RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780342|ref|YP_003064755.1| substrate-binding region of ABC-type glycine betaine transport system [Candidatus Liberibacter asiaticus str. psy62] (309 letters) >gnl|CDD|32296 COG2113, ProX, ABC-type proline/glycine betaine transport systems, periplasmic components [Amino acid transport and metabolism]. Length = 302 Score = 236 bits (604), Expect = 5e-63 Identities = 96/295 (32%), Positives = 144/295 (48%), Gaps = 3/295 (1%) Query: 4 ILAVCLFLTTFSISYARDADSCTPVRFADTGWTDIAATTAMTSVILEEILGYKTNIKLLA 63 L + + A A++ VR AD GWT ATT + IL+ LGY + L Sbjct: 9 AAVAAAALLAAAAAAAAAAEAGKTVRIADVGWTSGTATTNVAKKILKG-LGYTVELVTLD 67 Query: 64 VPVTFRSLKNKGIDIFMGYWYPSLEKFIAPYLEEGSIKLVAENLQGAKYMLAVNDVGFAL 123 V ++SL +D+F W P+ +++ ++L NL+GAK AV Sbjct: 68 TAVMYQSLAKGDLDVFPEAWLPTTPDDYKKAVKDKKVELGGTNLEGAKQGWAVPKYVADA 127 Query: 124 GIKSYQDIAKYKKELGAKIYGIEPGNEGNQRILDMINNNKFSLKGFRLIEASELASFSQI 183 GIKS D+AK+K + G KIYGIEPG + I D I LKGF L+E+SE A + Sbjct: 128 GIKSIADLAKFKDKFGGKIYGIEPGWGCMRVIEDAIKAYGLGLKGFELVESSEAAMLAAA 187 Query: 184 RRDQRNNIPAVFLSWEPHPINSDLNIHYLPGGEEISG--FGEASVYTVVRSDYLDKCPNI 241 R + P VF W PH + ++ YL G G +V+TVVR + ++ PN+ Sbjct: 188 IRAAKRKEPIVFYGWSPHWMFGKYDLKYLEDPGPPKGANGGWETVHTVVRKGFAEEAPNV 247 Query: 242 SRLLKNIKFSVALENEMMKLILNNKQDRQFVGRTMLRTHPDLLKNWLIGVTTFDG 296 ++LL N F +A EN +M + + + + L+ +P++ W+ GV DG Sbjct: 248 AKLLANFSFPLAEENALMAAMDDGGATPEEAAKQWLKANPEIWDGWVSGVAAADG 302 >gnl|CDD|146609 pfam04069, OpuAC, Substrate binding domain of ABC-type glycine betaine transport system. Part of a high affinity multicomponent binding-protein-dependent transport system involved in bacterial osmoregulation. This domain is often fused to the permease component of the transporter complex. Family members are often integral membrane proteins or predicted to be attached to the membrane by a lipid anchor. Glycine betaine is involved in protection from high osmolarity environments for example in Bacillus subtilis. The family member OpuBC is closely related, and involved in choline transport. Choline is necessary for the biosynthesis of glycine betaine. L-carnitine is important for osmoregulation in Listeria monocytogenes. Family also contains proteins binding l-proline (ProX), histidine (HisX) and taurine (TauA). Length = 256 Score = 139 bits (352), Expect = 9e-34 Identities = 54/248 (21%), Positives = 95/248 (38%), Gaps = 10/248 (4%) Query: 27 PVRFADTGWTDIAATTAMTSVILEEILGYKTNI-KLLAVPVTFRSLKNKGIDIFMGYWYP 85 + WT+ + + +LE LGY + L + V F +L + ID++ W Sbjct: 2 TIVIGSKNWTEQEILANIAAQLLEA-LGYVVELVGLGSTAVLFAALASGDIDLYPEEWTG 60 Query: 86 SLEKFIAPYLEEGSIKLVA-ENLQGAKYMLAVN-DVGFALGIKSYQDIAKYKKE---LGA 140 + + +EE LV G Y LAV V GIKS D+AK + Sbjct: 61 TTYEAYKKAVEEKLGLLVLGPLGAGNTYGLAVPKYVAEKPGIKSISDLAKPADDELGFKG 120 Query: 141 KIYGIEPGNEGNQRILDMINNNKFSLKGFRLIEASELASFSQIRRDQRNNIPAVFLSWEP 200 + G G + ++ + L + L+E SE A + + + P V +W P Sbjct: 121 EFIGRPDGWGCTRSTEGLLK--AYGLDKYELVEGSEAAMDALLYAAIKRGEPDVVYAWTP 178 Query: 201 HPINSDLNIHYLPGGEEISGFGEASVYTVVRSDYLDKCPNISRLLKNIKFSVALENEMMK 260 + ++ L + + +V VVR + +K P ++ L + NE+ Sbjct: 179 DWMIKKYDLVVLEDPKGLFPPAY-NVVPVVRKGFAEKHPEVAAFLNKLSLDTEDLNELNA 237 Query: 261 LILNNKQD 268 + +D Sbjct: 238 QVDVEGKD 245 >gnl|CDD|147350 pfam05128, DUF697, Domain of unknown function (DUF697). Family of bacterial hypothetical proteins that is sometimes associated with GTPase domains. Length = 162 Score = 27.1 bits (61), Expect = 5.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Query: 140 AKIYGIEPGNEGNQRILDMI 159 AK+YGIE G EG R+ + Sbjct: 62 AKLYGIELGYEGAIRLARSV 81 >gnl|CDD|144015 pfam00270, DEAD, DEAD/DEAH box helicase. Members of this family include the DEAD and DEAH box helicases. Helicases are involved in unwinding nucleic acids. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression. Length = 167 Score = 26.8 bits (60), Expect = 7.6 Identities = 13/53 (24%), Positives = 20/53 (37%), Gaps = 9/53 (16%) Query: 154 RILDMINNNKFSLKGFRLI---EASELAS------FSQIRRDQRNNIPAVFLS 197 R+LD++ LK +L+ EA L +I R + LS Sbjct: 105 RLLDLLERGGLLLKNLKLLVLDEAHRLLDQGFGDDLEEILRRLPPKRQILLLS 157 >gnl|CDD|33735 COG3954, PrkB, Phosphoribulokinase [Energy production and conversion]. Length = 289 Score = 26.5 bits (58), Expect = 9.1 Identities = 7/19 (36%), Positives = 11/19 (57%) Query: 189 NNIPAVFLSWEPHPINSDL 207 N +P F W+P P +D+ Sbjct: 108 NQVPGTFTPWQPLPEPTDV 126 >gnl|CDD|38590 KOG3380, KOG3380, KOG3380, Actin-related protein Arp2/3 complex, subunit ARPC5 [Cytoskeleton]. Length = 152 Score = 26.4 bits (58), Expect = 9.3 Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 57 TNIKLLAVPVTFRSLKNKGIDIFMGYWYPSLEK 89 T+IK + + L + IDI M Y Y +E Sbjct: 84 TSIKQADIEAAVKKLSTEEIDILMKYIYKGMEI 116 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.138 0.405 Gapped Lambda K H 0.267 0.0798 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,742,507 Number of extensions: 196299 Number of successful extensions: 412 Number of sequences better than 10.0: 1 Number of HSP's gapped: 406 Number of HSP's successfully gapped: 16 Length of query: 309 Length of database: 6,263,737 Length adjustment: 94 Effective length of query: 215 Effective length of database: 4,232,491 Effective search space: 909985565 Effective search space used: 909985565 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 57 (25.6 bits)