23 SLTIPPGKTVALVGSSGCGKSTVVSLLERFYDPTSGEILLD------GVDIRDLN-LRWL 75 Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLE-IVNLTKWADCKI 167 R + +V Q+ L T+A N+ G +VE ++ A + I++L D + Sbjct: 76 RSQ-IGLVSQEPVLFD-GTIAENIRYGKPDATDEEVEEAAKKANIHDFIMSLPDGYDTLV 133 Query: 168 ----NMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLK-KT 222 + LSGG KQR+ ARA ILL+DE S+LD +Q+ AL R +K +T Sbjct: 134 GERGSQLSGGQKQRIAIARALLRNPKILLLDEATSALDAESEKLVQE---ALDRAMKGRT 190 Query: 223 IVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEII 258 + ++H ++ R + IA+++ G++++ GT E++ Sbjct: 191 TIVIAHRLS-TIRNADLIAVLQNGQVVEQGTHDELM 225 >gnl|CDD|73013 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP-binding protein. In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor. This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 229 Score = 97.2 bits (242), Expect = 6e-21 Identities = 54/216 (25%), Positives = 103/216 (47%), Gaps = 17/216 (7%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 N +K GE + ++G +GAGK+TL+ + +G++L+D ++ LR + Sbjct: 23 NFSIKPGETVAIVGPTGAGKTTLINLLMRFYDPQKGQILIDG----IDIRDISRKSLRSM 78 Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAE-HLEIVNLTKWADCKI 167 + +V Q L T+ N+ LG +V ++ A H I+ L D + Sbjct: 79 ----IGVVLQDTFLFS-GTIMENIRLGRPNATDEEVIEAAKEAGAHDFIMKLPNGYDTVL 133 Query: 168 N----MLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTI 223 LS G +Q + ARA IL++DE S++D +Q+ L L + +T Sbjct: 134 GENGGNLSQGERQLLAIARAMLRDPKILILDEATSNIDTETEKLIQEALEKLMK--GRTS 191 Query: 224 VFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIIL 259 + ++H ++ + ++I +++ G+II+ GT E++ Sbjct: 192 IIIAHRLS-TIKNADKILVLDDGKIIEEGTHDELLA 226 >gnl|CDD|35284 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism]. Length = 613 Score = 95.4 bits (237), Expect = 2e-20 Identities = 84/320 (26%), Positives = 135/320 (42%), Gaps = 38/320 (11%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPV---VRGEVLVDTDKGFVNPYAADANVL 105 + K GE+L +MG SG+GK+TLL ++ G + GE+L+ N D+ Sbjct: 50 SGTAKPGELLAIMGPSGSGKTTLLNALAGRLNGGLKLSGEILL-------NGRPRDSRSF 102 Query: 106 RKLRMHTVSMVFQQFALLPWRTVARNVELGLEFL---DIPDVERKSRVAEHLEIVNLTKW 162 RK+ V Q LLP TV + + E++ RV E + + L K Sbjct: 103 RKI----SGYVQQDDVLLPTLTVRETLRFSALLRLPSSLSKEEKRERVEEVISELGLEKC 158 Query: 163 ADCKI-----NMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQR 217 AD I LSGG ++RV A T IL +DEP S LD +++ L L R Sbjct: 159 ADTLIGNPGIRGLSGGERKRVSIALELLTDPSILFLDEPTSGLDSFSALQVVQLLKRLAR 218 Query: 218 KLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEII--LHPANCYVSEFIQKLNP 275 + I + +E F L +++ ++ G ++ G+P+E++ E NP Sbjct: 219 SGRTVICTIHQPSSELFELFDKLLLLSEGEVVYSGSPRELLEFFSSLGFPCPELE---NP 275 Query: 276 ITALVAADVMRVCSIDDE-------SNIVHKISRQMPLIDIIDMVADNLGKIGVVEDDRI 328 L+ D++ V S E + +++K S+ L ++ + +L VE Sbjct: 276 ADFLL--DLLSVDSGTRELEEAVRIAKLINKFSQTDNLKKTLEALEKSLSTSKKVEIGTS 333 Query: 329 VGIIT--AIDIVRGLSCCRR 346 T I + R L RR Sbjct: 334 PSWWTQFKILLKRSLKNIRR 353 >gnl|CDD|73011 cd03252, ABCC_Hemolysin, The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli. The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane. HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB. This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport. Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.. Length = 237 Score = 94.6 bits (235), Expect = 3e-20 Identities = 65/220 (29%), Positives = 108/220 (49%), Gaps = 27/220 (12%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 +L +K GE++ ++G SG+GKSTL + I G VLVD + AD LR+ Sbjct: 22 SLRIKPGEVVGIVGRSGSGKSTLTKLIQRFYVPENGRVLVDG----HDLALADPAWLRR- 76 Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAE-HLEIVNLTKWADCKI 167 V +V Q+ L R++ N+ L + + V +++A H I L + D + Sbjct: 77 ---QVGVVLQENVLFN-RSIRDNIALADPGMSMERVIEAAKLAGAHDFISELPEGYDTIV 132 Query: 168 NM----LSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKK-- 221 LSGG +QR+ ARA IL+ DE S+LD + E A+ R + Sbjct: 133 GEQGAGLSGGQRQRIAIARALIHNPRILIFDEATSALD------YESE-HAIMRNMHDIC 185 Query: 222 ---TIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEII 258 T++ ++H ++ + +RI +ME GRI++ G+ E++ Sbjct: 186 AGRTVIIIAHRLS-TVKNADRIIVMEKGRIVEQGSHDELL 224 >gnl|CDD|143798 pfam00005, ABC_tran, ABC transporter. ABC transporters for a large family of proteins responsible for translocation of a variety of compounds across biological membranes. ABC transporters are the largest family of proteins in many completely sequenced bacteria. ABC transporters are composed of two copies of this domain and two copies of a transmembrane domain pfam00664. These four domains may belong to a single polypeptide or belong in different polypeptide chains. Length = 119 Score = 93.5 bits (233), Expect = 7e-20 Identities = 48/131 (36%), Positives = 61/131 (46%), Gaps = 13/131 (9%) Query: 69 STLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTV 128 STLL+ I GL G +L+D + G RK + +VFQ L P TV Sbjct: 1 STLLKLITGLLQPTSGTILLDGEDGT-------DLSSRKALRKRIGVVFQDPQLFPELTV 53 Query: 129 ARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWAD-CKINMLSGGMKQRVGFARAFATG 187 N+ GL D E +R E LE V L + D + LSGG KQRV ARA Sbjct: 54 RENLFFGL-----RDKEADARAEEALERVGLPDFLDRSPVGTLSGGQKQRVAIARALLKK 108 Query: 188 APILLMDEPFS 198 +LL+DEP + Sbjct: 109 PKLLLLDEPTA 119 >gnl|CDD|73010 cd03251, ABCC_MsbA, MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 234 Score = 93.0 bits (231), Expect = 1e-19 Identities = 69/215 (32%), Positives = 106/215 (49%), Gaps = 17/215 (7%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 +L++ GE + L+G SG+GKSTL+ I V G +L+D V Y L L Sbjct: 22 SLDIPAGETVALVGPSGSGKSTLVNLIPRFYDVDSGRILIDGHD--VRDYT-----LASL 74 Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLE-IVNLTKWADCKI 167 R + +V Q L TVA N+ G +VE +R A E I+ L + D I Sbjct: 75 RRQ-IGLVSQD-VFLFNDTVAENIAYGRPGATREEVEEAARAANAHEFIMELPEGYDTVI 132 Query: 168 N----MLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTI 223 LSGG +QR+ ARA PIL++DE S+LD +Q L L + +T Sbjct: 133 GERGVKLSGGQRQRIAIARALLKDPPILILDEATSALDTESERLVQAALERLMK--NRTT 190 Query: 224 VFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEII 258 ++H ++ +RI ++E G+I++ GT +E++ Sbjct: 191 FVIAHRLS-TIENADRIVVLEDGKIVERGTHEELL 224 >gnl|CDD|73026 cd03267, ABC_NatA_like, Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.. Length = 236 Score = 92.6 bits (230), Expect = 1e-19 Identities = 62/213 (29%), Positives = 104/213 (48%), Gaps = 10/213 (4%) Query: 38 EYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNP 97 +Y V A+ + ++KGEI+ +G +GAGK+T L+ ++GL GEV V G V P Sbjct: 30 KYREVEALKGISFTIEKGEIVGFIGPNGAGKTTTLKILSGLLQPTSGEVRV---AGLV-P 85 Query: 98 YAADANVLRKLRMHTVSMVFQQFALLPWR-TVARNVELGLEFLDIPDVERKSRVAEHLEI 156 + LR++ +VF Q L W V + L D+P K R+ E E+ Sbjct: 86 WKRRKKFLRRI-----GVVFGQKTQLWWDLPVIDSFYLLAAIYDLPPARFKKRLDELSEL 140 Query: 157 VNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQ 216 ++L + D + LS G + R A A IL +DEP LD + + +++ L Sbjct: 141 LDLEELLDTPVRQLSLGQRMRAEIAAALLHEPEILFLDEPTIGLDVVAQENIRNFLKEYN 200 Query: 217 RKLKKTIVFVSHDINEAFRLGNRIAIMEGGRII 249 R+ T++ SH + + L R+ +++ GR++ Sbjct: 201 RERGTTVLLTSHYMKDIEALARRVLVIDKGRLL 233 >gnl|CDD|34235 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 252 Score = 91.4 bits (227), Expect = 3e-19 Identities = 67/224 (29%), Positives = 111/224 (49%), Gaps = 12/224 (5%) Query: 38 EYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNP 97 YG + +L++ KG I ++G +GAGKSTLL ++ L GE+ +D + Sbjct: 10 SYGTKVVLDDVSLDIPKGGITSIIGPNGAGKSTLLSMMSRLLKKDSGEITIDG----LEL 65 Query: 98 YAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEF---LDIPDVERKSRVAEHL 154 + + L K +S++ Q+ + TV V G F E + + E + Sbjct: 66 TSTPSKELAK----KLSILKQENHINSRLTVRDLVGFG-RFPYSQGRLTKEDRRIINEAI 120 Query: 155 EIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLA 214 E ++L +D ++ LSGG +QR A A +L+DEP ++LD +++ L Sbjct: 121 EYLHLEDLSDRYLDELSGGQRQRAFIAMVLAQDTDYVLLDEPLNNLDMKHSVQIMKILRR 180 Query: 215 LQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEII 258 L +L KTIV V HDIN A + I ++ G++++ G+P EII Sbjct: 181 LADELGKTIVVVLHDINFASCYSDHIVALKNGKVVKQGSPDEII 224 >gnl|CDD|72974 cd03215, ABC_Carb_Monos_II, This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos). The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter.. Length = 182 Score = 90.1 bits (224), Expect = 7e-19 Identities = 49/201 (24%), Positives = 86/201 (42%), Gaps = 39/201 (19%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD-TDKGFVNPYAADANVLRK 107 + EV+ GEI+ + GL G G++ L ++ GL P GE+ +D +P A + Sbjct: 20 SFEVRAGEIVGIAGLVGNGQTELAEALFGLRPPASGEITLDGKPVTRRSPRDA-----IR 74 Query: 108 LRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKI 167 + V ++ L+ +VA N+ L Sbjct: 75 AGIAYVPEDRKREGLVLDLSVAENIALS-------------------------------- 102 Query: 168 NMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVS 227 ++LSGG +Q+V AR A +L++DEP +D + + + L K ++ +S Sbjct: 103 SLLSGGNQQKVVLARWLARDPRVLILDEPTRGVDVGAKAEIYRLIRELADA-GKAVLLIS 161 Query: 228 HDINEAFRLGNRIAIMEGGRI 248 +++E L +RI +M GRI Sbjct: 162 SELDELLGLCDRILVMYEGRI 182 >gnl|CDD|31316 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism]. Length = 257 Score = 90.3 bits (224), Expect = 7e-19 Identities = 54/214 (25%), Positives = 87/214 (40%), Gaps = 17/214 (7%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 + +V GE ++G +GAGK+TLL + G P G+V + + + +L Sbjct: 51 SWQVNPGEHWAIVGPNGAGKTTLLSLLTGEHPPSSGDVTL-----LGRRFGK-GETIFEL 104 Query: 109 RMHT--VSMVFQQFALLPWRTVARNVELGLEFLDI------PDVERKSRVAEHLEIVNLT 160 R VS + R R+V L F I E + LE++ Sbjct: 105 RKRIGLVSSELHE--RFRVRETVRDVVLSGFFASIGIYQEDLTAEDLAAAQWLLELLGAK 162 Query: 161 KWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLAL-QRKL 219 AD LS G ++RV ARA +L++DEP LD + R +L + L L Sbjct: 163 HLADRPFGSLSQGEQRRVLIARALVKDPELLILDEPAQGLDLIAREQLLNRLEELAASPG 222 Query: 220 KKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGT 253 ++FV+H E +++ G ++ G Sbjct: 223 APALLFVTHHAEEIPPCFTHRLLLKEGEVVAQGK 256 >gnl|CDD|31298 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only]. Length = 263 Score = 90.3 bits (224), Expect = 8e-19 Identities = 59/220 (26%), Positives = 102/220 (46%), Gaps = 24/220 (10%) Query: 44 AVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADAN 103 A+ +LE+ +G+ + ++G +GAGKSTLL +I G G++L+D V + Sbjct: 21 ALNGLSLEIAEGDFVTVIGSNGAGKSTLLNAIAGDLKPTSGQILIDGVD--VTKKSVAK- 77 Query: 104 VLRKLRMHTVSMVFQ--QFALLPWRTVARNVELGLE------FLDIPDVERKSRVAEHLE 155 R + ++ VFQ P T+ N+ L + R+S E L Sbjct: 78 -----RANLLARVFQDPLAGTAPELTIEENLALAESRGKKRGLSSALNERRRSSFRERLA 132 Query: 156 IVN--LTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDP---LIRMRLQD 210 + L +I +LSGG +Q + A ILL+DE ++LDP M L Sbjct: 133 RLGLGLENRLSDRIGLLSGGQRQALSLLMATLHPPKILLLDEHTAALDPKTAEFVMELTA 192 Query: 211 ELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQ 250 +++ + K T + V+H++ +A GNR+ ++ G+I+ Sbjct: 193 KIVE---EHKLTTLMVTHNMEDALDYGNRLIMLHSGKIVL 229 >gnl|CDD|73009 cd03250, ABCC_MRP_domain1, Domain 1 of the ABC subfamily C. This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.. Length = 204 Score = 90.1 bits (224), Expect = 8e-19 Identities = 59/208 (28%), Positives = 98/208 (47%), Gaps = 37/208 (17%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 NLEV KGE++ ++G G+GKS+LL ++ G + G V V +V+ Sbjct: 25 NLEVPKGELVAIVGPVGSGKSSLLSALLGELEKLSGSVSVPGSIAYVS------------ 72 Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAE------HLEIV---NL 159 Q + T+ N+ G F D ER +V + LEI+ +L Sbjct: 73 ----------QEPWIQNGTIRENILFGKPF----DEERYEKVIKACALEPDLEILPDGDL 118 Query: 160 TKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKL 219 T+ + IN LSGG KQR+ ARA + A I L+D+P S++D + + + + Sbjct: 119 TEIGEKGIN-LSGGQKQRISLARAVYSDADIYLLDDPLSAVDAHVGRHIFENCILGLLLN 177 Query: 220 KKTIVFVSHDINEAFRLGNRIAIMEGGR 247 KT + V+H + + ++I +++ GR Sbjct: 178 NKTRILVTHQL-QLLPHADQIVVLDNGR 204 >gnl|CDD|33864 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 258 Score = 90.0 bits (223), Expect = 9e-19 Identities = 66/242 (27%), Positives = 108/242 (44%), Gaps = 9/242 (3%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPY 98 YG + ++ GE+L ++G SG+GK+TLL+ I+G G V G Sbjct: 16 YGPGKGCRDVSFDLYPGEVLGIVGESGSGKTTLLKCISGRLTPDAGTVTYRMRDGQPRDL 75 Query: 99 AADANVLRKLRMHTVSMVFQQFALLPWR-TVARNVELGLEFLDIPDV---ERKSRVAEHL 154 + R+ + T Q R V+ +G + I ++ + L Sbjct: 76 YTMSEAERRRLLRTEWGFVHQNPRDGLRMQVSAGGNIGERLMAIGARHYGNIRAEAQDWL 135 Query: 155 EIVNL-TKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELL 213 E V + D SGGM+QR+ AR T ++ MDEP LD ++ RL D L Sbjct: 136 EEVEIDLDRIDDLPRTFSGGMQQRLQIARNLVTRPRLVFMDEPTGGLDVSVQARLLDLLR 195 Query: 214 ALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCY----VSEF 269 L R+L +V V+HD+ A L +R+ +M+ G++++ G ++ P + Y VS Sbjct: 196 GLVRELGLAVVIVTHDLAVARLLADRLMVMKQGQVVESGLTDRVLDDPHHPYTQLLVSSV 255 Query: 270 IQ 271 +Q Sbjct: 256 LQ 257 >gnl|CDD|35281 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]. Length = 716 Score = 89.6 bits (222), Expect = 1e-18 Identities = 58/224 (25%), Positives = 111/224 (49%), Gaps = 21/224 (9%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD-TDKGFVNPYAADANVLRK 107 + ++ GE++ L+G SG+GKST+ + G +L+D +N + Sbjct: 488 SFTIRPGEVVALVGPSGSGKSTIASLLLRFYDPTSGRILLDGVPISDINH--------KY 539 Query: 108 LRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAE-HLEIVNLTKWADCK 166 LR + +V Q+ L ++ N+ GL+ ++E +++A H I N + Sbjct: 540 LRRK-IGLVGQEPVLFS-GSIRENIAYGLDNATDEEIEAAAKMANAHEFITNFPDGYNTV 597 Query: 167 IN----MLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLK-K 221 + LSGG KQR+ ARA +L++DE S+LD +Q+ AL R ++ + Sbjct: 598 VGEKGSQLSGGQKQRIAIARALLRNPRVLILDEATSALDAESEYLVQE---ALDRLMQGR 654 Query: 222 TIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCY 265 T++ ++H ++ R ++I +++ GR+++ GT E++ P Y Sbjct: 655 TVLVIAHRLS-TVRHADQIVVIDKGRVVEMGTHDELLSKPNGLY 697 >gnl|CDD|33892 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only]. Length = 213 Score = 88.9 bits (220), Expect = 2e-18 Identities = 56/188 (29%), Positives = 84/188 (44%), Gaps = 14/188 (7%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSING-LAP--VVRGEVLVDTDKGFVNPYAADANVL 105 N + KGEI+ LMG SG GKSTLL + G LA GE+ ++ ++L Sbjct: 22 NFTIAKGEIVTLMGPSGCGKSTLLSWMIGALAGQFSCTGELWLN---------EQRLDML 72 Query: 106 RKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADC 165 + + ++FQ L P +V +N+ L + R++ LE L Sbjct: 73 PAAQRQ-IGILFQDALLFPHLSVGQNLLFALP-ATLKGNARRNAANAALERSGLDGAFHQ 130 Query: 166 KINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVF 225 LSGG + RV RA LL+DEPFS LD +R + + + + R V Sbjct: 131 DPATLSGGQRARVALLRALLAQPKALLLDEPFSRLDVALRDQFRQWVFSEVRAAGIPTVQ 190 Query: 226 VSHDINEA 233 V+HD+ + Sbjct: 191 VTHDLQDV 198 >gnl|CDD|73004 cd03245, ABCC_bacteriocin_exporters, ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2. A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.. Length = 220 Score = 88.7 bits (220), Expect = 2e-18 Identities = 70/217 (32%), Positives = 109/217 (50%), Gaps = 19/217 (8%) Query: 42 VSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD-TDKGFVNPYAA 100 + A+ +L ++ GE + ++G G+GKSTLL+ + GL G VL+D TD ++P Sbjct: 17 IPALDNVSLTIRAGEKVAIIGRVGSGKSTLLKLLAGLYKPTSGSVLLDGTDIRQLDP--- 73 Query: 101 DANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNL- 159 LR + + V Q L + T+ N+ LG D + R + +A + VN Sbjct: 74 -----ADLRRN-IGYVPQDVTLF-YGTLRDNITLGAPLADDERILRAAELAGVTDFVNKH 126 Query: 160 TKWADCKIN----MLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLAL 215 D +I LSGG +Q V ARA PILL+DEP S++D RL++ L L Sbjct: 127 PNGLDLQIGERGRGLSGGQRQAVALARALLNDPPILLLDEPTSAMDMNSEERLKERLRQL 186 Query: 216 QRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCG 252 KT++ ++H + L +RI +M+ GRI+ G Sbjct: 187 LG--DKTLIIITHRPS-LLDLVDRIIVMDSGRIVADG 220 >gnl|CDD|35277 KOG0054, KOG0054, KOG0054, Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]. Length = 1381 Score = 88.8 bits (220), Expect = 2e-18 Identities = 67/222 (30%), Positives = 114/222 (51%), Gaps = 44/222 (19%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 N E+KKG+++ ++G G+GKS+LL +I G P + G V V+ Sbjct: 541 NFEIKKGQLVAVVGPVGSGKSSLLSAILGEMPKLSGSVAVNG------------------ 582 Query: 109 RMHTVSMVFQQFALLPW---RTVARNVELGLEFLDIPDVERKSRVAE------HLEIV-- 157 +V+ V QQ PW TV N+ G + D ER +V + LEI+ Sbjct: 583 ---SVAYVPQQ----PWIQNGTVRENILFGSPY----DEERYDKVIKACALKKDLEILPF 631 Query: 158 -NLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQ 216 +LT+ + IN LSGG KQR+ ARA A I L+D+P S++D + + +E + Sbjct: 632 GDLTEIGERGIN-LSGGQKQRISLARAVYQDADIYLLDDPLSAVDAHVGKHIFEECIRGL 690 Query: 217 RKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEII 258 + KT++ V+H + + ++I +++ G+I++ GT +E++ Sbjct: 691 LR-GKTVILVTHQL-QFLPHADQIIVLKDGKIVESGTYEELL 730 Score = 61.8 bits (150), Expect = 2e-10 Identities = 54/222 (24%), Positives = 104/222 (46%), Gaps = 32/222 (14%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 + +K GE + ++G +GAGKS+L+ ++ L GE+L+D V+ + LR Sbjct: 1160 SFTIKPGEKVGIVGRTGAGKSSLILALFRLVEPAEGEILIDG----VDISKIGLHDLRS- 1214 Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWA----- 163 +S++ Q L TV N++ E+ D + E LE L Sbjct: 1215 ---RLSIIPQDPVLFS-GTVRFNLDPFDEYSD-------DEIWEALERCQLKDVVSSLPG 1263 Query: 164 --DCKI----NMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQR 217 D ++ S G +Q + ARA + IL++DE +S+DP +Q ++ Sbjct: 1264 GLDSEVSEGGENFSVGQRQLLCLARALLRKSKILVLDEATASVDPETDALIQK---TIRE 1320 Query: 218 KLKK-TIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEII 258 + K T++ ++H +N +R+ +++ GR+++ +P E++ Sbjct: 1321 EFKDCTVLTIAHRLNTVMDS-DRVLVLDAGRVVEFDSPAELL 1361 >gnl|CDD|34390 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 235 Score = 88.4 bits (219), Expect = 3e-18 Identities = 66/209 (31%), Positives = 106/209 (50%), Gaps = 9/209 (4%) Query: 40 GMVSAVIK-ANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPY 98 G+ V++ +L V GE +VL G SG+GKSTLLRS+ G++LV + +V+ Sbjct: 21 GVRLPVLRNVSLSVNAGECVVLHGPSGSGKSTLLRSLYANYLPDEGQILVRHEGEWVDLV 80 Query: 99 AADANVLRKLRMHTVSMVFQQFALLPWRTVARNV--ELGLEFLDIPDVERKSRVAEHLEI 156 A+ + ++R T+ V Q ++P R A +V E L +P +++ A+ L Sbjct: 81 TAEPREVLEVRRTTIGYVSQFLRVIP-RVSALDVVAEPLLA-RGVPREVARAKAADLLTR 138 Query: 157 VNLTK--WADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLA 214 +NL + W+ SGG +QRV AR F PILL+DEP +SLD R + EL+ Sbjct: 139 LNLPERLWS-LAPATFSGGEQQRVNIARGFIVDYPILLLDEPTASLDATNR-AVVVELIR 196 Query: 215 LQRKLKKTIVFVSHDINEAFRLGNRIAIM 243 + +V + HD + +R+ + Sbjct: 197 EAKARGAALVGIFHDEEVREAVADRLLDV 225 >gnl|CDD|33903 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only]. Length = 300 Score = 87.2 bits (216), Expect = 5e-18 Identities = 63/225 (28%), Positives = 109/225 (48%), Gaps = 14/225 (6%) Query: 34 DKVSE-YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDK 92 + V++ +G AV + EV GEI L+G +GAGK+T R I GL GE+ + Sbjct: 6 EGVTKSFGDKKAVDNISFEVPPGEIFGLLGPNGAGKTTTFRMILGLLEPTEGEITWNGGP 65 Query: 93 GFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAE 152 L + + + + ++ L P TV ++ E +P E + ++ Sbjct: 66 ------------LSQEIKNRIGYLPEERGLYPKMTVEDQLKYLAELKGMPKAEIQKKLQA 113 Query: 153 HLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDEL 212 LE + + KI LS G +Q++ F A +L++DEPFS LDP+ L+D + Sbjct: 114 WLERLEIVGKKTKKIKELSKGNQQKIQFISAVIHEPELLILDEPFSGLDPVNVELLKDAI 173 Query: 213 LALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEI 257 L ++ TI+F SH + L +R+ +++ G+ + GT ++I Sbjct: 174 FEL-KEEGATIIFSSHRMEHVEELCDRLLMLKKGQTVLYGTVEDI 217 >gnl|CDD|73012 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transporter that is expressed in the mitochondria. Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 236 Score = 87.2 bits (216), Expect = 6e-18 Identities = 58/216 (26%), Positives = 104/216 (48%), Gaps = 17/216 (7%) Query: 48 ANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRK 107 + + G+ + ++G SG+GKST+LR + V G +L+D + + LR+ Sbjct: 20 VSFTIPAGKKVAIVGPSGSGKSTILRLLFRFYDVSSGSILIDG----QDIREVTLDSLRR 75 Query: 108 LRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAE-HLEIVNLTKWADCK 166 + +V Q L T+ N+ G +V ++ A+ H +I+ D Sbjct: 76 ----AIGVVPQDTVLFN-DTIGYNIRYGRPDATDEEVIEAAKAAQIHDKIMRFPDGYDTI 130 Query: 167 IN----MLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKT 222 + LSGG KQRV ARA PILL+DE S+LD +Q L + + +T Sbjct: 131 VGERGLKLSGGEKQRVAIARAILKNPPILLLDEATSALDTHTEREIQAALRDVSK--GRT 188 Query: 223 IVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEII 258 + ++H ++ ++I +++ GRI++ GT +E++ Sbjct: 189 TIVIAHRLSTIVN-ADKIIVLKDGRIVERGTHEELL 223 >gnl|CDD|33894 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism]. Length = 248 Score = 86.2 bits (213), Expect = 1e-17 Identities = 64/223 (28%), Positives = 97/223 (43%), Gaps = 28/223 (12%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 + EV+ GEIL L+G +GAGKSTLL + G+ G + +A +L Sbjct: 19 SGEVRAGEILHLVGPNGAGKSTLLARMAGMTS-GSGSIQFAGQ-------PLEAWSATEL 70 Query: 109 RMHTVSMVFQQ---FALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADC 165 H + QQ FA+ W + L PD R + + + L Sbjct: 71 ARHRAYLSQQQTPPFAMPVWHYLT---------LHQPDKTRTELLNDVAGALALDDKLGR 121 Query: 166 KINMLSGGMKQRVGFARAFATGAP-------ILLMDEPFSSLDPLIRMRLQDELLALQRK 218 N LSGG QRV A P +LL+DEP +SLD + + D LL+ + Sbjct: 122 STNQLSGGEWQRVRLAAVVLQITPDANPAGQLLLLDEPMNSLD-VAQQSALDRLLSALCQ 180 Query: 219 LKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHP 261 IV SHD+N R +R +++ G+++ G +E++ P Sbjct: 181 QGLAIVMSSHDLNHTLRHAHRAWLLKRGKLLASGRREEVLTPP 223 >gnl|CDD|34241 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only]. Length = 580 Score = 86.1 bits (213), Expect = 1e-17 Identities = 62/218 (28%), Positives = 103/218 (47%), Gaps = 16/218 (7%) Query: 48 ANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRK 107 + ++ GE L ++G SG+GKSTL R + G+ P G V +D + D L + Sbjct: 355 ISFALQAGEALGIIGPSGSGKSTLARLLVGIWPPTSGSVRLDG----ADLRQWDREQLGR 410 Query: 108 LRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAE-HLEIVNLTKWADCK 166 + + Q L T+A N+ E D V +R+A H I+ L + D + Sbjct: 411 ----HIGYLPQDVELFD-GTIAENIARFGEEADPEKVIEAARLAGVHELILRLPQGYDTR 465 Query: 167 IN----MLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKT 222 I LSGG +QR+ ARA ++++DEP S+LD L +LA + T Sbjct: 466 IGEGGATLSGGQRQRIALARALYGDPFLVVLDEPNSNLDSEGEAALAAAILAA-KARGGT 524 Query: 223 IVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILH 260 +V ++H + A ++I +++ GRI G +E++ Sbjct: 525 VVVIAHRPS-ALASVDKILVLQDGRIAAFGPREEVLAK 561 >gnl|CDD|34242 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only]. Length = 223 Score = 85.8 bits (212), Expect = 1e-17 Identities = 55/226 (24%), Positives = 90/226 (39%), Gaps = 35/226 (15%) Query: 48 ANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPY-AADANVLR 106 +L V+ GE + + G SG GKSTLL+ + L G +L + + R Sbjct: 22 ISLSVRAGEFIAITGPSGCGKSTLLKIVASLISPTSGTLLFEGE-----DVSTLKPEAYR 76 Query: 107 KLRMHTVSMVFQQFALL----------PWRTVARNVELGLEFLDIPDVERKSRVAEHLEI 156 + VS Q AL PW+ R + + + Sbjct: 77 Q----QVSYCAQTPALFGDTVEDNLIFPWQIRNRRPDRAAALDLLARFALPDSI------ 126 Query: 157 VNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQ 216 LTK I LSGG KQR+ R ILL+DE S+LD + +++ + Sbjct: 127 --LTK----NITELSGGEKQRIALIRNLQFMPKILLLDEITSALDESNKRNIEEMIHRYV 180 Query: 217 RKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPA 262 R+ +++++HD ++A R +++ ++ G G QE A Sbjct: 181 REQNVAVLWITHDKDQAIRHADKVITLQPGHA---GEMQEARQELA 223 >gnl|CDD|72993 cd03234, ABCG_White, The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors. The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan. The pigment precursors are encoded by the white, brown, and scarlet genes, respectively. Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan. However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes. Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in macrophages, hepatocytes, and intestinal mucosa cells. ABCG1 (ABC8), the human homolog of the Drosophila white gene is induced in monocyte-derived macrophages during cholesterol influx mediated by acetylated low-density lipoprotein. It is possible that human ABCG1 forms heterodimers with several heterologous partners.. Length = 226 Score = 85.7 bits (212), Expect = 2e-17 Identities = 57/212 (26%), Positives = 93/212 (43%), Gaps = 18/212 (8%) Query: 48 ANLEVKKGEILVLMGLSGAGKSTLLRSINGLAP---VVRGEVLVDTDKGFVNPYAADANV 104 +L V+ G+++ ++G SG+GK+TLL +I+G G++L + Sbjct: 26 VSLHVESGQVMAILGSSGSGKTTLLDAISGRVEGGGTTSGQILFNGQP-----------R 74 Query: 105 LRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFL---DIPDVERKSRVA-EHLEIVNLT 160 V+ V Q LLP TV + D RK RV L + LT Sbjct: 75 KPDQFQKCVAYVRQDDILLPGLTVRETLTYTAILRLPRKSSDAIRKKRVEDVLLRDLALT 134 Query: 161 KWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLK 220 + + +SGG ++RV A +L++DEP S LD + L L L R+ + Sbjct: 135 RIGGNLVKGISGGERRRVSIAVQLLWDPKVLILDEPTSGLDSFTALNLVSTLSQLARRNR 194 Query: 221 KTIVFVSHDINEAFRLGNRIAIMEGGRIIQCG 252 I+ + ++ FRL +RI ++ G I+ G Sbjct: 195 IVILTIHQPRSDLFRLFDRILLLSSGEIVYSG 226 >gnl|CDD|34240 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism]. Length = 546 Score = 84.6 bits (209), Expect = 3e-17 Identities = 61/205 (29%), Positives = 95/205 (46%), Gaps = 22/205 (10%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADA-NVLRK 107 NL +K+GE++ L+G +G+GKSTL + GL GE+L+D P +A+ RK Sbjct: 343 NLTIKRGELVFLIGGNGSGKSTLAMLLTGLYQPQSGEILLDG-----KPVSAEQLEDYRK 397 Query: 108 LRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKI 167 L S VF + L LG E + + + LE+ + T D + Sbjct: 398 L----FSAVFSDYHLFD-------QLLGPE--GKASPQLIEKWLQRLELAHKTSLNDGRF 444 Query: 168 NM--LSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVF 225 + LS G K+R+ A IL++DE + DP R LL L ++ KTI Sbjct: 445 SNLKLSTGQKKRLALLLALLEERDILVLDEWAADQDPAFRREFYQVLLPLLKEQGKTIFA 504 Query: 226 VSHDINEAFRLGNRIAIMEGGRIIQ 250 +SHD + F +R+ M G++ + Sbjct: 505 ISHD-DHYFIHADRLLEMRNGQLSE 528 >gnl|CDD|30834 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]. Length = 530 Score = 84.5 bits (209), Expect = 4e-17 Identities = 53/214 (24%), Positives = 87/214 (40%), Gaps = 16/214 (7%) Query: 47 KANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFV----NPYAADA 102 +L + GE + L+G +GAGKSTLL+ + G GEV P Sbjct: 21 NVSLTLNPGERIGLVGRNGAGKSTLLKILAGELEPDSGEVTRPKGLRVGYLSQEPPLDPE 80 Query: 103 NVLRKLRMHTVSMVFQ-------QFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLE 155 + + + + +ALL EL ++ ++R E L Sbjct: 81 KTVLDYVIEGFGELRELLAELEEAYALLADPDDELLAELEALLEELDGWTLEARAEEALL 140 Query: 156 IVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLAL 215 + D ++ LSGG ++RV ARA +LL+DEP + LD L+D L Sbjct: 141 GLGFPDE-DRPVSSLSGGWRRRVALARALLEEPDLLLLDEPTNHLDLESIEWLEDYL--- 196 Query: 216 QRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRII 249 ++ T++ VSHD + I ++ G++ Sbjct: 197 -KRYPGTVIVVSHDRYFLDNVATHILELDRGKLT 229 Score = 76.4 bits (188), Expect = 1e-14 Identities = 53/211 (25%), Positives = 88/211 (41%), Gaps = 33/211 (15%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 + + +G+ + ++G +GAGKSTLL+ + G + G V K+ Sbjct: 342 SFRIDRGDRIAIVGPNGAGKSTLLKLLAGELGPLSGTV--------------------KV 381 Query: 109 RMHTVSMVFQQF--ALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLT-KWADC 165 F Q L P +TV + G F D + E V +L T + + Sbjct: 382 GETVKIGYFDQHRDELDPDKTVLEELSEG--FPDGDEQE----VRAYLGRFGFTGEDQEK 435 Query: 166 KINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVF 225 + +LSGG K R+ A+ +LL+DEP + LD L++ L + T++ Sbjct: 436 PVGVLSGGEKARLLLAKLLLQPPNLLLLDEPTNHLDIESLEALEEAL----LDFEGTVLL 491 Query: 226 VSHDINEAFRLGNRIAIMEGGRIIQCGTPQE 256 VSHD R+ RI ++E G ++ Sbjct: 492 VSHDRYFLDRVATRIWLVEDKVEEFEGGYED 522 >gnl|CDD|73005 cd03246, ABCC_Protease_Secretion, This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain. They export degradative enzymes by using a type I protein secretion system and lack an N-terminal signal peptide, but contain a C-terminal secretion signal. The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP). For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli. The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior. HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels. The spectrum of transport substrates ranges from inorganic ions, nutrients such as amino acids, sugars, or peptides, hydrophobic drugs, to large polypeptides, such as HlyA.. Length = 173 Score = 82.1 bits (203), Expect = 2e-16 Identities = 56/202 (27%), Positives = 81/202 (40%), Gaps = 52/202 (25%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRK- 107 + ++ GE L ++G SG+GKSTL R I GL G V +D AD + Sbjct: 22 SFSIEPGESLAIIGPSGSGKSTLARLILGLLRPTSGRVRLD---------GADISQWDPN 72 Query: 108 -LRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCK 166 L H V + Q L ++A N+ Sbjct: 73 ELGDH-VGYLPQDDELFS-GSIAENI---------------------------------- 96 Query: 167 INMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFV 226 LSGG +QR+G ARA IL++DEP S LD L + AL + T + + Sbjct: 97 ---LSGGQRQRLGLARALYGNPRILVLDEPNSHLDVEGERALNQAIAAL-KAAGATRIVI 152 Query: 227 SHDINEAFRLGNRIAIMEGGRI 248 +H E +RI ++E GR+ Sbjct: 153 AHRP-ETLASADRILVLEDGRV 173 >gnl|CDD|35280 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]. Length = 591 Score = 80.7 bits (199), Expect = 5e-16 Identities = 67/238 (28%), Positives = 110/238 (46%), Gaps = 23/238 (9%) Query: 29 SIKKHDKVSEYGMVSAVIK-ANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVL 87 SI+ D YG V+K + + KGE + ++G +G+GKST+LR + G +L Sbjct: 351 SIEFDDVHFSYGPKRKVLKGVSFTIPKGEKVAIVGSNGSGKSTILRLLLRFFDY-SGSIL 409 Query: 88 VDTDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPD---V 144 +D + LR+ ++ +V Q L T+ N++ G D V Sbjct: 410 IDG----QDIKEVSLESLRQ----SIGVVPQDSVLFN-DTILYNIKYGN--PSASDEEVV 458 Query: 145 ERKSRVAEHLEIVNLTKWADCKI----NMLSGGMKQRVGFARAFATGAPILLMDEPFSSL 200 E R H I L + MLSGG KQRV ARAF APILL+DE S+L Sbjct: 459 EACKRAGLHDVISRLPDGYQTLVGERGLMLSGGEKQRVSLARAFLKDAPILLLDEATSAL 518 Query: 201 DPLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEII 258 D + D ++ + +T++ + H ++ ++I +++ G + + GT E++ Sbjct: 519 DSETEREILDMIMDVMS--GRTVIMIVHRLDLLKDF-DKIIVLDNGTVKEYGTHSELL 573 >gnl|CDD|33889 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones]. Length = 209 Score = 78.8 bits (194), Expect = 2e-15 Identities = 43/155 (27%), Positives = 66/155 (42%), Gaps = 14/155 (9%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 + + GE L + G +GAGK+TLLR + GL GEV + + +L Sbjct: 22 SFTLNAGEALQITGPNGAGKTTLLRILAGLLRPDAGEVYWQGEPIQNVRESYHQALL--- 78 Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGLEFL-DIPDVERKSRVAEHLEIVNLTKWADCKI 167 + Q + T N L F + + E L V L D + Sbjct: 79 ------YLGHQPGIKTELTALEN----LHFWQRFHGSGNAATIWEALAQVGLAGLEDLPV 128 Query: 168 NMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDP 202 LS G ++RV AR + + AP+ ++DEPF++LD Sbjct: 129 GQLSAGQQRRVALARLWLSPAPLWILDEPFTALDK 163 >gnl|CDD|34291 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only]. Length = 249 Score = 78.8 bits (194), Expect = 2e-15 Identities = 61/233 (26%), Positives = 99/233 (42%), Gaps = 26/233 (11%) Query: 38 EYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNP 97 +G A+ + V GE+ VL+G +GAGK+TL+ I G GEVL D D Sbjct: 14 SFGGFKALNDLSFSVDPGELRVLIGPNGAGKTTLMDVITGKTRPQEGEVLFDGDTD---- 69 Query: 98 YAADANVLRKLRMHTVSMV-----FQQFALLPWRTVARNVELGLE--------FLDIPDV 144 L KL H ++ FQ+ + TV N+EL L Sbjct: 70 -------LTKLPEHRIARAGIGRKFQKPTVFENLTVRENLELALNRDKSVFASLFARLRA 122 Query: 145 ERKSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLI 204 E + R+ E L + L D +LS G KQ + A +LL+DEP + + Sbjct: 123 EERRRIDELLATIGLGDERDRLAALLSHGQKQWLEIGMLLAQDPKLLLLDEPVAGMTDAE 182 Query: 205 RMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEI 257 + + L +L K +I+ V HD+ + +++ ++ G ++ G+ E+ Sbjct: 183 TEKTAELLKSLAG--KHSILVVEHDMGFVREIADKVTVLHEGSVLAEGSLDEV 233 >gnl|CDD|33911 COG4170, SapD, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]. Length = 330 Score = 77.7 bits (191), Expect = 4e-15 Identities = 68/253 (26%), Positives = 114/253 (45%), Gaps = 27/253 (10%) Query: 40 GMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDK---GFVN 96 G V AV + ++ + +GEI L+G SG+GKS + ++I G V + V D+ ++ Sbjct: 18 GWVKAVDRVSMTLNEGEIRGLVGESGSGKSLIAKAICG---VNKDNWRVTADRMRFDDID 74 Query: 97 PYAADANVLRKLRMHTVSMVFQ--QFALLPWRTVARNVELGLEFLDIPDVE--------- 145 RKL H VSM+FQ Q L P V R + +IP Sbjct: 75 LLRLSPRERRKLVGHNVSMIFQEPQSCLDPSERVGRQL-----IQNIPAWTYKGRWWQRF 129 Query: 146 --RKSRVAEHLEIVNLTKWADCKI---NMLSGGMKQRVGFARAFATGAPILLMDEPFSSL 200 RK R E L V + D L+ G Q+V A A A +L+ DEP +S+ Sbjct: 130 GWRKRRAIELLHRVGIKDHKDIMRSYPYELTEGECQKVMIAIALANQPRLLIADEPTNSM 189 Query: 201 DPLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILH 260 +P + ++ L L + TI+ +SHD+ + ++I ++ G+ ++ +E++ Sbjct: 190 EPTTQAQIFRLLSRLNQNSNTTILLISHDLQMISQWADKINVLYCGQTVESAPSEELVTM 249 Query: 261 PANCYVSEFIQKL 273 P + Y I+ + Sbjct: 250 PHHPYTQALIRAI 262 >gnl|CDD|73007 cd03248, ABCC_TAP, TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules. Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells. Subsequently, virus-infected or malignantly transformed cells can be eliminated. TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.. Length = 226 Score = 77.3 bits (190), Expect = 5e-15 Identities = 54/204 (26%), Positives = 97/204 (47%), Gaps = 17/204 (8%) Query: 50 LEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKLR 109 + GE+ L+G SG+GKST++ + G+VL+D ++ Y + L Sbjct: 35 FTLHPGEVTALVGPSGSGKSTVVALLENFYQPQGGQVLLDGKP--ISQY--EHKYLHS-- 88 Query: 110 MHTVSMVFQQFALLPWRTVARNVELGL---EFLDIPDVERKSRVAEHLEIVNLTKWADC- 165 VS+V Q+ L R++ N+ GL F + + +K+ + + + Sbjct: 89 --KVSLVGQEPVLFA-RSLQDNIAYGLQSCSFECVKEAAQKAHAHSFISELASGYDTEVG 145 Query: 166 -KINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIV 224 K + LSGG KQRV ARA +L++DE S+LD Q + ++T++ Sbjct: 146 EKGSQLSGGQKQRVAIARALIRNPQVLILDEATSALD--AESEQQVQQALYDWPERRTVL 203 Query: 225 FVSHDINEAFRLGNRIAIMEGGRI 248 ++H ++ R ++I +++GGRI Sbjct: 204 VIAHRLSTVER-ADQILVLDGGRI 226 >gnl|CDD|72972 cd03213, ABCG_EPDR, ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR). DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.. Length = 194 Score = 77.5 bits (191), Expect = 5e-15 Identities = 57/207 (27%), Positives = 85/207 (41%), Gaps = 44/207 (21%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPV--VRGEVLVDTDKGFVNPYAADANVLR 106 + + K GE+ +MG SGAGKSTLL ++ G V GEVL +N D R Sbjct: 29 SGKAKPGELTAIMGPSGAGKSTLLNALAGRRTGLGVSGEVL-------INGRPLDKRSFR 81 Query: 107 KLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCK 166 K+ + V Q L P TV + K Sbjct: 82 KI----IGYVPQDDILHPTLTVRETLMFAA-----------------------------K 108 Query: 167 INMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFV 226 + LSGG ++RV A + +L +DEP S LD +++ L L +TI+ Sbjct: 109 LRGLSGGERKRVSIALELVSNPSLLFLDEPTSGLDSSSALQVMSLLRRL-ADTGRTIICS 167 Query: 227 SHDI-NEAFRLGNRIAIMEGGRIIQCG 252 H +E F L +++ ++ GR+I G Sbjct: 168 IHQPSSEIFELFDKLLLLSQGRVIYFG 194 >gnl|CDD|73006 cd03247, ABCC_cytochrome_bd, The CYD subfamily implicated in cytochrome bd biogenesis. The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes. CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space. In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.. Length = 178 Score = 76.8 bits (189), Expect = 8e-15 Identities = 57/204 (27%), Positives = 94/204 (46%), Gaps = 47/204 (23%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 +LE+K+GE + L+G SG+GKSTLL+ + G +GE+ +D + L K Sbjct: 22 SLELKQGEKIALLGRSGSGKSTLLQLLTGDLKPQQGEITLD---------GVPVSDLEKA 72 Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKIN 168 +S++ Q+ L + T RN LG F Sbjct: 73 LSSLISVLNQRPYL--FDTTLRN-NLGRRF------------------------------ 99 Query: 169 MLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSH 228 SGG +QR+ AR API+L+DEP LDP+ +L + + + KT+++++H Sbjct: 100 --SGGERQRLALARILLQDAPIVLLDEPTVGLDPITERQLLSLIFEVLK--DKTLIWITH 155 Query: 229 DINEAFRLGNRIAIMEGGRIIQCG 252 + + ++I +E G+II G Sbjct: 156 HLTGIEHM-DKILFLENGKIIMQG 178 >gnl|CDD|73003 cd03244, ABCC_MRP_domain2, Domain 2 of the ABC subfamily C. This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.. Length = 221 Score = 72.0 bits (177), Expect = 2e-13 Identities = 52/218 (23%), Positives = 99/218 (45%), Gaps = 32/218 (14%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 + +K GE + ++G +G+GKS+LL ++ L + G +L+D V+ L L Sbjct: 24 SFSIKPGEKVGIVGRTGSGKSSLLLALFRLVELSSGSILIDG----VDISKIG---LHDL 76 Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKIN 168 R +S++ Q L T+ N LD + + LE V L ++ + Sbjct: 77 RSR-ISIIPQDPVLFS-GTIRSN-------LDPFGEYSDEELWQALERVGLKEFVESLPG 127 Query: 169 ML-----------SGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQR 217 L S G +Q + ARA + IL++DE +S+DP +Q ++ Sbjct: 128 GLDTVVEEGGENLSVGQRQLLCLARALLRKSKILVLDEATASVDPETDALIQK---TIRE 184 Query: 218 KLKK-TIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTP 254 K T++ ++H ++ +RI +++ GR+++ +P Sbjct: 185 AFKDCTVLTIAHRLDTIIDS-DRILVLDKGRVVEFDSP 221 >gnl|CDD|72990 cd03231, ABC_CcmA_heme_exporter, CcmA, the ATP-binding component of the bacterial CcmAB transporter. The CCM family is involved in bacterial cytochrome c biogenesis. Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH). CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH. The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.. Length = 201 Score = 71.9 bits (176), Expect = 2e-13 Identities = 43/154 (27%), Positives = 68/154 (44%), Gaps = 17/154 (11%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD-TDKGFVNPYAADANVLRK 107 + + GE L + G +G+GK+TLLR + GL+P + G VL++ F A Sbjct: 20 SFTLAAGEALQVTGPNGSGKTTLLRILAGLSPPLAGRVLLNGGPLDFQRDSIARG----- 74 Query: 108 LRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKI 167 + + P +V L F +V E L V L + D + Sbjct: 75 --LLYL-------GHAPGIKTTLSVLENLRFWH--ADHSDEQVEEALARVGLNGFEDRPV 123 Query: 168 NMLSGGMKQRVGFARAFATGAPILLMDEPFSSLD 201 LS G ++RV AR +G P+ ++DEP ++LD Sbjct: 124 AQLSAGQQRRVALARLLLSGRPLWILDEPTTALD 157 >gnl|CDD|33918 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only]. Length = 604 Score = 70.3 bits (172), Expect = 6e-13 Identities = 54/191 (28%), Positives = 83/191 (43%), Gaps = 38/191 (19%) Query: 47 KANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLR 106 + N EV+ GE L++ G SGAGK++LLR++ GL P G + AD+ +L Sbjct: 411 ELNFEVRPGERLLITGESGAGKTSLLRALAGLWPWGSGRIS----------MPADSALL- 459 Query: 107 KLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCK 166 Q LP T+ + D D E + L V L A+ + Sbjct: 460 ---------FLPQRPYLPQGTLREALCYPNAAPDFSDAE----LVAVLHKVGLGDLAE-R 505 Query: 167 IN-------MLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELL-ALQRK 218 ++ +LSGG +QR+ FAR + +DE S+LD +D L L+ + Sbjct: 506 LDEEDRWDRVLSGGEQQRLAFARLLLHKPKWVFLDEATSALDE----ETEDRLYQLLKEE 561 Query: 219 LKK-TIVFVSH 228 L T++ V H Sbjct: 562 LPDATVISVGH 572 >gnl|CDD|35283 KOG0060, KOG0060, KOG0060, Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism, General function prediction only]. Length = 659 Score = 69.6 bits (170), Expect = 1e-12 Identities = 49/187 (26%), Positives = 80/187 (42%), Gaps = 23/187 (12%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKG-----FV--NPYAAD 101 +LEV G+ L++ G SG GK++LLR + GL P G++ TD G F+ PY Sbjct: 455 SLEVPSGQNLLITGPSGCGKTSLLRVLGGLWPSTGGKLTKPTDGGPKDLFFLPQRPYMTL 514 Query: 102 ANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTK 161 LR +++ A A + ++ L L+ + L+ Sbjct: 515 GT-LRD------QVIYPLKAEDMDSKSASDEDI-LRILENVQLGHLLEREGGLDQQVDWD 566 Query: 162 WADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKK 221 W D +LS G +QR+ FAR F ++DE S++ ++ L R++ Sbjct: 567 WMD----VLSPGEQQRLAFARLFYHKPKFAILDECTSAVT----EDVEGALYRKCREMGI 618 Query: 222 TIVFVSH 228 T + V H Sbjct: 619 TFISVGH 625 >gnl|CDD|35279 KOG0056, KOG0056, KOG0056, Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism]. Length = 790 Score = 68.9 bits (168), Expect = 2e-12 Identities = 56/230 (24%), Positives = 98/230 (42%), Gaps = 29/230 (12%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 + V+ G+ + L+G SGAGKST++R + V G + +D + + Sbjct: 558 SFTVQPGKTVALVGPSGAGKSTIMRLLFRFFDVNSGSITIDG---------------QDI 602 Query: 109 RMHTVSMVFQQFALLPWRTV------ARNVELGLEFLDIPDVERKSRVAE-HLEIVNLTK 161 R T S + ++P TV N+ +V ++ A+ H I+ + Sbjct: 603 RNVTQSSLRSSIGVVPQDTVLFNDTILYNIRYAKPSASNEEVYAAAKAAQIHDRILQFPE 662 Query: 162 WADCKIN----MLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQR 217 + ++ LSGG KQRV AR I+L+DE S+LD +Q L L Sbjct: 663 GYNTRVGERGLKLSGGEKQRVAIARTILKAPSIILLDEATSALDTNTERAIQAALARLCA 722 Query: 218 KLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVS 267 +T + V+H ++ + I ++ GRI++ G +E++ Y Sbjct: 723 --NRTTIVVAHRLSTIVN-ADLILVISNGRIVERGRHEELLKRDGGAYAD 769 >gnl|CDD|72982 cd03223, ABCD_peroxisomal_ALDP, Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome. The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation. To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes. X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family. The disease is characterized by a striking and unpredictable variation in phenotypic expression. Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asymptomatic).. Length = 166 Score = 68.6 bits (168), Expect = 2e-12 Identities = 44/188 (23%), Positives = 70/188 (37%), Gaps = 62/188 (32%) Query: 45 VIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKG--FV--NPYAA 100 + + E+K G+ L++ G SG GKS+L R++ GL P G + + + F+ PY Sbjct: 17 LKDLSFEIKPGDRLLITGPSGTGKSSLFRALAGLWPWGSGRIGMPEGEDLLFLPQRPYLP 76 Query: 101 DANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLT 160 + +L + PW V Sbjct: 77 LGTLREQL-------------IYPWDDV-------------------------------- 91 Query: 161 KWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLK 220 LSGG +QR+ FAR + +DE S+LD +D L L ++L Sbjct: 92 ---------LSGGEQQRLAFARLLLHKPKFVFLDEATSALDE----ESEDRLYQLLKELG 138 Query: 221 KTIVFVSH 228 T++ V H Sbjct: 139 ITVISVGH 146 >gnl|CDD|35288 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]. Length = 1391 Score = 65.3 bits (159), Expect = 2e-11 Identities = 62/219 (28%), Positives = 95/219 (43%), Gaps = 28/219 (12%) Query: 52 VKKGEILVLMGLSGAGKSTLLRSING--LAPVVRGEVLVDTDKGFVNPYAADANVLRKLR 109 K G + LMG SGAGK+TLL + G + G++L+ GF A V Sbjct: 814 FKPGVLTALMGESGAGKTTLLDVLAGRKTGGYIEGDILIS---GFPKDQETFARV----- 865 Query: 110 MHTVSMVFQQFALLPWRTVARNVELGLEF---LDIPDVERKSRVAEHLEIVNLTKWADCK 166 V QQ P TV ++ ++ D E+ V E +E++ L ++AD Sbjct: 866 ---SGYVEQQDIHSPELTVRESLRFSAALRLPKEVSDEEKYEYVEEVIELLELKEYADAL 922 Query: 167 INM----LSGGMKQRVGFA-RAFATGAPILLMDEPFSSLD---PLIRMRLQDELLALQRK 218 + + LS ++R+ A + IL +DEP S LD I MR +L + Sbjct: 923 VGLPGSGLSTEQRKRLTIGVELVANPSSILFLDEPTSGLDSQAAAIVMRFLRKLADTGQT 982 Query: 219 LKKTIVFVSHDINEAFRLGNRIAIM-EGGRIIQCGTPQE 256 + TI S DI EAF + + ++ GG+ + G E Sbjct: 983 ILCTIHQPSIDIFEAF---DELLLLKRGGQTVYFGPLGE 1018 Score = 61.8 bits (150), Expect = 3e-10 Identities = 57/291 (19%), Positives = 111/291 (38%), Gaps = 32/291 (10%) Query: 6 VKFRDVDIVFGETSNKIRKRSRYSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSG 65 + D+ +G T I SI + + + + + +K GE+ +++G G Sbjct: 92 ALGVEADVTYGPTLVNILSNPLESILRMLGKRKKKKIQILKDISGIIKPGEMTLVLGPPG 151 Query: 66 AGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKLR-MHTVSMVFQQFALLP 124 +GK+TLL+++ G +D + + L++ TV+ +Q P Sbjct: 152 SGKTTLLKALAGK---------LDNFLKSSGEITYNGHDLKEFVPKKTVAYNSEQDVHFP 202 Query: 125 WRTVARNVELGLEF----LDIPDVERKSRVA----EHLEIVNLTKWADCKIN-----MLS 171 TV ++ +V R+ ++A L+I+ L AD + +S Sbjct: 203 ELTVRETLDFAARCKGPGSRYDEVSRREKLAAMTDYLLKILGLDHCADTLVGNDMVRGVS 262 Query: 172 GGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKT-IVFVSHDI 230 GG ++RV A IL DE LD ++ L L T +V + Sbjct: 263 GGERKRVSIGEMLVGPASILFWDEITRGLDSSTAFQIIKALRQLAHITGATALVSILQPS 322 Query: 231 NEAFRLGNRIAIMEGGRIIQCGTPQEIILH--------PANCYVSEFIQKL 273 E + L + + ++ G I G E++ + P ++F+ ++ Sbjct: 323 PEIYDLFDDVILLSEGYQIYQGPRDEVLPYFEDMGFKCPPRKGTADFLTEV 373 >gnl|CDD|73049 cd03290, ABCC_SUR1_N, The SUR domain 1. The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.. Length = 218 Score = 64.3 bits (156), Expect = 4e-11 Identities = 54/195 (27%), Positives = 90/195 (46%), Gaps = 26/195 (13%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 N+ + G++ +++G G GKS+LL +I G + G+V N R Sbjct: 21 NIRIPTGQLTMIVGQVGCGKSSLLLAILGEMQTLEGKVHWSN----KNESEPSFEATRSR 76 Query: 109 RMHTVSMVFQQFALLPW---RTVARNVELGLEFLDIPDVERKSRVAEH---------LEI 156 ++V+ Q+ PW TV N+ G F + +R V + L Sbjct: 77 NRYSVAYAAQK----PWLLNATVEENITFGSPF----NKQRYKAVTDACSLQPDIDLLPF 128 Query: 157 VNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLD-PLIRMRLQDELLAL 215 + T+ + IN LSGG +QR+ ARA I+ +D+PFS+LD L +Q+ +L Sbjct: 129 GDQTEIGERGIN-LSGGQRQRICVARALYQNTNIVFLDDPFSALDIHLSDHLMQEGILKF 187 Query: 216 QRKLKKTIVFVSHDI 230 + K+T+V V+H + Sbjct: 188 LQDDKRTLVLVTHKL 202 >gnl|CDD|31438 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]. Length = 591 Score = 63.3 bits (154), Expect = 9e-11 Identities = 56/241 (23%), Positives = 101/241 (41%), Gaps = 29/241 (12%) Query: 6 VKFRDVDIVFGETSNKIRKRSRYSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSG 65 V+FR +I F E + K ++ D YG ++ E+ GE++ ++G +G Sbjct: 319 VRFRPEEIEFEEKPPRDDKARDTLVEYPDLKKTYGDFKLEVEEG-EIYDGEVIGILGPNG 377 Query: 66 AGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPY-AADANVLRKLRMHTVSMVFQQFALLP 124 GK+T ++ + G+ G D + Y + D + TV + Sbjct: 378 IGKTTFVKLLAGVIKPDEGSE-EDLKVSYKPQYISPDYD-------GTVEDLL------- 422 Query: 125 WRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAF 184 R+ R+ K+ + + L + +L + ++ LSGG QRV A A Sbjct: 423 -RSAIRS--------AFGSSYFKTEIVKPLNLEDLL---ERPVDELSGGELQRVAIAAAL 470 Query: 185 ATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIME 244 + A + L+DEP + LD R+ + + +KT + V HDI + +R+ + E Sbjct: 471 SREADLYLLDEPSAYLDVEQRIIVAKVIRRFIENNEKTALVVDHDIYMIDYVSDRLIVFE 530 Query: 245 G 245 G Sbjct: 531 G 531 Score = 53.7 bits (129), Expect = 7e-08 Identities = 50/184 (27%), Positives = 75/184 (40%), Gaps = 12/184 (6%) Query: 52 VKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADA---NVLRKL 108 + G+++ ++G +G GKST L+ + G G V N +KL Sbjct: 97 PRPGKVVGILGPNGIGKSTALKILAGELKPNLGRYEDPPSWDEVIKRFRGTELQNYFKKL 156 Query: 109 RMHTVSMVF--QQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCK 166 + V Q L+P + V V L+ V+ + + E +E + L D Sbjct: 157 YEGELRAVHKPQYVDLIP-KVVKGKVGELLK-----KVDERGKFDEVVERLGLENVLDRD 210 Query: 167 INMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFV 226 ++ LSGG QRV A A A + DEP S LD R+ + L K IV V Sbjct: 211 VSELSGGELQRVAIAAALLRDADVYFFDEPSSYLDIRQRLNAARVIRELAEDGKYVIV-V 269 Query: 227 SHDI 230 HD+ Sbjct: 270 EHDL 273 >gnl|CDD|34862 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones]. Length = 497 Score = 63.0 bits (153), Expect = 1e-10 Identities = 58/217 (26%), Positives = 101/217 (46%), Gaps = 17/217 (7%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 + + G+ + ++G SGAGKST+LR + V G + +D + + LR+ Sbjct: 283 SFTIPLGKTVAIVGESGAGKSTILRLLFRFYDVNSGSITID--GQDIRDVTQQS--LRR- 337 Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVA-EHLEIVNLTKWADCKI 167 + +V Q L T+A N++ G +V + A H I +L + D + Sbjct: 338 ---AIGIVPQDTVLFN-DTIAYNIKYGRPDATAEEVGAAAEAAQIHDFIQSLPEGYDTGV 393 Query: 168 NM----LSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTI 223 LSGG KQRV AR PIL++DE S+LD +Q L + +T Sbjct: 394 GERGLKLSGGEKQRVAIARTILKNPPILILDEATSALDTHTEQAIQAALREVSA--GRTT 451 Query: 224 VFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILH 260 + ++H ++ + I +++ GRI++ GT +E++ Sbjct: 452 LVIAHRLSTIID-ADEIIVLDNGRIVERGTHEELLAA 487 >gnl|CDD|36145 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC superfamily) [General function prediction only]. Length = 614 Score = 62.3 bits (151), Expect = 2e-10 Identities = 54/198 (27%), Positives = 80/198 (40%), Gaps = 35/198 (17%) Query: 47 KANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLR 106 K N + + L+G +GAGKSTLL+ I G G V + N L Sbjct: 408 KLNFGIDLDSRVALVGPNGAGKSTLLKLITGDLQPTIGMVSRHSH-----------NKLP 456 Query: 107 KLRMHTVSMVFQQFALLPWRTVARNVELGLEFL--DIPDVERKSRVAEHLEIVNLTKWA- 163 + H L ++ LEF+ PD + + L LT A Sbjct: 457 RYNQH------LAEQLDLDKSS-------LEFMMPKFPDEKELEEMRSILGRFGLTGDAQ 503 Query: 164 DCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTI 223 ++ LS G ++RV FAR +LL+DEP + LD L + + + + Sbjct: 504 VVPMSQLSDGQRRRVLFARLAVKQPHLLLLDEPTNHLDIETIDALAEAI----NEFPGGV 559 Query: 224 VFVSHDINEAFRLGNRIA 241 V VSHD FRL +++A Sbjct: 560 VLVSHD----FRLISQVA 573 Score = 56.1 bits (135), Expect = 1e-08 Identities = 48/191 (25%), Positives = 83/191 (43%), Gaps = 19/191 (9%) Query: 50 LEVKKGEILVLMGLSGAGKSTLLRSING-LAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 LE+ +G L+G +G+GKST LR+I G P+ + ++ ++ + Sbjct: 96 LELNRGRRYGLIGPNGSGKSTFLRAIAGREVPIPEHIDFYLLSREIE---PSEKQAVQAV 152 Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERK---------SRVAEHL-EIVN 158 M T + L A + + E ++ ER ++ A+ L + Sbjct: 153 VMETDHERKRLEYLAEDLAQACDDKEKDELDEL--YERLDEMDNDTFEAKAAKILHGLGF 210 Query: 159 LTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRK 218 L++ D K+ LSGG + R ARA +LL+DEP + LD + L++ L + Sbjct: 211 LSEMQDKKVKDLSGGWRMRAALARALFQKPDLLLLDEPTNHLDLEAIVWLEEY---LAKY 267 Query: 219 LKKTIVFVSHD 229 + +V VSH Sbjct: 268 DRIILVIVSHS 278 >gnl|CDD|35286 KOG0063, KOG0063, KOG0063, RNAse L inhibitor, ABC superfamily [RNA processing and modification]. Length = 592 Score = 61.5 bits (149), Expect = 3e-10 Identities = 67/256 (26%), Positives = 104/256 (40%), Gaps = 32/256 (12%) Query: 7 KFRDVDIVF--GETSNKIRKRSRYSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLS 64 +FR +VF + S++ R+ RYS K K G IK E EI+V++G + Sbjct: 320 RFRPECLVFLASDLSSEDRRTGRYSYPKMKK--TVGDFCLCIKVG-EFSDSEIIVMLGEN 376 Query: 65 GAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLP 124 G GK+T +R + G G + V + + R TV + Sbjct: 377 GTGKTTFIRMLAGRLKPDEGGEIP------VLNVSYKPQKISPKREGTVRQLL------- 423 Query: 125 WRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAF 184 T R+ + +F + V + L+I N+ D ++ LSGG QRV A Sbjct: 424 -HTKIRDAYMHPQF--------VNDVMKPLQIENII---DQEVQGLSGGELQRVALALCL 471 Query: 185 ATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIME 244 A + L+DEP + LD R+ + KKT V HD A L +R+ + E Sbjct: 472 GKPADVYLIDEPSAYLDSEQRIIASKVIKRFILHAKKTAFVVEHDFIMATYLADRVIVFE 531 Query: 245 G--GRIIQCGTPQEII 258 G +PQ ++ Sbjct: 532 GQPSVNTVANSPQSLL 547 Score = 42.6 bits (100), Expect = 2e-04 Identities = 50/183 (27%), Positives = 79/183 (43%), Gaps = 12/183 (6%) Query: 53 KKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADA---NVLRKLR 109 + G++L L+G +G GKST L+ + G G D + Y + N K+ Sbjct: 98 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDNPPDWQEILTYFRGSELQNYFTKIL 157 Query: 110 MHTVSMVF--QQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKI 167 + + Q +P R V V L+ D + + K V + L++ NL D ++ Sbjct: 158 EDNLKAIIKPQYVDQIP-RAVKGTVGSLLDRKD--ERDNKEEVCDQLDLNNLL---DREV 211 Query: 168 NMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVS 227 LSGG QR A A + + DEP S LD R++ + +L + IV V Sbjct: 212 EQLSGGELQRFAIAMVCVQKADVYMFDEPSSYLDVKQRLKAAITIRSLINPDRYIIV-VE 270 Query: 228 HDI 230 HD+ Sbjct: 271 HDL 273 >gnl|CDD|32537 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only]. Length = 593 Score = 60.4 bits (146), Expect = 6e-10 Identities = 50/183 (27%), Positives = 77/183 (42%), Gaps = 22/183 (12%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 NLE+K G+++ ++G SGAGK+TLLR I G RGE D G V + L Sbjct: 403 NLEIKPGDVVAVVGQSGAGKTTLLRMILGAQ-KGRGEEKYRPDSGKVEVPKNTVSALIPG 461 Query: 109 RMH---TVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADC 165 + + + VE+ L + D R Sbjct: 462 EYEPEFGEVTILEHLRSKT-GDLNAAVEI-LNRAGLSDAVLYRR---------------- 503 Query: 166 KINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVF 225 K + LS G K+R A+ A +LL+DE + LD L +R+ ++ L R+ T++ Sbjct: 504 KFSELSTGQKERAKLAKLLAERPNVLLIDEFAAHLDELTAVRVARKISELAREAGITLIV 563 Query: 226 VSH 228 V+H Sbjct: 564 VTH 566 >gnl|CDD|72992 cd03233, ABC_PDR_domain1, The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. This PDR subfamily represents domain I of its (ABC-IM)2 organization. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 202 Score = 59.8 bits (145), Expect = 1e-09 Identities = 44/206 (21%), Positives = 78/206 (37%), Gaps = 44/206 (21%) Query: 52 VKKGEILVLMGLSGAGKSTLLRSINGLAPV---VRGEVLVDTDKGFVNPYAADANVLRKL 108 VK GE+++++G G+G STLL+++ V G++ + PY A Sbjct: 30 VKPGEMVLVLGRPGSGCSTLLKALANRTEGNVSVEGDIHYNG-----IPYKEFAEKYP-- 82 Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKIN 168 + V ++ P TV ++ L CK N Sbjct: 83 --GEIIYVSEEDVHFPTLTVRETLDFALR---------------------------CKGN 113 Query: 169 M----LSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIV 224 +SGG ++RV A A + A +L D LD + + + + LK T Sbjct: 114 EFVRGISGGERKRVSIAEALVSRASVLCWDNSTRGLDSSTALEILKCIRTMADVLKTTTF 173 Query: 225 F-VSHDINEAFRLGNRIAIMEGGRII 249 + +E + L +++ ++ GR I Sbjct: 174 VSLYQASDEIYDLFDKVLVLYEGRQI 199 >gnl|CDD|72976 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component. Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems. The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions. The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.. Length = 200 Score = 58.6 bits (142), Expect = 3e-09 Identities = 56/216 (25%), Positives = 97/216 (44%), Gaps = 45/216 (20%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLA--PVVRGEVLVDTDKGFVNPYAADANVLR 106 NL +KKGE+ LMG +G+GKSTL ++I G V GE+L + D Sbjct: 20 NLTIKKGEVHALMGPNGSGKSTLAKTIMGHPKYEVTEGEILFKGED------ITDLPPEE 73 Query: 107 KLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCK 166 + R+ + + FQ +IP V + A+ L VN Sbjct: 74 RARL-GIFLAFQ------------------YPPEIPGV----KNADFLRYVNEG------ 104 Query: 167 INMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFV 226 SGG K+R + + ++DEP S LD + +RL E++ R+ K+++ + Sbjct: 105 ---FSGGEKKRNEILQLLLLEPDLAILDEPDSGLD-IDALRLVAEVINKLREEGKSVLII 160 Query: 227 SH--DINEAFRLGNRIAIMEGGRIIQCGTPQEIILH 260 +H + + + +R+ ++ GRI++ G +E+ L Sbjct: 161 THYQRLLDYIK-PDRVHVLYDGRIVKSG-DKELALE 194 >gnl|CDD|72996 cd03237, ABC_RNaseL_inhibitor_domain2, The ATPase domain 2 of RNase L inhibitor. The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.. Length = 246 Score = 58.0 bits (140), Expect = 3e-09 Identities = 47/195 (24%), Positives = 85/195 (43%), Gaps = 24/195 (12%) Query: 51 EVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKLRM 110 + + E++ ++G +G GK+T ++ + G+ G++ ++ D P A+ +R Sbjct: 21 SISESEVIGILGPNGIGKTTFIKMLAGVLKPDEGDIEIELDTVSYKPQYIKADYEGTVR- 79 Query: 111 HTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKINML 170 LL ++ ++ F K+ +A+ L+I + D ++ L Sbjct: 80 ----------DLL--SSITKDFYTHPYF--------KTEIAKPLQIEQIL---DREVPEL 116 Query: 171 SGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHDI 230 SGG QRV A + A I L+DEP + LD R+ + +KT V HDI Sbjct: 117 SGGELQRVAIAACLSKDADIYLLDEPSAYLDVEQRLMASKVIRRFAENNEKTAFVVEHDI 176 Query: 231 NEAFRLGNRIAIMEG 245 L +R+ + EG Sbjct: 177 IMIDYLADRLIVFEG 191 >gnl|CDD|72980 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth. EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site. The reaction requires ATP hydrolysis. EF-3 contains two ATP nucleotide binding sequence (NBS) motifs. NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.. Length = 144 Score = 57.4 bits (139), Expect = 6e-09 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 4/78 (5%) Query: 170 LSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHD 229 LSGG K R+ A+ +LL+DEP + LD L++ L ++ T++ VSHD Sbjct: 71 LSGGEKMRLALAKLLLENPNLLLLDEPTNHLDLESIEALEEAL----KEYPGTVILVSHD 126 Query: 230 INEAFRLGNRIAIMEGGR 247 ++ +I +E G+ Sbjct: 127 RYFLDQVATKIIELEDGK 144 Score = 40.1 bits (94), Expect = 9e-04 Identities = 16/43 (37%), Positives = 23/43 (53%) Query: 47 KANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD 89 +L + G+ + L+G +GAGKSTLL+ I G G V Sbjct: 18 DISLTINPGDRIGLVGRNGAGKSTLLKLIAGELEPDEGIVTWG 60 >gnl|CDD|30745 COG0396, SufC, ABC-type transport system involved in Fe-S cluster assembly, ATPase component [Posttranslational modification, protein turnover, chaperones]. Length = 251 Score = 56.7 bits (137), Expect = 1e-08 Identities = 55/232 (23%), Positives = 102/232 (43%), Gaps = 30/232 (12%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAP--VVRGEVLVDTDKGFVNPYAADANVLR 106 NL VK+GE+ +MG +G+GKSTL +I G V GE+L D + + + Sbjct: 24 NLTVKEGEVHAIMGPNGSGKSTLAYTIMGHPKYEVTEGEILFDGED------ILELSPDE 77 Query: 107 KLRMHTVSMVFQQFALLP------WRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLT 160 + R + + FQ +P + A N G E + E E++ L Sbjct: 78 RARA-GIFLAFQYPVEIPGVTNSDFLRAAMNARRG---ARGILPEFIKELKEKAELLGLD 133 Query: 161 -KWADCKINM-LSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRK 218 ++ + +N SGG K+R + + ++DEP S LD + +++ E + R+ Sbjct: 134 EEFLERYVNEGFSGGEKKRNEILQLLLLEPKLAILDEPDSGLD-IDALKIVAEGINALRE 192 Query: 219 LKKTIVFVSHDINEAFRLGN-----RIAIMEGGRIIQCGTPQEIILHPANCY 265 + ++ ++H + RL + ++ ++ GRI++ G P+ Y Sbjct: 193 EGRGVLIITH--YQ--RLLDYIKPDKVHVLYDGRIVKSGDPELAEELEEKGY 240 >gnl|CDD|73050 cd03291, ABCC_CFTR1, The CFTR subfamily domain 1. The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia. Use of the term assembly of a functional ion channel implies the coming together of subunits, or at least smaller not-yet functional components of the active whole. In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells. CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.. Length = 282 Score = 53.8 bits (129), Expect = 7e-08 Identities = 56/227 (24%), Positives = 100/227 (44%), Gaps = 41/227 (18%) Query: 42 VSAVIK-ANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAA 100 + V+K NL+++KGE+L + G +G+GK++LL I G G++ Sbjct: 49 GAPVLKNINLKIEKGEMLAITGSTGSGKTSLLMLILGELEPSEGKI-------------- 94 Query: 101 DANVLRKLRMHTVSMVF-QQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIV-N 158 H+ + F QF+ + T+ N+ G+ + D R V + ++ + Sbjct: 95 ---------KHSGRISFSSQFSWIMPGTIKENIIFGVSY----DEYRYKSVVKACQLEED 141 Query: 159 LTKWADCKINM--------LSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQD 210 +TK+ + K N LSGG + R+ ARA A + L+D PF LD + + Sbjct: 142 ITKFPE-KDNTVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEKEIFE 200 Query: 211 ELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEI 257 + + KT + V+ + E + ++I I+ G GT E+ Sbjct: 201 SCVC-KLMANKTRILVTSKM-EHLKKADKILILHEGSSYFYGTFSEL 245 >gnl|CDD|37566 KOG2355, KOG2355, KOG2355, Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only, Transcription]. Length = 291 Score = 52.7 bits (126), Expect = 1e-07 Identities = 52/210 (24%), Positives = 93/210 (44%), Gaps = 9/210 (4%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 NL++ G +L+G +GAGK+TLL+ ++G V G V V F + + L L Sbjct: 34 NLDLPAGSRCLLVGANGAGKTTLLKILSGKHMVGGGVVQVLGRSAFHDTSLESSGDLSYL 93 Query: 109 RMHTVSMV-FQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKI 167 V L A ++ G+ D ER+ ++ + L+I +L +W ++ Sbjct: 94 GGEWSKTVGIAGEVPLQGDISAEHMIFGVGGDDP---ERREKLIDILDI-DL-RW---RM 145 Query: 168 NMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVS 227 + +S G ++RV +LL+DE LD L R L + L + TIV+ + Sbjct: 146 HKVSDGQRRRVQICMGLLKPFKVLLLDEVTVDLDVLARADLLEFLKEECEQRGATIVYAT 205 Query: 228 HDINEAFRLGNRIAIMEGGRIIQCGTPQEI 257 H + + ++ G+++ Q+I Sbjct: 206 HIFDGLETWPTHLVYIKSGKLVDNLKYQKI 235 >gnl|CDD|35285 KOG0062, KOG0062, KOG0062, ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism, Translation, ribosomal structure and biogenesis]. Length = 582 Score = 52.2 bits (125), Expect = 2e-07 Identities = 52/185 (28%), Positives = 77/185 (41%), Gaps = 30/185 (16%) Query: 47 KANLEVKKGEILVLMGLSGAGKSTLLRSI-NGLAPVVRGEVLVDTDKGFVNPYAADANVL 105 KANL + +G L+G +G GKSTLLR+I NG E V D +++ Sbjct: 98 KANLTLSRGRRYGLVGRNGIGKSTLLRAIANGQVSGFHVEQEVRGDDTEALQSVLESDTE 157 Query: 106 RKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADC 165 R + ++ LL GL +I + L + T Sbjct: 158 RL------DFLAEEKELL----------AGLTLEEI--------YDKILAGLGFTPEMQL 193 Query: 166 K-INMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIV 224 + LSGG + R+ ARA +LL+DEP + LD + L++ L + K T + Sbjct: 194 QPTKSLSGGWRMRLALARALFAKPDLLLLDEPTNHLDVVAVAWLENYL----QTWKITSL 249 Query: 225 FVSHD 229 VSHD Sbjct: 250 IVSHD 254 Score = 43.4 bits (102), Expect = 9e-05 Identities = 34/101 (33%), Positives = 48/101 (47%), Gaps = 11/101 (10%) Query: 152 EHLEIVNLT-KWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQD 210 HL L+ + A I LSGG K RV FA +L++DEP + LD +D Sbjct: 464 RHLGSFGLSGELALQSIASLSGGQKSRVAFAACTWNNPHLLVLDEPTNHLD-------RD 516 Query: 211 ELLALQRKLKK---TIVFVSHDINEAFRLGNRIAIMEGGRI 248 L AL + LK +V VSHD L + ++E G++ Sbjct: 517 SLGALAKALKNFNGGVVLVSHDEEFISSLCKELWVVEDGKV 557 >gnl|CDD|72995 cd03236, ABC_RNaseL_inhibitor_domain1, The ATPase domain 1 of RNase L inhibitor. The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.. Length = 255 Score = 51.8 bits (124), Expect = 2e-07 Identities = 59/218 (27%), Positives = 94/218 (43%), Gaps = 14/218 (6%) Query: 34 DKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSING-LAPVVRGEVLVDTDK 92 + V YG S + ++G++L L+G +G GKST L+ + G L P + Sbjct: 5 EPVHRYGPNSFKLHRLPVPREGQVLGLVGPNGIGKSTALKILAGKLKPNLGKFDDPPDWD 64 Query: 93 GFVNPYAADA--NVLRKLRMHTVSMVF--QQFALLPWRTVARNVELGLEFLDIPDVERKS 148 ++ + N KL V ++ Q L+P + V V L+ D + + Sbjct: 65 EILDEFRGSELQNYFTKLLEGDVKVIVKPQYVDLIP-KAVKGKVGELLKKKD--ERGKLD 121 Query: 149 RVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRL 208 + + LE+ ++ D I+ LSGG QRV A A A A DEP S LD I+ RL Sbjct: 122 ELVDQLELRHVL---DRNIDQLSGGELQRVAIAAALARDADFYFFDEPSSYLD--IKQRL 176 Query: 209 QDELLALQR-KLKKTIVFVSHDINEAFRLGNRIAIMEG 245 L + + ++ V HD+ L + I + G Sbjct: 177 NAARLIRELAEDDNYVLVVEHDLAVLDYLSDYIHCLYG 214 >gnl|CDD|73029 cd03270, ABC_UvrA_I, The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.. Length = 226 Score = 51.3 bits (123), Expect = 4e-07 Identities = 58/236 (24%), Positives = 97/236 (41%), Gaps = 56/236 (23%) Query: 49 NLEVKKGEILVLMGLSGAGKSTL----------LRSINGLAPVVR------GEVLVDTDK 92 ++++ + +++V+ G+SG+GKS+L R + L+ R + VD+ + Sbjct: 15 DVDIPRNKLVVITGVSGSGKSSLAFDTIYAEGQRRYVESLSAYARQFLGQMDKPDVDSIE 74 Query: 93 GFVNPYAADANVLRK---LRMHTVSMVFQQFALLPWRTVARN-----VELGLEFLDIPDV 144 G A D + + TV+ ++ LL R R V++GL +L + Sbjct: 75 GLSPAIAIDQKTTSRNPRSTVGTVTEIYDYLRLLFARVGIRERLGFLVDVGLGYLTL--- 131 Query: 145 ERKSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATG--APILLMDEPFSSLDP 202 SR A LSGG QR+ A +G + ++DEP L P Sbjct: 132 ---SRSA----------------PTLSGGEAQRIRLATQIGSGLTGVLYVLDEPSIGLHP 172 Query: 203 LIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRI------AIMEGGRIIQCG 252 RL + L L R L T++ V HD + R + + A + GG I+ G Sbjct: 173 RDNDRLIETLKRL-RDLGNTVLVVEHD-EDTIRAADHVIDIGPGAGVHGGEIVAQG 226 >gnl|CDD|72981 cd03222, ABC_RNaseL_inhibitor, The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.. Length = 177 Score = 48.5 bits (115), Expect = 3e-06 Identities = 29/76 (38%), Positives = 37/76 (48%) Query: 170 LSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHD 229 LSGG QRV A A A L DEP + LD R+ + L + KKT + V HD Sbjct: 72 LSGGELQRVAIAAALLRNATFYLFDEPSAYLDIEQRLNAARAIRRLSEEGKKTALVVEHD 131 Query: 230 INEAFRLGNRIAIMEG 245 + L +RI + EG Sbjct: 132 LAVLDYLSDRIHVFEG 147 Score = 33.0 bits (75), Expect = 0.11 Identities = 14/48 (29%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Query: 30 IKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSING 77 D V YG+ +++ VK+GE++ ++G +G GK+T ++ + G Sbjct: 1 QLYPDCVKRYGVFFLLVELG-VVKEGEVIGIVGPNGTGKTTAVKILAG 47 >gnl|CDD|72991 cd03232, ABC_PDR_domain2, The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. This PDR subfamily represents domain I of its (ABC-IM)2 organization. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 192 Score = 46.0 bits (109), Expect = 1e-05 Identities = 53/200 (26%), Positives = 75/200 (37%), Gaps = 49/200 (24%) Query: 52 VKKGEILVLMGLSGAGKSTLLRSING--LAPVVRGEVLVDTDKGFVNPYAADANVLRKLR 109 VK G + LMG SGAGK+TLL + G A V+ GE+L++ D N R Sbjct: 30 VKPGTLTALMGESGAGKTTLLDVLAGRKTAGVITGEILING-------RPLDKNFQR--- 79 Query: 110 MHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKINM 169 + V QQ P TV L F + Sbjct: 80 --STGYVEQQDVHSPNLTV----REALRF-------------------------SALLRG 108 Query: 170 LSGGMKQRVGFARAFATGAPILLMDEPFSSLD---PLIRMRLQDELLALQRKLKKTIVFV 226 LS ++R+ A IL +DEP S LD +R +L + + TI Sbjct: 109 LSVEQRKRLTIGVELAAKPSILFLDEPTSGLDSQAAYNIVRFLKKLADSGQAILCTIHQP 168 Query: 227 SHDINEAFRLGNRIAIMEGG 246 S I E F +R+ +++ G Sbjct: 169 SASIFEKF---DRLLLLKRG 185 >gnl|CDD|35287 KOG0064, KOG0064, KOG0064, Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism]. Length = 728 Score = 46.1 bits (109), Expect = 1e-05 Identities = 46/163 (28%), Positives = 70/163 (42%), Gaps = 20/163 (12%) Query: 45 VIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDT-DKGFV---NPYAA 100 V K +++ G L++ G +G GKS+L R + GL PV G + + + F PY + Sbjct: 498 VPKLTFQIEPGMHLLITGPNGCGKSSLFRILGGLWPVYNGLLSIPRPNNIFYIPQRPYMS 557 Query: 101 DANVLRKLRMHTV-SMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNL 159 LR + +Q R + +L LDI +E + + V Sbjct: 558 ----GGTLRDQIIYPDSSEQMK----RKGYTDQDL-EAILDIVHLEHILQREGGWDAVR- 607 Query: 160 TKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDP 202 W D +LSGG KQR+G AR F L+DE S++ Sbjct: 608 -DWKD----VLSGGEKQRMGMARMFYHRPKYALLDECTSAVSI 645 >gnl|CDD|35289 KOG0066, KOG0066, KOG0066, eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis]. Length = 807 Score = 45.1 bits (106), Expect = 3e-05 Identities = 52/194 (26%), Positives = 78/194 (40%), Gaps = 16/194 (8%) Query: 46 IKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVV---------RGEVLVDTDKGFVN 96 + A+L + G L+G +G GK+TLL+ I A + EV+ D+ Sbjct: 281 VNASLTIVYGRRYGLVGPNGMGKTTLLKHIAARALAIPPNIDVLLCEQEVVADSTSAIDT 340 Query: 97 PYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEI 156 AD L L M Q R E+ E I ++R L Sbjct: 341 VLKADKKRLALLEEEAKLM--SQIEEGDTTAAERLKEVADELRAIGADSAEARARRILAG 398 Query: 157 VNLTK-WADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLAL 215 + +K + SGG + RV ARA +L++DEP + LD + L + L Sbjct: 399 LGFSKEMQERPTTKFSGGWRMRVSLARALFLEPTLLMLDEPTNHLDLNAVIWLDNYL--- 455 Query: 216 QRKLKKTIVFVSHD 229 + KKT++ VSHD Sbjct: 456 -QGWKKTLLIVSHD 468 Score = 41.2 bits (96), Expect = 4e-04 Identities = 46/187 (24%), Positives = 77/187 (41%), Gaps = 33/187 (17%) Query: 46 IKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD--TDKGFVNPYAADAN 103 K + + + ++G +G GKSTLL+ + G GE+ + G+ + +A +A Sbjct: 604 KKLDFGIDMDSRIAIVGPNGVGKSTLLKLLIGKLDPNDGELRKNHRLRIGWFDQHANEA- 662 Query: 104 VLRKLRMHTVSMVFQQFAL-LPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKW 162 L + + Q LP++ + +LG +A H + Sbjct: 663 ----LNGEETPVEYLQRKFNLPYQEARK--QLG-----------TFGLASHAHTI----- 700 Query: 163 ADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKT 222 KI LSGG K RV A G +L++DEP ++LD + D L + Sbjct: 701 ---KIKDLSGGQKARVALAELALGGPDVLILDEPTNNLD----IESIDALAEAINEYNGG 753 Query: 223 IVFVSHD 229 ++ VSHD Sbjct: 754 VIMVSHD 760 >gnl|CDD|73047 cd03288, ABCC_SUR2, The SUR domain 2. The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.. Length = 257 Score = 44.6 bits (105), Expect = 4e-05 Identities = 58/251 (23%), Positives = 107/251 (42%), Gaps = 46/251 (18%) Query: 30 IKKHDKVSEY-GMVSAVIK-ANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVL 87 IK HD Y + V+K +K G+ + + G +G+GKS+L + + + G+++ Sbjct: 20 IKIHDLCVRYENNLKPVLKHVKAYIKPGQKVGICGRTGSGKSSLSLAFFRMVDIFDGKIV 79 Query: 88 VDTDKGFVNPYAADANVLRKLRMHTV----SMVFQQFALLPWRTVARNVELGLEFLDIPD 143 +D + KL +HT+ S++ Q L + ++ L D Sbjct: 80 IDGID------------ISKLPLHTLRSRLSIILQDPILF-----SGSIRFNL------D 116 Query: 144 VERK---SRVAEHLEIVNLTKWA-------DCKINM----LSGGMKQRVGFARAFATGAP 189 E K R+ E LEI L D + S G +Q ARAF + Sbjct: 117 PECKCTDDRLWEALEIAQLKNMVKSLPGGLDAVVTEGGENFSVGQRQLFCLARAFVRKSS 176 Query: 190 ILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRII 249 IL+MDE +S+D LQ + + +T+V ++H ++ + + ++ G ++ Sbjct: 177 ILIMDEATASIDMATENILQK--VVMTAFADRTVVTIAHRVSTILD-ADLVLVLSRGILV 233 Query: 250 QCGTPQEIILH 260 +C TP+ ++ Sbjct: 234 ECDTPENLLAQ 244 >gnl|CDD|72997 cd03238, ABC_UvrA, The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.. Length = 176 Score = 43.7 bits (103), Expect = 8e-05 Identities = 36/190 (18%), Positives = 67/190 (35%), Gaps = 51/190 (26%) Query: 42 VSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAAD 101 V + ++ + ++V+ G+SG+GKSTL+ +G A Sbjct: 8 VHNLQNLDVSIPLNVLVVVTGVSGSGKSTLVN------------------EGLYASGKAR 49 Query: 102 ANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTK 161 + Q L +++GL +L + Sbjct: 50 LISFLPKFSRNKLIFIDQLQFL--------IDVGLGYLTL-------------------- 81 Query: 162 WADCKINMLSGGMKQRVGFARAFATGAP--ILLMDEPFSSLDPLIRMRLQDELLALQRKL 219 K++ LSGG QRV A + P + ++DEP + L +L + + L L Sbjct: 82 --GQKLSTLSGGELQRVKLASELFSEPPGTLFILDEPSTGLHQQDINQLLEVIKGL-IDL 138 Query: 220 KKTIVFVSHD 229 T++ + H+ Sbjct: 139 GNTVILIEHN 148 >gnl|CDD|73061 cd03369, ABCC_NFT1, Domain 2 of NFT1 (New full-length MRP-type transporter 1). NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters. Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.. Length = 207 Score = 43.7 bits (103), Expect = 8e-05 Identities = 47/205 (22%), Positives = 91/205 (44%), Gaps = 28/205 (13%) Query: 51 EVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVD-TDKGFVNPYAADANVLRKLR 109 +VK GE + ++G +GAGKSTL+ ++ G++ +D D + L LR Sbjct: 30 KVKAGEKIGIVGRTGAGKSTLILALFRFLEAEEGKIEIDGIDISTIP--------LEDLR 81 Query: 110 MHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKINM 169 +++++ Q L T+ N++ E+ D EI + ++ +N Sbjct: 82 -SSLTIIPQDPTLFS-GTIRSNLDPFDEYSDE-------------EIYGALRVSEGGLN- 125 Query: 170 LSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHD 229 LS G +Q + ARA +L++DE +S+D +Q + TI+ ++H Sbjct: 126 LSQGQRQLLCLARALLKRPRVLVLDEATASIDYATDALIQKTIREEFT--NSTILTIAHR 183 Query: 230 INEAFRLGNRIAIMEGGRIIQCGTP 254 + ++I +M+ G + + P Sbjct: 184 LRTIIDY-DKILVMDAGEVKEYDHP 207 >gnl|CDD|30527 COG0178, UvrA, Excinuclease ATPase subunit [DNA replication, recombination, and repair]. Length = 935 Score = 43.6 bits (103), Expect = 9e-05 Identities = 34/100 (34%), Positives = 48/100 (48%), Gaps = 10/100 (10%) Query: 170 LSGGMKQRVGFARAFATGAPILL--MDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVS 227 LSGG QR+ A +G +L +DEP L RL + L L R L T++ V Sbjct: 482 LSGGEAQRIRLATQIGSGLTGVLYVLDEPSIGLHQRDNERLIETLKRL-RDLGNTVIVVE 540 Query: 228 HDINEAFRLGNRI------AIMEGGRIIQCGTPQEIILHP 261 HD + R + I A GG I+ GTP+E++ +P Sbjct: 541 HD-EDTIRAADHIIDIGPGAGEHGGEIVAEGTPEELLANP 579 Score = 40.5 bits (95), Expect = 7e-04 Identities = 42/154 (27%), Positives = 71/154 (46%), Gaps = 19/154 (12%) Query: 132 VELGLEFL-DIPDVERKSRVAEH--LEIVNLTKWADCKINMLSGGMKQRVGFARAF---A 185 VE LEF IP + RK + L + L + A LSGG QRV A+ + Sbjct: 786 VEEALEFFEAIPKIARKLQTLVDVGLGYIKLGQPA----TTLSGGEAQRVKLAKELSKRS 841 Query: 186 TGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIM-- 243 TG + ++DEP + L +L + L L T++ + H++ + + + I + Sbjct: 842 TGKTLYILDEPTTGLHFDDIKKLLEVLHRL-VDKGNTVIVIEHNL-DVIKTADWIIDLGP 899 Query: 244 ----EGGRIIQCGTPQEIILHPANCYVSEFIQKL 273 GG I+ GTP+E+ A+ Y ++++K Sbjct: 900 EGGDGGGEIVASGTPEEVAKVKAS-YTGKYLKKY 932 Score = 32.5 bits (74), Expect = 0.19 Identities = 11/23 (47%), Positives = 20/23 (86%) Query: 49 NLEVKKGEILVLMGLSGAGKSTL 71 +LE+ + +++V+ GLSG+GKS+L Sbjct: 20 DLEIPRNKLVVITGLSGSGKSSL 42 >gnl|CDD|73048 cd03289, ABCC_CFTR2, The CFTR subfamily domain 2. The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia. Use of the term assembly of a functional ion channel implies the coming together of subunits or at least smaller not-yet functional components of the active whole. In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells. CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.. Length = 275 Score = 43.1 bits (101), Expect = 1e-04 Identities = 53/229 (23%), Positives = 107/229 (46%), Gaps = 47/229 (20%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108 + + G+ + L+G +G+GKSTLL + L G++ +D + ++ L+K Sbjct: 24 SFSISPGQRVGLLGRTGSGKSTLLSAFLRLLNT-EGDIQIDG-------VSWNSVPLQKW 75 Query: 109 RMHTVSMVFQQFALLPWR------TVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKW 162 R + F ++P + T +N++ ++ D E +VAE + + ++ + Sbjct: 76 R--------KAFGVIPQKVFIFSGTFRKNLDPYGKWSD----EEIWKVAEEVGLKSVIEQ 123 Query: 163 ADCKIN--------MLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLA 214 +++ +LS G KQ + AR+ + A ILL+DEP + LDP+ Sbjct: 124 FPGQLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPIT-------YQV 176 Query: 215 LQRKLKK-----TIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEII 258 +++ LK+ T++ H I EA R ++E ++ Q + Q+++ Sbjct: 177 IRKTLKQAFADCTVILSEHRI-EAMLECQRFLVIEENKVRQYDSIQKLL 224 >gnl|CDD|30768 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]. Length = 908 Score = 40.4 bits (94), Expect = 7e-04 Identities = 22/92 (23%), Positives = 36/92 (39%), Gaps = 11/92 (11%) Query: 170 LSGGMKQRVGFARAFA--------TGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKK 221 LSGG + A A +L +DEPF +LD +L + L L + Sbjct: 816 LSGGERFLASLALRLALSDLLQGRARLELLFLDEPFGTLDEERLEKLAEILEELLSDG-R 874 Query: 222 TIVFVSHD--INEAFRLGNRIAIMEGGRIIQC 251 I+ +SH + E + R+ G ++ Sbjct: 875 QIIIISHVEELKERADVRIRVKKDGGRSRVEV 906 >gnl|CDD|57925 cd01854, YjeQ_engC, YjeQ/EngC. YjeQ (YloQ in Bacillus subtilis) represents a protein family whose members are broadly conserved in bacteria and have been shown to be essential to the growth of E. coli and B. subtilis. Proteins of the YjeQ family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. All YjeQ family proteins display a unique domain architecture, which includes an N-terminal OB-fold RNA-binding domain, the central permuted GTPase domain, and a zinc knuckle-like C-terminal cysteine domain. This domain architecture suggests a role for YjeQ as a regulator of translation.. Length = 287 Score = 40.2 bits (94), Expect = 9e-04 Identities = 15/40 (37%), Positives = 23/40 (57%) Query: 54 KGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKG 93 KG+ VL+G SG GKSTL+ ++ + GE+ +G Sbjct: 160 KGKTSVLVGQSGVGKSTLINALLPDLDLATGEISEKLGRG 199 >gnl|CDD|146027 pfam03193, DUF258, Protein of unknown function, DUF258. Length = 161 Score = 39.9 bits (94), Expect = 0.001 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Query: 46 IKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKG 93 +K L KG+ VL G SG GKSTLL ++ + GE+ +G Sbjct: 29 LKPLL---KGKTSVLAGQSGVGKSTLLNALLPELDLRTGEISEKLGRG 73 >gnl|CDD|73038 cd03279, ABC_sbcCD, SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.. Length = 213 Score = 39.5 bits (92), Expect = 0.001 Identities = 43/207 (20%), Positives = 72/207 (34%), Gaps = 32/207 (15%) Query: 51 EVKKGEILVLMGLSGAGKSTLLRSIN-GLAPVVRGEVLVDTDKGFVNPYAADANVLRKLR 109 + + ++ G +GAGKST+L +I L + + P A V Sbjct: 24 GLDNNGLFLICGPTGAGKSTILDAITYALYGKTPRYGRQENLRSVFAPGEDTAEV----- 78 Query: 110 MHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKINM 169 S FQ L + GL++ D + + E ++ Sbjct: 79 ----SFTFQ----LGGKKYRVERSRGLDY----DQFTRIVLLPQGEFDRFLARP---VST 123 Query: 170 LSGGMKQRVGFARAFA--------TGAPI--LLMDEPFSSLDPLIRMRLQDELLALQRKL 219 LSGG + A A GA + L +DE F +LDP + L L R Sbjct: 124 LSGGETFLASLSLALALSEVLQNRGGARLEALFIDEGFGTLDPEALEAVA-TALELIRTE 182 Query: 220 KKTIVFVSHDINEAFRLGNRIAIMEGG 246 + + +SH R+ R+ +++ Sbjct: 183 NRMVGVISHVEELKERIPQRLEVIKTP 209 >gnl|CDD|31356 COG1162, COG1162, Predicted GTPases [General function prediction only]. Length = 301 Score = 38.7 bits (90), Expect = 0.002 Identities = 16/48 (33%), Positives = 26/48 (54%) Query: 46 IKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKG 93 ++ E+ G+I VL+G SG GKSTL+ ++ GE+ +G Sbjct: 155 LEELAELLAGKITVLLGQSGVGKSTLINALLPELNQKTGEISEKLGRG 202 >gnl|CDD|177053 CHL00131, ycf16, sulfate ABC transporter protein; Validated. Length = 252 Score = 38.1 bits (89), Expect = 0.003 Identities = 16/29 (55%), Positives = 21/29 (72%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSING 77 NL + KGEI +MG +G+GKSTL + I G Sbjct: 27 NLSINKGEIHAIMGPNGSGKSTLSKVIAG 55 >gnl|CDD|72986 cd03227, ABC_Class2, ABC-type Class 2 contains systems involved in cellular processes other than transport. These families are characterised by the fact that the ABC subunit is made up of duplicated, fused ABC modules (ABC2). No known transmembrane proteins or domains are associated with these proteins.. Length = 162 Score = 37.2 bits (86), Expect = 0.007 Identities = 15/64 (23%), Positives = 25/64 (39%), Gaps = 5/64 (7%) Query: 170 LSGGMKQRVGFARAFA----TGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVF 225 LSGG K+ A A P+ ++DE LDP L + + ++ Sbjct: 78 LSGGEKELSALALILALASLKPRPLYILDEIDRGLDPRDGQALAE-AILEHLVKGAQVIV 136 Query: 226 VSHD 229 ++H Sbjct: 137 ITHL 140 Score = 29.2 bits (65), Expect = 2.0 Identities = 14/61 (22%), Positives = 24/61 (39%), Gaps = 1/61 (1%) Query: 54 KGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKLRMHTV 113 +G + ++ G +G+GKST+L +I GLA A + + Sbjct: 20 EGSLTIITGPNGSGKSTILDAI-GLALGGAQSATRRRSGVKAGCIVAAVSAELIFTRLQL 78 Query: 114 S 114 S Sbjct: 79 S 79 >gnl|CDD|72999 cd03240, ABC_Rad50, The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains. The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence. This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.. Length = 204 Score = 35.9 bits (83), Expect = 0.016 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 7/67 (10%) Query: 170 LSGGMKQ------RVGFARAFATGAPILLMDEPFSSLDP-LIRMRLQDELLALQRKLKKT 222 SGG K R+ A F + IL +DEP ++LD I L + + + + Sbjct: 116 CSGGEKVLASLIIRLALAETFGSNCGILALDEPTTNLDEENIEESLAEIIEERKSQKNFQ 175 Query: 223 IVFVSHD 229 ++ ++HD Sbjct: 176 LIVITHD 182 >gnl|CDD|73120 cd04621, CBS_pair_8, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).. Length = 135 Score = 35.7 bits (82), Expect = 0.018 Identities = 19/76 (25%), Positives = 33/76 (43%), Gaps = 11/76 (14%) Query: 267 SEFIQKLNPITALVAADVMR--VCSIDDESNIVHKISRQMPLIDIIDMVADNLGKIGVVE 324 + + LVA D+M + ++ ++V M+ N+ + VV+ Sbjct: 69 GQKRYRYVKEVPLVAEDIMTEEIITVSPNDDVVDAAK---------LMLEANISGLPVVD 119 Query: 325 DDRIVGIITAIDIVRG 340 +D IVG+IT DI R Sbjct: 120 NDNIVGVITKTDICRE 135 >gnl|CDD|73095 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.. Length = 110 Score = 35.1 bits (81), Expect = 0.031 Identities = 17/44 (38%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Query: 297 VHKISRQMPLIDIID-MVADNLGKIGVVEDDRIVGIITAIDIVR 339 V + PL ++ + MV ++G++ VVED R+VGI+T D++R Sbjct: 66 VVTVPPDTPLSEVQELMVEHDIGRVPVVEDGRLVGIVTRTDLLR 109 >gnl|CDD|73132 cd04634, CBS_pair_21, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).. Length = 143 Score = 34.4 bits (79), Expect = 0.050 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 11/91 (12%) Query: 253 TPQEIILHPANCYVS--EFIQKLNPITALVAADVMRVCSIDDESNIVHKISRQMPLIDII 310 +P E+I P +++ E + L + D+M + V IS + D Sbjct: 61 SPLELIELPLREFINWEETKRALTDAGKMKVRDIM--------TKKVITISPDASIEDAA 112 Query: 311 D-MVADNLGKIGVVEDDRIVGIITAIDIVRG 340 + MV + ++ VVED R+VGI+T DI+ G Sbjct: 113 ELMVRHKIKRLPVVEDGRLVGIVTRGDIIEG 143 Score = 27.9 bits (62), Expect = 4.6 Identities = 7/27 (25%), Positives = 16/27 (59%) Query: 316 NLGKIGVVEDDRIVGIITAIDIVRGLS 342 + V++ ++VGI++ DI++ L Sbjct: 23 KISGAPVLDGGKLVGIVSESDILKLLV 49 >gnl|CDD|33697 COG3910, COG3910, Predicted ATPase [General function prediction only]. Length = 233 Score = 34.1 bits (78), Expect = 0.058 Identities = 46/181 (25%), Positives = 69/181 (38%), Gaps = 36/181 (19%) Query: 54 KGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKLRMHTV 113 + I + G +G+GKSTLL +I GF N N +L Sbjct: 36 RAPITFITGENGSGKSTLLEAIAAGM-------------GF-NAAGGGKNFKGELDASHS 81 Query: 114 SMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKINML--- 170 ++ +A L R +G FL E VA +L+ A+ L Sbjct: 82 AL--VDYAKLHKRK---KPPIGF-FLR---AESFYNVASYLD--EADGEANYGGRSLHHM 130 Query: 171 SGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKT---IVFVS 227 S G F F G I ++DEP ++L P ++ ELLA+ R L + I+ + Sbjct: 131 SHGESFLAIFHNRF-NGQGIYILDEPEAALSPSRQL----ELLAILRDLADSGAQIIIAT 185 Query: 228 H 228 H Sbjct: 186 H 186 >gnl|CDD|73131 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).. Length = 121 Score = 33.6 bits (77), Expect = 0.086 Identities = 29/104 (27%), Positives = 53/104 (50%), Gaps = 12/104 (11%) Query: 239 RIAIMEGGRIIQCGTPQEII--LHPANCYVSEFIQKLNPITALVAADVMRVCSIDDESNI 296 R+ ++EGG+++ T ++I L V + Q+ I L +D+M + Sbjct: 26 RLPVIEGGKLVGIVTEKDIADALRSFRPLVRDRHQE-RRIRNLPVSDIM--------TRP 76 Query: 297 VHKISRQMPLIDIID-MVADNLGKIGVVEDDRIVGIITAIDIVR 339 V I + D+ M+ +N+G + VV+D ++VGI+T DI+R Sbjct: 77 VITIEPDTSVSDVASLMLENNIGGLPVVDDGKLVGIVTRTDILR 120 Score = 32.1 bits (73), Expect = 0.22 Identities = 10/30 (33%), Positives = 19/30 (63%) Query: 312 MVADNLGKIGVVEDDRIVGIITAIDIVRGL 341 M+ ++ ++ V+E ++VGI+T DI L Sbjct: 19 MLDHDISRLPVIEGGKLVGIVTEKDIADAL 48 >gnl|CDD|73086 cd04586, CBS_pair_BON_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain. BON is a putative phospholipid-binding domain found in a family of osmotic shock protection proteins. It is also found in some secretins and a group of potential haemolysins. Its likely function is attachment to phospholipid membranes. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.. Length = 135 Score = 33.2 bits (76), Expect = 0.10 Identities = 11/41 (26%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Query: 300 ISRQMPLIDIID-MVADNLGKIGVVEDDRIVGIITAIDIVR 339 + PL ++ + M + ++ VV R+VGI++ D++R Sbjct: 94 VGEDTPLAEVAELMEEHRIKRVPVVRGGRLVGIVSRADLLR 134 >gnl|CDD|73030 cd03271, ABC_UvrA_II, The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins and UvrB having one ATP binding site that is structurally related to that of helicases.. Length = 261 Score = 33.2 bits (76), Expect = 0.11 Identities = 36/130 (27%), Positives = 61/130 (46%), Gaps = 21/130 (16%) Query: 138 FLDIPDVERKSRVAEH--LEIVNLTKWADCKINMLSGGMKQRVGFARAF---ATGAPILL 192 F +IP + RK + L + L + A LSGG QR+ A+ +TG + + Sbjct: 140 FENIPKIARKLQTLCDVGLGYIKLGQPA----TTLSGGEAQRIKLAKELSKRSTGKTLYI 195 Query: 193 MDEPFSSLDPLIRMRLQDELLALQRKLKK--TIVFVSHDINEAFRLGNRIAIM------E 244 +DEP + L +L L LQR + K T+V + H++ + + + I + Sbjct: 196 LDEPTTGLHFHDVKKL---LEVLQRLVDKGNTVVVIEHNL-DVIKCADWIIDLGPEGGDG 251 Query: 245 GGRIIQCGTP 254 GG+++ GTP Sbjct: 252 GGQVVASGTP 261 >gnl|CDD|30543 COG0194, Gmk, Guanylate kinase [Nucleotide transport and metabolism]. Length = 191 Score = 32.8 bits (75), Expect = 0.16 Identities = 12/24 (50%), Positives = 19/24 (79%) Query: 52 VKKGEILVLMGLSGAGKSTLLRSI 75 + KG ++VL G SG GKSTL++++ Sbjct: 1 MSKGLLIVLSGPSGVGKSTLVKAL 24 >gnl|CDD|73134 cd04636, CBS_pair_23, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).. Length = 132 Score = 32.6 bits (74), Expect = 0.16 Identities = 21/101 (20%), Positives = 43/101 (42%), Gaps = 7/101 (6%) Query: 240 IAIMEGGRIIQCGTPQEIILHPANCYVSEFIQKLNPITALVAADVMRVCSIDDESNIVHK 299 + I+ G +I+ + + + S + I L+ V + + V Sbjct: 37 VGIVSEGDLIRKIYKGKGLFY-VTLLYSVIFLDESKIKKLLGKKVEEIMTKK-----VIT 90 Query: 300 ISRQMPLIDIID-MVADNLGKIGVVEDDRIVGIITAIDIVR 339 + + D+ M N+ ++ VV+D ++VGII+ DI+R Sbjct: 91 VDEDTTIEDVARIMSKKNIKRLPVVDDGKLVGIISRGDIIR 131 >gnl|CDD|133362 cd04162, Arl9_Arfrp2_like, Arl9/Arfrp2-like subfamily. Arl9 (Arf-like 9) was first identified as part of the Human Cancer Genome Project. It maps to chromosome 4q12 and is sometimes referred to as Arfrp2 (Arf-related protein 2). This is a novel subfamily identified in human cancers that is uncharacterized to date. Length = 164 Score = 32.4 bits (74), Expect = 0.20 Identities = 13/22 (59%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Query: 56 EILVLMGLSGAGKSTLLRSING 77 +ILVL GL GAGK++LL S++ Sbjct: 1 QILVL-GLDGAGKTSLLHSLSS 21 >gnl|CDD|73136 cd04638, CBS_pair_25, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).. Length = 106 Score = 32.1 bits (73), Expect = 0.23 Identities = 14/29 (48%), Positives = 22/29 (75%) Query: 312 MVADNLGKIGVVEDDRIVGIITAIDIVRG 340 MV +N+ ++ VV+D ++VGI+T DIVR Sbjct: 78 MVENNIRRVPVVDDGKLVGIVTVADIVRA 106 >gnl|CDD|73142 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain. Members of CAP_ED, include CAP which binds cAMP, FNR (fumarate and nitrate reductase) which uses an iron-sulfur cluster to sense oxygen, and CooA a heme containing CO sensor. In all cases binding of the effector leads to conformational changes and the ability to activate transcription. DUF294 is a putative nucleotidyltransferase with a conserved DxD motif. The PB1 domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pairs associate. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.. Length = 111 Score = 32.0 bits (73), Expect = 0.27 Identities = 11/28 (39%), Positives = 20/28 (71%) Query: 312 MVADNLGKIGVVEDDRIVGIITAIDIVR 339 M+ + + VV+D R+VG+I+A D++R Sbjct: 83 MLERGIHHLPVVDDGRLVGVISATDLLR 110 >gnl|CDD|73144 cd04802, CBS_pair_3, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).. Length = 112 Score = 31.4 bits (71), Expect = 0.36 Identities = 13/29 (44%), Positives = 19/29 (65%) Query: 312 MVADNLGKIGVVEDDRIVGIITAIDIVRG 340 M + ++ VV+DD +VGI+T DIV G Sbjct: 84 MAKHGIKRLPVVDDDELVGIVTTTDIVMG 112 Score = 30.6 bits (69), Expect = 0.67 Identities = 12/29 (41%), Positives = 22/29 (75%) Query: 312 MVADNLGKIGVVEDDRIVGIITAIDIVRG 340 M +N+G++ VV++++ VGIIT D+V+ Sbjct: 19 MTENNIGRLIVVDNEKPVGIITERDLVKK 47 >gnl|CDD|32729 COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms]. Length = 610 Score = 31.0 bits (70), Expect = 0.54 Identities = 21/85 (24%), Positives = 38/85 (44%), Gaps = 12/85 (14%) Query: 270 IQKLNPITALVAADVMRVCSIDDESNIVHKISRQM--PLIDI----------IDMVADNL 317 + P+ +V +R I D + K+S M P+I + + M+ + + Sbjct: 186 LDDSGPLLGIVTRKDLRSRVIADGRSKTQKVSEVMTSPVISVDRGDFLFEAMLMMLRNRI 245 Query: 318 GKIGVVEDDRIVGIITAIDIVRGLS 342 + V ED + +GI+T DI+R S Sbjct: 246 KHLPVTEDGQPLGILTLTDILRLFS 270 >gnl|CDD|144238 pfam00571, CBS, CBS domain. CBS domains are small intracellular modules that pair together to form a stable globular domain. This family represents a single CBS domain. Pairs of these domains have been termed a Bateman domain. CBS domains have been shown to bind ligands with an adenosyl group such as AMP, ATP and S-AdoMet. CBS domains are found attached to a wide range of other protein domains suggesting that CBS domains may play a regulatory role making proteins sensitive to adenosyl carrying ligands. The region containing the CBS domains in Cystathionine-beta synthase is involved in regulation by S-AdoMet. CBS domain pairs from AMPK bind AMP or ATP. The CBS domains from IMPDH and the chloride channel CLC2 bind ATP. Length = 57 Score = 30.6 bits (70), Expect = 0.59 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Query: 297 VHKISRQMPLIDIID-MVADNLGKIGVV-EDDRIVGIITAIDIVRGLS 342 V + L + ++ M + + ++ VV ED ++VGI+T D++R L Sbjct: 9 VVTVPPDTSLEEALELMRENGISRLPVVDEDGKLVGIVTLRDLLRALL 56 >gnl|CDD|73084 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria. Acetoin is a product of fermentative metabolism in many prokaryotic and eukaryotic microorganisms. They produce acetoin as an external carbon storage compound and then later reuse it as a carbon and energy source during their stationary phase and sporulation. In addition these CBS domains are associated with a downstream ACT domain, which is linked to a wide range of metabolic enzymes that are regulated by amino acid concentration. Pairs of ACT domains bind specifically to a particular amino acid leading to regulation of the linked enzyme. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.. Length = 121 Score = 30.5 bits (69), Expect = 0.60 Identities = 14/28 (50%), Positives = 19/28 (67%) Query: 312 MVADNLGKIGVVEDDRIVGIITAIDIVR 339 M +G + VVED R+VGIIT D++R Sbjct: 93 MREHRIGCLPVVEDGRLVGIITETDLLR 120 >gnl|CDD|73121 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).. Length = 113 Score = 30.5 bits (69), Expect = 0.65 Identities = 13/27 (48%), Positives = 19/27 (70%) Query: 312 MVADNLGKIGVVEDDRIVGIITAIDIV 338 M ++G + V E+DR+VGI+T DIV Sbjct: 19 MREHDVGALPVCENDRLVGIVTDRDIV 45 >gnl|CDD|73111 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction. The GGDEF domain has been suggested to be homologous to the adenylyl cyclase catalytic domain and is thought to be involved in regulating cell surface adhesiveness in bacteria. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.. Length = 111 Score = 30.5 bits (69), Expect = 0.66 Identities = 13/41 (31%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Query: 300 ISRQMPLIDIID-MVADNLGKIGVVEDDRIVGIITAIDIVR 339 L + M + I VV+D R +GI+T DI+R Sbjct: 6 CPPDTSLAEAASRMRERRISSIVVVDDGRPLGIVTERDILR 46 >gnl|CDD|73122 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).. Length = 113 Score = 30.5 bits (69), Expect = 0.73 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Query: 297 VHKISRQMPLIDIIDMVAD-NLGKIGVVED-DRIVGIITAIDIVRGL 341 V + + + ++A+ N+G + VV+D R+VGI + DIVR + Sbjct: 3 VITVRPDATVAEAAKLMAEKNIGAVVVVDDGGRLVGIFSERDIVRKV 49 >gnl|CDD|73112 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC. SpoIVFB is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A ), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus). SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB. It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB. EriC is involved in inorganic ion transport and metabolism. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.. Length = 111 Score = 30.2 bits (68), Expect = 0.78 Identities = 13/37 (35%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Query: 305 PLIDIID-MVADNLGKIGVVEDD-RIVGIITAIDIVR 339 L D + M ++G++ VV+D R+VGI++ D++R Sbjct: 74 TLRDALKRMAERDIGRLPVVDDSGRLVGIVSRSDLLR 110 >gnl|CDD|34310 COG4694, COG4694, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 758 Score = 30.4 bits (68), Expect = 0.83 Identities = 17/70 (24%), Positives = 33/70 (47%), Gaps = 9/70 (12%) Query: 168 NMLSGGMKQRVGF----ARAFATG----APILLMDEPFSSLDPLIRMRLQDELLALQRKL 219 N LS G K + F A+ ++++D+P SS D I R+ L+ ++ Sbjct: 528 NTLSEGEKTFIAFLYFLAKLKENPDISKNKVVVIDDPISSFDSNILFRVS-VLVKEEKTN 586 Query: 220 KKTIVFVSHD 229 K ++ ++H+ Sbjct: 587 IKQVIVLTHN 596 >gnl|CDD|30863 COG0517, COG0517, FOG: CBS domain [General function prediction only]. Length = 117 Score = 30.1 bits (67), Expect = 0.84 Identities = 15/47 (31%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Query: 297 VHKISRQMPLIDIIDMVADN-LGKIGVVEDDRIVGIITAIDIVRGLS 342 V + + D + ++++N + + VV+D ++VGIIT DI+R L+ Sbjct: 9 VITVKPDTSVRDALLLMSENGVSAVPVVDDGKLVGIITERDILRALA 55 >gnl|CDD|73000 cd03241, ABC_RecN, RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 276 Score = 30.2 bits (68), Expect = 0.86 Identities = 15/36 (41%), Positives = 25/36 (69%), Gaps = 2/36 (5%) Query: 44 AVIK-ANLEVKKGEILVLMGLSGAGKSTLLRSINGL 78 A+I+ L+ ++G + VL G +GAGKS LL +++ L Sbjct: 10 ALIEELELDFEEG-LTVLTGETGAGKSILLDALSLL 44 >gnl|CDD|73180 cd00071, GMPK, Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), also known as guanylate kinase (GKase), catalyzes the reversible phosphoryl transfer from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) to yield adenosine diphosphate (ADP) and guanosine diphosphate (GDP). It plays an essential role in the biosynthesis of guanosine triphosphate (GTP). This enzyme is also important for the activation of some antiviral and anticancer agents, such as acyclovir, ganciclovir, carbovir, and thiopurines.. Length = 137 Score = 30.1 bits (68), Expect = 0.87 Identities = 11/19 (57%), Positives = 15/19 (78%) Query: 57 ILVLMGLSGAGKSTLLRSI 75 ++VL G SG GKSTLL+ + Sbjct: 1 LIVLSGPSGVGKSTLLKRL 19 >gnl|CDD|34256 COG4637, COG4637, Predicted ATPase [General function prediction only]. Length = 373 Score = 30.0 bits (67), Expect = 1.0 Identities = 13/39 (33%), Positives = 24/39 (61%) Query: 48 ANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEV 86 +L+++ + V++G +GAGKS ++ LA VRG + Sbjct: 15 RSLDLEIRRVNVIIGANGAGKSNFYDALRLLADAVRGNL 53 >gnl|CDD|73042 cd03283, ABC_MutS-like, MutS-like homolog in eukaryotes. The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, and recognition of specific DNA structures or lesions results in ADP/ATP exchange.. Length = 199 Score = 29.8 bits (67), Expect = 1.0 Identities = 9/27 (33%), Positives = 20/27 (74%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSI 75 +++++K +++ G + +GKST LR+I Sbjct: 19 DIDMEKKNGILITGSNMSGKSTFLRTI 45 >gnl|CDD|32858 COG3044, COG3044, Predicted ATPase of the ABC class [General function prediction only]. Length = 554 Score = 30.0 bits (67), Expect = 1.1 Identities = 18/76 (23%), Positives = 32/76 (42%), Gaps = 5/76 (6%) Query: 171 SGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHDI 230 SG A GA LL+DE S+ + L+R ++LA + + ++T+ + +I Sbjct: 322 SGSTSMAAWIQEAIEAGAKTLLIDEDTSATNLLVR-----DVLAKESEGERTLTPLVDEI 376 Query: 231 NEAFRLGNRIAIMEGG 246 + GG Sbjct: 377 GSLRGDLISTIAVTGG 392 >gnl|CDD|30108 cd01386, MYSc_type_XVIII, Myosin motor domain, type XVIII myosins. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle.. Length = 767 Score = 29.6 bits (66), Expect = 1.2 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 4/55 (7%) Query: 39 YGMVSAVIKANLEVKKGEILVLMGLSGAGKST----LLRSINGLAPVVRGEVLVD 89 Y + +A LE ++ + ++ +G SGAGK+T L + A V G V V+ Sbjct: 70 YSLAQTAYRALLETRRDQSIIFLGRSGAGKTTSCKHALEYLALAAGSVDGRVSVE 124 >gnl|CDD|29833 cd01918, HprK_C, HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of Ser-46 of HPr and its dephosphorylation by phosphorolysis. The latter reaction uses inorganic phosphate as substrate and produces pyrophosphate. Phosphoenolpyruvate carboxykinase (PEPCK) and the C-terminal catalytic domain of HprK/P are structurally similar with conserved active site residues suggesting these two phosphotransferases have related functions. The HprK/P N-terminal domain is structurally similar to the N-terminal domains of the MurE and MurF amino acid ligases.. Length = 149 Score = 29.8 bits (67), Expect = 1.3 Identities = 22/113 (19%), Positives = 42/113 (37%), Gaps = 17/113 (15%) Query: 58 LVLMGLSGAGKSTLLRSINGLAPVVRGEVLV-----DTDKGFVNPYAADANVLRKLR--- 109 +++ G SG GKS L L + RG LV + L+ L Sbjct: 17 VLITGPSGIGKSEL-----ALELIKRGHRLVADDRVVVKREGGRLVGRAPEALKGLIEIR 71 Query: 110 ---MHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNL 159 + V ++ A+ + + +EL E+ + + +R E+ I+ + Sbjct: 72 GLGIIDVPRLYGIEAVRDRKVIDLVIEL-EEWEEEKNFDRLGLEEEYKRILGV 123 >gnl|CDD|73104 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein. These APIs catalyze the conversion of the pentose pathway intermediate D-ribulose 5-phosphate into A5P, a precursor of 3-deoxy-D-manno-octulosonate, which is an integral carbohydrate component of various glycolipids coating the surface of the outer membrane of Gram-negative bacteria, including lipopolysaccharide and many group 2 K-antigen capsules. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.. Length = 114 Score = 29.3 bits (66), Expect = 1.4 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Query: 297 VHKISRQMPLID-IIDMVADNLGKIGVV-EDDRIVGIITAIDIVRGLS 342 + +S L D +++M LG VV ED R+VGI T D+ R L Sbjct: 4 LPLVSPDTSLKDALLEMSRKGLGMTAVVDEDGRLVGIFTDGDLRRALE 51 >gnl|CDD|39857 KOG4658, KOG4658, KOG4658, Apoptotic ATPase [Signal transduction mechanisms]. Length = 889 Score = 29.5 bits (66), Expect = 1.5 Identities = 16/61 (26%), Positives = 25/61 (40%), Gaps = 1/61 (1%) Query: 16 GETSNKIRKRSRYSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSI 75 GE+ + K I+ V M+ + L I+ + G+ G GK+TL R I Sbjct: 141 GESLDPREKVETRPIQSESDVGLETMLEKLWN-RLMEDDVGIVGIYGMGGVGKTTLARQI 199 Query: 76 N 76 Sbjct: 200 F 200 >gnl|CDD|30814 COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]. Length = 782 Score = 29.4 bits (66), Expect = 1.7 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 5/56 (8%) Query: 21 KIRKRSRYSIKK-HDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSI 75 KI + Y ++K +++ EY V + K KG IL L+G G GK++L +SI Sbjct: 319 KILDKDHYGLEKVKERILEYLAVQKLTKK----LKGPILCLVGPPGVGKTSLGKSI 370 >gnl|CDD|30843 COG0497, RecN, ATPase involved in DNA repair [DNA replication, recombination, and repair]. Length = 557 Score = 29.4 bits (66), Expect = 1.7 Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 2/36 (5%) Query: 44 AVI-KANLEVKKGEILVLMGLSGAGKSTLLRSINGL 78 A+I + LE +KG + VL G +GAGKS ++ ++ L Sbjct: 11 AIIEELELEFEKG-LTVLTGETGAGKSIIIDALGLL 45 >gnl|CDD|31145 COG0802, COG0802, Predicted ATPase or kinase [General function prediction only]. Length = 149 Score = 29.1 bits (65), Expect = 1.8 Identities = 12/24 (50%), Positives = 19/24 (79%) Query: 52 VKKGEILVLMGLSGAGKSTLLRSI 75 +K G++++L G GAGK+TL+R I Sbjct: 22 LKAGDVVLLSGDLGAGKTTLVRGI 45 >gnl|CDD|29834 cd01919, PEPCK, Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity. PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).. Length = 515 Score = 29.2 bits (65), Expect = 1.9 Identities = 37/147 (25%), Positives = 58/147 (39%), Gaps = 23/147 (15%) Query: 53 KKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKLRMHT 112 G++LV GLSG GK+TL S++ ++ + D G NP L + T Sbjct: 215 TNGDVLVFFGLSGTGKTTL--SMDPKRELIGDDEHWWKDDGVFNPEGGCYAKAIGLSVKT 272 Query: 113 VSMVFQQFALLPWRTVARNVEL----GLEFLDIPDVERKSRV---AEHLEIVNLTKWADC 165 +++ + + NV G++F DI +RV A H+ I+ W Sbjct: 273 EPNIYKA---IRKNAIFENVAETSDGGIDFEDI-SAHPNTRVCYPASHIPII-DAAWE-- 325 Query: 166 KINMLSGGMKQRVGF--ARAFATGAPI 190 S G + V F AF P+ Sbjct: 326 -----SAGHIEGVIFLTRDAFGVVPPV 347 >gnl|CDD|73100 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain. These proteins are integral membrane proteins with four transmembrane spanning helices. The function of these proteins is uncertain, but they are thought to be transporters. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.. Length = 124 Score = 29.0 bits (65), Expect = 2.0 Identities = 16/66 (24%), Positives = 31/66 (46%), Gaps = 10/66 (15%) Query: 277 TALVAADVMRVCSIDDESNIVHKISRQMPLIDIIDMVADN-LGKIGVVEDD-RIVGIITA 334 D+M S V + P+ +++ ++AD + VV++D R+VGI+T Sbjct: 67 KPETVGDIM--------SPPVVTVRPDTPIAELVPLLADGGHHHVPVVDEDRRLVGIVTQ 118 Query: 335 IDIVRG 340 D++ Sbjct: 119 TDLIAA 124 >gnl|CDD|133255 cd00879, Sar1, Sar1 subfamily. Sar1 is an essential component of COPII vesicle coats involved in export of cargo from the ER. The GTPase activity of Sar1 functions as a molecular switch to control protein-protein and protein-lipid interactions that direct vesicle budding from the ER. Activation of the GDP to the GTP-bound form of Sar1 involves the membrane-associated guanine nucleotide exchange factor (GEF) Sec12. Sar1 is unlike all Ras superfamily GTPases that use either myristoyl or prenyl groups to direct membrane association and function, in that Sar1 lacks such modification. Instead, Sar1 contains a unique nine-amino-acid N-terminal extension. This extension contains an evolutionarily conserved cluster of bulky hydrophobic amino acids, referred to as the Sar1-N-terminal activation recruitment (STAR) motif. The STAR motif mediates the recruitment of Sar1 to ER membranes and facilitates its interaction with mammalian Sec12 GEF leading to activation. Length = 190 Score = 29.1 bits (66), Expect = 2.0 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Query: 53 KKGEILVLMGLSGAGKSTLLR 73 K+ +IL L GL AGK+TLL Sbjct: 18 KEAKILFL-GLDNAGKTTLLH 37 >gnl|CDD|133354 cd04154, Arl2, Arl2 subfamily. Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity. Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix. The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI. Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different. In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport. In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis. Length = 173 Score = 29.1 bits (66), Expect = 2.0 Identities = 11/26 (42%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Query: 53 KKGEILVLM-GLSGAGKSTLLRSING 77 K+ E+ +L+ GL AGK+T+L+ + G Sbjct: 11 KEREMRILILGLDNAGKTTILKKLLG 36 >gnl|CDD|34258 COG4639, COG4639, Predicted kinase [General function prediction only]. Length = 168 Score = 29.2 bits (65), Expect = 2.0 Identities = 10/27 (37%), Positives = 15/27 (55%) Query: 57 ILVLMGLSGAGKSTLLRSINGLAPVVR 83 ++VL G SG+GKST + V+ Sbjct: 4 LVVLRGASGSGKSTFAKENFLQNYVLS 30 >gnl|CDD|36702 KOG1489, KOG1489, KOG1489, Predicted GTP-binding protein (ODN superfamily) [General function prediction only]. Length = 366 Score = 28.8 bits (64), Expect = 2.1 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 9/65 (13%) Query: 18 TSNKIRKRSRYSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSING 77 SN+ R K S+ G+ LE+K + L+G AGKSTLL +++ Sbjct: 168 LSNENRSP---------KFSKPGLNGEERVIELELKSIADVGLVGFPNAGKSTLLNALSR 218 Query: 78 LAPVV 82 P V Sbjct: 219 AKPKV 223 >gnl|CDD|73081 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).. Length = 113 Score = 29.0 bits (64), Expect = 2.1 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Query: 297 VHKISRQMPLIDIID-MVADNLGKIGVVEDD-RIVGIITAIDIVR 339 V +S L + + M+ + ++ VV+D+ R+VGI+T DI+R Sbjct: 68 VVTVSPDTSLEEAAELMLEHGIRRLPVVDDEGRLVGIVTRSDILR 112 Score = 26.6 bits (58), Expect = 9.3 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Query: 297 VHKISRQMPLIDIID-MVADNLGKIGVVEDD-RIVGIITAIDIVRGLS 342 V +S + + + M+ + + VV+DD R+VGI+T D++R L+ Sbjct: 3 VVTVSPDDTVAEALRLMLEHGISGLPVVDDDGRLVGIVTERDLLRALA 50 >gnl|CDD|133298 cd01898, Obg, Obg subfamily. The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation. Obg proteins are among a large group of GTP binding proteins conserved from bacteria to humans. The E. coli homolog, ObgE is believed to function in ribosomal biogenesis. Members of the subfamily contain two equally and highly conserved domains, a C-terminal GTP binding domain and an N-terminal glycine-rich domain. Length = 170 Score = 28.9 bits (66), Expect = 2.3 Identities = 11/16 (68%), Positives = 13/16 (81%) Query: 60 LMGLSGAGKSTLLRSI 75 L+GL AGKSTLL +I Sbjct: 5 LVGLPNAGKSTLLSAI 20 >gnl|CDD|73031 cd03272, ABC_SMC3_euk, Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18).. Length = 243 Score = 28.6 bits (64), Expect = 2.3 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Query: 166 KINMLSGGMKQRVGFARAFATG----APILLMDEPFSSLDPLIR 205 ++ LSGG K V A FA AP L DE ++LD R Sbjct: 155 EMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDAALDAQYR 198 >gnl|CDD|29830 cd00484, PEPCK_ATP, Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity. PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity, this model describes the ATP-dependent groups.. Length = 508 Score = 28.6 bits (64), Expect = 2.4 Identities = 11/19 (57%), Positives = 15/19 (78%) Query: 53 KKGEILVLMGLSGAGKSTL 71 KKG++ + GLSG GK+TL Sbjct: 207 KKGDVALFFGLSGTGKTTL 225 >gnl|CDD|147030 pfam04670, Gtr1_RagA, Gtr1/RagA G protein conserved region. GTR1 was first identified in S. cerevisiae as a suppressor of a mutation in RCC1. Biochemical analysis revealed that Gtr1 is in fact a G protein of the Ras family. The RagA/B proteins are the human homologues of Gtr1. Included in this family is the human Rag C, a novel protein that has been shown to interact with RagA/B. Length = 230 Score = 28.7 bits (65), Expect = 2.5 Identities = 11/18 (61%), Positives = 16/18 (88%), Gaps = 1/18 (5%) Query: 58 LVLMGLSGAGKSTLLRSI 75 ++LMGL G+GKS+ +RSI Sbjct: 2 VLLMGLRGSGKSS-MRSI 18 >gnl|CDD|31846 COG1660, COG1660, Predicted P-loop-containing kinase [General function prediction only]. Length = 286 Score = 28.6 bits (64), Expect = 2.5 Identities = 10/20 (50%), Positives = 15/20 (75%) Query: 56 EILVLMGLSGAGKSTLLRSI 75 ++++ GLSGAGKS LR + Sbjct: 2 RLVIVTGLSGAGKSVALRVL 21 >gnl|CDD|30875 COG0529, CysC, Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]. Length = 197 Score = 28.7 bits (64), Expect = 2.5 Identities = 12/30 (40%), Positives = 20/30 (66%) Query: 42 VSAVIKANLEVKKGEILVLMGLSGAGKSTL 71 V+ + L+ +KG ++ GLSG+GKST+ Sbjct: 10 VTKQEREALKGQKGAVIWFTGLSGSGKSTI 39 >gnl|CDD|73105 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain. Met2 is a key enzyme in the biosynthesis of methionine. It encodes a homoserine transacetylase involved in converting homoserine to O-acetyl homoserine. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.. Length = 110 Score = 28.6 bits (64), Expect = 2.6 Identities = 12/36 (33%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Query: 312 MVADNLGKIGVVEDD-RIVGIITAIDIVRGLSCCRR 346 M+ +N+ + VV++D R+VGI+T+ DI + ++ ++ Sbjct: 20 MIEENINHLPVVDEDGRLVGIVTSWDISKAVARDKK 55 >gnl|CDD|30084 cd00124, MYSc, Myosin motor domain. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle.. Length = 679 Score = 28.7 bits (64), Expect = 2.6 Identities = 15/63 (23%), Positives = 30/63 (47%), Gaps = 4/63 (6%) Query: 8 FRDVDIVFGETSNKIRKRSRYSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAG 67 ++D+ ET K R +SR + H + + + L ++ + +++ G SGAG Sbjct: 43 YKDLPNYGPETIRKYRGKSRSELPPHV----FAIADRAYRNMLRDRRNQSIIISGESGAG 98 Query: 68 KST 70 K+ Sbjct: 99 KTE 101 >gnl|CDD|111276 pfam02367, UPF0079, Uncharacterized P-loop hydrolase UPF0079. This uncharacterized family contains a P-loop. Length = 123 Score = 28.4 bits (64), Expect = 2.8 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 53 KKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEV 86 K G++++L G GAGK+T +R + + G V Sbjct: 13 KAGDVVLLSGDLGAGKTTFVRGL-AKGLGITGNV 45 >gnl|CDD|30194 cd02021, GntK, Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.. Length = 150 Score = 28.7 bits (64), Expect = 2.8 Identities = 10/15 (66%), Positives = 15/15 (100%) Query: 57 ILVLMGLSGAGKSTL 71 I+V+MG+SG+GKST+ Sbjct: 1 IIVVMGVSGSGKSTV 15 >gnl|CDD|39108 KOG3905, KOG3905, KOG3905, Dynein light intermediate chain [Cell motility]. Length = 473 Score = 28.5 bits (63), Expect = 2.8 Identities = 10/41 (24%), Positives = 25/41 (60%) Query: 47 KANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVL 87 + ++ G+ ++++G +G+GK++L+ + G V +G L Sbjct: 44 RTRSKLPSGKNVLVLGDNGSGKTSLISKLQGSETVKKGSGL 84 >gnl|CDD|73129 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).. Length = 125 Score = 28.6 bits (64), Expect = 2.8 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 3/55 (5%) Query: 297 VHKISRQMPLIDIID-MVADNLGKIGVVEDD--RIVGIITAIDIVRGLSCCRRFS 348 V + P+++ MV + ++ VV++ ++VGIITA DI++ L +F+ Sbjct: 3 VVTVPPTTPIMEAAKIMVRNGFRRLPVVDEGTGKLVGIITATDILKYLGGGEKFN 57 Score = 28.2 bits (63), Expect = 3.0 Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Query: 297 VHKISRQMPLIDIID-MVADNLGKIGVVEDD-RIVGIITAIDIVR 339 V I+ + D + M+ +G + VV+DD ++VGI+T D+++ Sbjct: 80 VITITPDDSIKDAAELMLEKRVGGLPVVDDDGKLVGIVTERDLLK 124 >gnl|CDD|33504 COG3709, COG3709, Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism]. Length = 192 Score = 28.4 bits (63), Expect = 3.0 Identities = 10/22 (45%), Positives = 14/22 (63%) Query: 51 EVKKGEILVLMGLSGAGKSTLL 72 G ++ ++G SGAGK TLL Sbjct: 1 RTFMGRLIAVVGPSGAGKDTLL 22 >gnl|CDD|32629 COG2766, PrkA, Putative Ser protein kinase [Signal transduction mechanisms]. Length = 649 Score = 28.3 bits (63), Expect = 3.1 Identities = 20/81 (24%), Positives = 34/81 (41%), Gaps = 14/81 (17%) Query: 12 DIVFGETSNKIRKRSRYSIKKHDKVSE----YGMVSAVIK---------ANLEVKKGEIL 58 D +T + R +S + D+ +GM ++ + LE +K +IL Sbjct: 48 DPEMVDTEHDGRLSRIFSNRVIDRYPAFNDFFGMEESIEQIVGYFKHAAQGLEERK-QIL 106 Query: 59 VLMGLSGAGKSTLLRSINGLA 79 L+G G GKS+L + L Sbjct: 107 YLLGPVGGGKSSLAERLKRLM 127 >gnl|CDD|31297 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only]. Length = 219 Score = 28.4 bits (62), Expect = 3.1 Identities = 12/55 (21%), Positives = 19/55 (34%), Gaps = 6/55 (10%) Query: 58 LVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKLRMHT 112 +V++G G GK+TLL + V E N A + + Sbjct: 8 IVVLGDGGVGKTTLLNRL------VGDEFPEGYPPTIGNLDPAKTIEPYRRNIKL 56 >gnl|CDD|31388 COG1195, RecF, Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair]. Length = 363 Score = 28.3 bits (63), Expect = 3.3 Identities = 11/23 (47%), Positives = 13/23 (56%) Query: 188 APILLMDEPFSSLDPLIRMRLQD 210 PILL+D+ S LD R L D Sbjct: 303 YPILLLDDVASELDDGRRAALLD 325 >gnl|CDD|133356 cd04156, ARLTS1, ARLTS1 subfamily. ARLTS1 (Arf-like tumor suppressor gene 1), also known as Arl11, is a member of the Arf family of small GTPases that is believed to play a major role in apoptotic signaling. ARLTS1 is widely expressed and functions as a tumor suppressor gene in several human cancers. ARLTS1 is a low-penetrance suppressor that accounts for a small percentage of familial melanoma or familial chronic lymphocytic leukemia (CLL). ARLTS1 inactivation seems to occur most frequently through biallelic down-regulation by hypermethylation of the promoter. In breast cancer, ARLTS1 alterations were typically a combination of a hypomorphic polymorphism plus loss of heterozygosity. In a case of thyroid adenoma, ARLTS1 alterations were polymorphism plus promoter hypermethylation. The nonsense polymorphism Trp149Stop occurs with significantly greater frequency in familial cancer cases than in sporadic cancer cases, and the Cys148Arg polymorphism is associated with an increase in high-risk familial breast cancer. Length = 160 Score = 28.2 bits (63), Expect = 3.5 Identities = 11/24 (45%), Positives = 15/24 (62%) Query: 58 LVLMGLSGAGKSTLLRSINGLAPV 81 ++L+GL AGKSTLL + V Sbjct: 2 VLLLGLDSAGKSTLLYKLKHAELV 25 >gnl|CDD|143815 pfam00025, Arf, ADP-ribosylation factor family. Pfam combines a number of different Prosite families together. Length = 174 Score = 28.4 bits (64), Expect = 3.5 Identities = 11/20 (55%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Query: 53 KKGEILVLMGLSGAGKSTLL 72 K+ IL+L GL AGK+T+L Sbjct: 13 KEMRILIL-GLDNAGKTTIL 31 >gnl|CDD|73099 cd04599, CBS_pair_GGDEF_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain. The GGDEF domain has been suggested to be homologous to the adenylyl cyclase catalytic domain and is thought to be involved in regulating cell surface adhesiveness in bacteria. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.. Length = 105 Score = 28.3 bits (63), Expect = 3.5 Identities = 13/28 (46%), Positives = 19/28 (67%) Query: 312 MVADNLGKIGVVEDDRIVGIITAIDIVR 339 M +G + VVED ++VGIIT+ D+ R Sbjct: 19 MEKHRIGGLPVVEDGKLVGIITSRDVRR 46 Score = 26.8 bits (59), Expect = 9.1 Identities = 8/28 (28%), Positives = 15/28 (53%) Query: 312 MVADNLGKIGVVEDDRIVGIITAIDIVR 339 M + ++ V+ + ++VGIIT I Sbjct: 77 MEEKKIERLPVLRERKLVGIITKGTIAL 104 >gnl|CDD|73128 cd04630, CBS_pair_17, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).. Length = 114 Score = 28.2 bits (63), Expect = 3.7 Identities = 10/28 (35%), Positives = 17/28 (60%) Query: 312 MVADNLGKIGVVEDDRIVGIITAIDIVR 339 M N+ + VVE++ ++GII+ DI Sbjct: 86 MERTNIRRAPVVENNELIGIISLTDIFL 113 >gnl|CDD|36182 KOG0964, KOG0964, KOG0964, Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]. Length = 1200 Score = 28.0 bits (62), Expect = 3.7 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 8/64 (12%) Query: 167 INMLSGGMKQRVGFARAFA----TGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKT 222 + LSGG K V A FA AP L DE ++LD R + D L ++L + Sbjct: 1095 MEQLSGGQKSVVALALIFAIQRCDPAPFYLFDEIDAALDAQYRTAVAD----LIKELSDS 1150 Query: 223 IVFV 226 F+ Sbjct: 1151 AQFI 1154 >gnl|CDD|73045 cd03286, ABC_MSH6_euk, MutS6 homolog in eukaryotes. The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, and recognition of specific DNA structures or lesions results in ADP/ATP exchange.. Length = 218 Score = 28.0 bits (62), Expect = 4.2 Identities = 13/27 (48%), Positives = 17/27 (62%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLLRSI 75 +L ILVL G + GKSTLLR++ Sbjct: 24 DLGATSPRILVLTGPNMGGKSTLLRTV 50 >gnl|CDD|33731 COG3950, COG3950, Predicted ATP-binding protein involved in virulence [General function prediction only]. Length = 440 Score = 27.7 bits (61), Expect = 4.7 Identities = 10/31 (32%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 55 GEILVLMGLSGAGKSTLLRSI-NGLAPVVRG 84 E +++G +G+GK+T+L +I N L + Sbjct: 24 SETTIIVGPNGSGKTTVLDAIRNALNKFIDF 54 >gnl|CDD|110578 pfam01583, APS_kinase, Adenylylsulphate kinase. Enzyme that catalyses the phosphorylation of adenylylsulphate to 3'-phosphoadenylylsulfate. This domain contains an ATP binding P-loop motif. Length = 157 Score = 27.6 bits (62), Expect = 5.1 Identities = 9/18 (50%), Positives = 13/18 (72%) Query: 54 KGEILVLMGLSGAGKSTL 71 +G + GLSG+GKST+ Sbjct: 1 RGCTVWFTGLSGSGKSTI 18 >gnl|CDD|35296 KOG0073, KOG0073, KOG0073, GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport, Cytoskeleton]. Length = 185 Score = 27.5 bits (61), Expect = 5.4 Identities = 13/41 (31%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Query: 40 GMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAP 80 G++S + K L+ ++ IL+L GL +GK+T+++ + G Sbjct: 2 GLLSILRKQKLKEREVRILIL-GLDNSGKTTIVKKLLGEDT 41 >gnl|CDD|32051 COG1866, PckA, Phosphoenolpyruvate carboxykinase (ATP) [Energy production and conversion]. Length = 529 Score = 27.6 bits (61), Expect = 5.4 Identities = 10/19 (52%), Positives = 15/19 (78%) Query: 53 KKGEILVLMGLSGAGKSTL 71 +KG++ + GLSG GK+TL Sbjct: 225 EKGDVALFFGLSGTGKTTL 243 >gnl|CDD|73109 cd04609, CBS_pair_PALP_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream. The vitamin B6 complex comprises pyridoxine, pyridoxal, and pyridoxamine, as well as the 5'-phosphate esters of pyridoxal (PALP) and pyridoxamine, the last two being the biologically active coenzyme derivatives. The members of the PALP family are principally involved in the biosynthesis of amino acids and amino acid-derived metabolites, but they are also found in the biosynthetic pathways of amino sugars and other amine-containing compounds. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.. Length = 110 Score = 27.4 bits (61), Expect = 5.6 Identities = 9/40 (22%), Positives = 21/40 (52%) Query: 300 ISRQMPLIDIIDMVADNLGKIGVVEDDRIVGIITAIDIVR 339 + P+ ++ +++ + V E + VGIIT D+++ Sbjct: 70 VDPDAPIEELSELLDRGNVAVVVDEGGKFVGIITRADLLK 109 >gnl|CDD|34627 COG5022, COG5022, Myosin heavy chain [Cytoskeleton]. Length = 1463 Score = 27.3 bits (60), Expect = 5.9 Identities = 13/62 (20%), Positives = 29/62 (46%), Gaps = 4/62 (6%) Query: 8 FRDVDIVFGETSNKIRKRSRYSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAG 67 +RD+ I + ++R ++ H + + + L K+ + +++ G SGAG Sbjct: 109 YRDLGIYTDDIIQSYSGKNRLELEPH----VFAIAEEAYRNLLSEKENQTIIISGESGAG 164 Query: 68 KS 69 K+ Sbjct: 165 KT 166 >gnl|CDD|29988 cd01122, GP4d_helicase, GP4d_helicase is a homohexameric 5'-3' helicases. Helicases couple NTP hydrolysis to the unwinding of nucleic acid duplexes into their component strands.. Length = 271 Score = 27.6 bits (61), Expect = 6.0 Identities = 10/23 (43%), Positives = 16/23 (69%) Query: 53 KKGEILVLMGLSGAGKSTLLRSI 75 +KGE+++L +G GK+T LR Sbjct: 28 RKGELIILTAGTGVGKTTFLREY 50 >gnl|CDD|33698 COG3911, COG3911, Predicted ATPase [General function prediction only]. Length = 183 Score = 27.3 bits (60), Expect = 6.0 Identities = 9/25 (36%), Positives = 15/25 (60%) Query: 51 EVKKGEILVLMGLSGAGKSTLLRSI 75 + + +L G GAGK+TLL ++ Sbjct: 5 PFNRHKRFILTGGPGAGKTTLLAAL 29 >gnl|CDD|133278 cd01876, YihA_EngB, The YihA (EngB) subfamily. This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control. YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting). Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis. The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target. Length = 170 Score = 27.5 bits (62), Expect = 6.0 Identities = 10/29 (34%), Positives = 14/29 (48%), Gaps = 4/29 (13%) Query: 56 EILVLMGLSGAGKSTLLRSI---NGLAPV 81 EI G S GKS+L+ ++ LA Sbjct: 1 EI-AFAGRSNVGKSSLINALTNRKKLART 28 >gnl|CDD|32881 COG3067, NhaB, Na+/H+ antiporter [Inorganic ion transport and metabolism]. Length = 516 Score = 27.2 bits (60), Expect = 6.1 Identities = 19/70 (27%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Query: 227 SHDINEAFRLGNRIAIME-------GGRIIQCGTPQE-IILHPANCYVSEFIQKLNPITA 278 + E FR R +M GG + G PQ II A + EF ++ P+T Sbjct: 191 YKVVLEQFRAFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKQAGWHFGEFFLRMAPVTV 250 Query: 279 LVAADVMRVC 288 V + C Sbjct: 251 PVLICGLLTC 260 >gnl|CDD|31609 COG1419, FlhF, Flagellar GTP-binding protein [Cell motility and secretion]. Length = 407 Score = 27.2 bits (60), Expect = 6.1 Identities = 10/24 (41%), Positives = 17/24 (70%) Query: 49 NLEVKKGEILVLMGLSGAGKSTLL 72 NL V++ ++ L+G +G GK+T L Sbjct: 197 NLIVEQKRVIALVGPTGVGKTTTL 220 >gnl|CDD|111395 pfam02492, cobW, CobW/HypB/UreG, nucleotide-binding domain. This domain is found in HypB, a hydrogenase expression / formation protein, and UreG a urease accessory protein. Both these proteins contain a P-loop nucleotide binding motif. HypB has GTPase activity and is a guanine nucleotide binding protein. It is not known whether UreG binds GTP or some other nucleotide. Both enzymes are involved in nickel binding. HypB can store nickel and is required for nickel dependent hydrogenase expression. UreG is required for functional incorporation of the urease nickel metallocenter. GTP hydrolysis may required by these proteins for nickel incorporation into other nickel proteins. This family of domains also contains P47K, a Pseudomonas chlororaphis protein needed for nitrile hydratase expression, and the cobW gene product, which may be involved in cobalamin biosynthesis in Pseudomonas denitrificans. Length = 174 Score = 27.2 bits (61), Expect = 6.2 Identities = 9/19 (47%), Positives = 13/19 (68%) Query: 57 ILVLMGLSGAGKSTLLRSI 75 + VL G G+GK+TLL + Sbjct: 2 VTVLTGFLGSGKTTLLEHL 20 >gnl|CDD|34791 COG5192, BMS1, GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis]. Length = 1077 Score = 27.4 bits (60), Expect = 6.3 Identities = 10/19 (52%), Positives = 15/19 (78%) Query: 57 ILVLMGLSGAGKSTLLRSI 75 I+ ++G G GKSTL+RS+ Sbjct: 71 IVAVVGPPGTGKSTLIRSL 89 >gnl|CDD|112483 pfam03668, ATP_bind_2, P-loop ATPase protein family. This family contains an ATP-binding site and could be an ATPase (personal obs:C Yeats). Length = 284 Score = 27.5 bits (61), Expect = 6.6 Identities = 10/23 (43%), Positives = 17/23 (73%) Query: 56 EILVLMGLSGAGKSTLLRSINGL 78 +++++ G SGAGKS LR++ L Sbjct: 2 DLVIITGRSGAGKSVALRALEDL 24 >gnl|CDD|73002 cd03243, ABC_MutS_homologs, The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, and recognition of specific DNA structures or lesions results in ADP/ATP exchange.. Length = 202 Score = 27.1 bits (60), Expect = 6.7 Identities = 11/32 (34%), Positives = 19/32 (59%) Query: 44 AVIKANLEVKKGEILVLMGLSGAGKSTLLRSI 75 + ++ + G +L++ G + GKST LRSI Sbjct: 18 TFVPNDINLGSGRLLLITGPNMGGKSTYLRSI 49 >gnl|CDD|30882 COG0536, Obg, Predicted GTPase [General function prediction only]. Length = 369 Score = 27.1 bits (60), Expect = 6.9 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 11/47 (23%) Query: 60 LMGLSGAGKSTLLRSINGLAPVVR-----------GEVLVDTDKGFV 95 L+GL AGKSTLL +++ P + G V VD + FV Sbjct: 164 LVGLPNAGKSTLLSAVSAAKPKIADYPFTTLVPNLGVVRVDGGESFV 210 >gnl|CDD|73001 cd03242, ABC_RecF, RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage. When replication is prematurely disrupted by DNA damage, several recF pathway gene products play critical roles processing the arrested replication fork, allowing it to resume and complete its task. This CD represents the nucleotide binding domain of RecF. RecF belongs to a large superfamily of ABC transporters involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases with a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 270 Score = 27.1 bits (60), Expect = 7.0 Identities = 8/33 (24%), Positives = 15/33 (45%) Query: 187 GAPILLMDEPFSSLDPLIRMRLQDELLALQRKL 219 P+LL+D+ + LD + L D + + Sbjct: 210 EYPVLLLDDVLAELDLGRQAALLDAIEGRVQTF 242 >gnl|CDD|30199 cd02026, PRK, Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes. This enzyme catalyzes the phosphorylation of D-ribulose 5-phosphate to form D-ribulose 1, 5-biphosphate, using ATP and NADPH produced by the primary reactions of photosynthesis.. Length = 273 Score = 27.1 bits (60), Expect = 7.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Query: 57 ILVLMGLSGAGKSTLLRSINGL 78 I+ + G SG GKST LR + L Sbjct: 1 IIGVAGDSGCGKSTFLRRLTSL 22 >gnl|CDD|73145 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).. Length = 122 Score = 27.1 bits (60), Expect = 7.4 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Query: 312 MVADNLGKIGVVEDD-RIVGIITAIDIVR 339 MV + +G + VV+D +VGIIT D +R Sbjct: 93 MVENKIGCLPVVDDKGTLVGIITRSDFLR 121 >gnl|CDD|30975 COG0630, VirB11, Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 312 Score = 26.9 bits (59), Expect = 8.3 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 9/73 (12%) Query: 11 VDIVFGETSNK------IRKRSRYSIKKHDKVSEYGMVSAVIKANLE--VKKGEILVLMG 62 + IV G + IRK S + + EYG +S A L ++ + +++ G Sbjct: 92 IQIVLGPEVSPNGSSFTIRKFSDE-PITPEDLIEYGTISPEQAAYLWLAIEARKSIIICG 150 Query: 63 LSGAGKSTLLRSI 75 + +GK+TLL ++ Sbjct: 151 GTASGKTTLLNAL 163 >gnl|CDD|176169 cd08480, PBP2_CrgA_like_10, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 10. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Length = 198 Score = 26.9 bits (60), Expect = 8.3 Identities = 10/28 (35%), Positives = 16/28 (57%) Query: 40 GMVSAVIKANLEVKKGEILVLMGLSGAG 67 +V+ + N+ V GE L + L+GAG Sbjct: 117 RIVALPVSGNILVNDGEALRRLALAGAG 144 >gnl|CDD|114021 pfam05272, VirE, Virulence-associated protein E. This family contains several bacterial virulence-associated protein E like proteins. Length = 198 Score = 27.0 bits (60), Expect = 8.4 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Query: 36 VSEYGMVSAVIKA-NLEVKKGEILVLMGLSGAGKSTLLRSING 77 VS+ ++ AV + K +L+L G G+GKST L+ + G Sbjct: 32 VSKLFLIGAVARVYEPGCKFDHVLILQGAQGSGKSTFLKKLGG 74 >gnl|CDD|146036 pfam03205, MobB, Molybdopterin guanine dinucleotide synthesis protein B. This protein contains a P-loop. Length = 122 Score = 26.9 bits (60), Expect = 8.4 Identities = 11/43 (25%), Positives = 20/43 (46%), Gaps = 10/43 (23%) Query: 57 ILVLMGLSGAGKSTLLRSI------NGLAPVVRGEVLVDTDKG 93 I++++G +GK+TL+R + G V+ D G Sbjct: 2 IVLVVGPKDSGKTTLIRKLLNYLKRRGYRVA----VVKHLDHG 40 >gnl|CDD|32593 COG2524, COG2524, Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription]. Length = 294 Score = 26.8 bits (59), Expect = 9.0 Identities = 17/83 (20%), Positives = 36/83 (43%), Gaps = 10/83 (12%) Query: 270 IQKLNPITALVAADVMRVCSIDDESNIVHKISRQMPLI-----DIID----MVADNLGKI 320 + + + +D+ + + + V R+ + DI D M +N+G++ Sbjct: 209 VDDDKIVGIITLSDIAKAIANGNLDAKVSDYMRKNVITINEDEDIYDAIRLMNKNNVGRL 268 Query: 321 GVVED-DRIVGIITAIDIVRGLS 342 V + + VGIIT DI+ ++ Sbjct: 269 LVTDSNGKPVGIITRTDILTRIA 291 Score = 26.8 bits (59), Expect = 9.1 Identities = 12/23 (52%), Positives = 17/23 (73%) Query: 322 VVEDDRIVGIITAIDIVRGLSCC 344 VV+DD+IVGIIT DI + ++ Sbjct: 208 VVDDDKIVGIITLSDIAKAIANG 230 >gnl|CDD|144347 pfam00709, Adenylsucc_synt, Adenylosuccinate synthetase. Length = 420 Score = 26.7 bits (60), Expect = 9.3 Identities = 10/36 (27%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Query: 210 DELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEG 245 +E L +L+ I S +N A + G ++ + EG Sbjct: 186 EEYLEYAERLRPYITDTSELLNRALKEGKKV-LFEG 220 >gnl|CDD|39822 KOG4622, KOG4622, KOG4622, Predicted nucleotide kinase [General function prediction only]. Length = 291 Score = 26.7 bits (58), Expect = 9.3 Identities = 11/34 (32%), Positives = 17/34 (50%) Query: 57 ILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDT 90 +L L+G+ AGKS+ R I G +R + Sbjct: 3 LLALIGIPAAGKSSFCRKILGAHAALRVRHIEHL 36 >gnl|CDD|30913 COG0567, SucA, 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes [Energy production and conversion]. Length = 906 Score = 26.7 bits (59), Expect = 9.4 Identities = 12/38 (31%), Positives = 20/38 (52%) Query: 134 LGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKINMLS 171 +G+E++ I D E K + E +E T A+ K +L Sbjct: 145 IGVEYMHISDPEEKRWLQERIESGKPTFTAEEKKAILK 182 >gnl|CDD|33254 COG3451, VirB4, Type IV secretory pathway, VirB4 components [Intracellular trafficking and secretion]. Length = 796 Score = 26.9 bits (59), Expect = 9.6 Identities = 25/78 (32%), Positives = 35/78 (44%), Gaps = 10/78 (12%) Query: 185 ATGAPILL-MDEPFSSLD-PLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAI 242 G P L+ +DE + LD P ++D L L RKL +VF + I + L +RIA Sbjct: 631 LDGRPFLIFIDEFWKLLDNPKFADFIRDWLKTL-RKLNGVVVFATQSILDI--LKSRIA- 686 Query: 243 MEGGRIIQCGTPQEIILH 260 I P +I L Sbjct: 687 ----DAIIEQCPTKIFLP 700 >gnl|CDD|133256 cd00880, Era_like, Era (E. coli Ras-like protein)-like. This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons. FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control. Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain. EngA and its orthologs are composed of two GTPase domains and, since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Length = 163 Score = 26.9 bits (60), Expect = 9.7 Identities = 8/16 (50%), Positives = 12/16 (75%) Query: 60 LMGLSGAGKSTLLRSI 75 L G + AGKS+LL ++ Sbjct: 1 LFGRTNAGKSSLLNAL 16 >gnl|CDD|72998 cd03239, ABC_SMC_head, The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms. SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes. The proteins range in size from approximately 110 to 170 kDa, and each has five distinct domains: amino- and carboxy-terminal globular domains, which contain sequences characteristic of ATPases, two coiled-coil regions separating the terminal domains , and a central flexible hinge. SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair, and epigenetic silencing of gene expression.. Length = 178 Score = 26.8 bits (59), Expect = 9.7 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 4/60 (6%) Query: 169 MLSGGMKQRVGFARAFA----TGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIV 224 +LSGG K A FA +P ++DE ++LDP R R+ D + + + + IV Sbjct: 94 ILSGGEKSLSALALIFALQEIKPSPFYVLDEIDAALDPTNRRRVSDMIKEMAKHTSQFIV 153 >gnl|CDD|30598 COG0249, MutS, Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair]. Length = 843 Score = 26.8 bits (59), Expect = 9.8 Identities = 8/23 (34%), Positives = 13/23 (56%) Query: 53 KKGEILVLMGLSGAGKSTLLRSI 75 I+++ G + GKST LR + Sbjct: 605 GNRRIILITGPNMGGKSTYLRQV 627 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.324 0.140 0.402 Gapped Lambda K H 0.267 0.0694 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,141,015 Number of extensions: 222587 Number of successful extensions: 1651 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1415 Number of HSP's successfully gapped: 379 Length of query: 348 Length of database: 6,263,737 Length adjustment: 95 Effective length of query: 253 Effective length of database: 4,210,882 Effective search space: 1065353146 Effective search space used: 1065353146 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 58 (26.2 bits)