RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780344|ref|YP_003064757.1| 7-cyano-7-deazaguanine reductase [Candidatus Liberibacter asiaticus str. psy62] (154 letters) >gnl|CDD|183924 PRK13258, PRK13258, 7-cyano-7-deazaguanine reductase; Provisional. Length = 115 Score = 207 bits (529), Expect = 1e-54 Identities = 62/115 (53%), Positives = 79/115 (68%) Query: 24 EALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQPDFAHMILDYIPKDWLIESKSLKLFM 83 EA+LE P+ + +Y +R T+PEFTSLCP T QPDFA +++DYIP +E KSLKL++ Sbjct: 1 EAVLETFPNPHPGRDYTIRITLPEFTSLCPKTGQPDFATIVIDYIPDKKCVELKSLKLYL 60 Query: 84 ASFRNHHSFHEDCTIYIARRLVTILDPKWLRIGAYWYPRGGIPIDIFWQTSAPPE 138 SFRNH FHEDCT I LV +LDP+WLR+G + PRGGI D+F PP Sbjct: 61 FSFRNHGIFHEDCTNRILDDLVALLDPRWLRVGGDFNPRGGIHTDVFANYGKPPT 115 >gnl|CDD|132183 TIGR03139, QueF-II, 7-cyano-7-deazaguanine reductase. The enzymatic step represents the first point at which the biosynthesis of queuosine in bacteria and eukaryotes is distinguished from the biosynthesis of archaeosine in archaea. Length = 115 Score = 161 bits (409), Expect = 8e-41 Identities = 52/109 (47%), Positives = 71/109 (65%) Query: 22 PNEALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQPDFAHMILDYIPKDWLIESKSLKL 81 P++ LLE P+ + +Y + F PEFTSLCP T QPDFA +++ YIP +E KSLKL Sbjct: 1 PSKELLEAFPNPYPDRDYTIEFVCPEFTSLCPKTGQPDFATIVISYIPDQRCVELKSLKL 60 Query: 82 FMASFRNHHSFHEDCTIYIARRLVTILDPKWLRIGAYWYPRGGIPIDIF 130 ++ SFRNH FHE+ T I LV +L P++LR+ + PRGGI +F Sbjct: 61 YLFSFRNHGIFHENVTNTILDDLVKLLQPRYLRVIGDFNPRGGIKTIVF 109 >gnl|CDD|163150 TIGR03138, QueF, 7-cyano-7-deazaguanine reductase. The enzymatic step represents the first point at which the biosynthesis of queuosine in bacteria and eukaryotes is distinguished from the biosynthesis of archaeosine in archaea. Length = 275 Score = 56.9 bits (138), Expect = 2e-09 Identities = 32/98 (32%), Positives = 52/98 (53%), Gaps = 4/98 (4%) Query: 50 SLCPVTSQPDFAHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARRLVTILD 109 S CPVT QPD+ + + Y K I+ ++L ++ SFR H+ FHE C I ++ Sbjct: 180 SNCPVTGQPDWGSVQIRYRGKK--IDREALLRYLISFRQHNEFHEQCVERIFADIMRFCQ 237 Query: 110 PKWLRIGAYWYPRGGIPIDIFWQT--SAPPEGVFLPNQ 145 P+ L + A + RGG+ I+ + +A P+ + L Q Sbjct: 238 PEKLTVYARYTRRGGLDINPYRSNDEAATPDNIRLARQ 275 Score = 30.3 bits (69), Expect = 0.20 Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Query: 73 LIESKSLKLFMASFRNHHSF 92 LIESKS KL++ SF N F Sbjct: 80 LIESKSFKLYLNSF-NQTRF 98 >gnl|CDD|183317 PRK11792, queF, 7-cyano-7-deazaguanine reductase; Provisional. Length = 273 Score = 45.5 bits (109), Expect = 5e-06 Identities = 32/86 (37%), Positives = 44/86 (51%), Gaps = 16/86 (18%) Query: 50 SLCPVTSQPDFAHMILDYI-PKDWLIESKSLKLFMASFRNHHSFHEDC--TIY--IARRL 104 S C VT QPD+ + + Y PK I+ + L ++ SFR H+ FHE C I+ I R Sbjct: 178 SNCLVTGQPDWGSVQIRYRGPK---IDREGLLRYLVSFRQHNEFHEQCVERIFTDIMRF- 233 Query: 105 VTILDPKWLRIGAYWYP-RGGIPIDI 129 P+ L + A Y RGG +DI Sbjct: 234 ---CQPEKLTVYA-RYTRRGG--LDI 253 Score = 30.1 bits (69), Expect = 0.25 Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Query: 73 LIESKSLKLFMASFRNHHSF 92 LIESKS KL++ SF N F Sbjct: 79 LIESKSFKLYLNSF-NQTRF 97 >gnl|CDD|129173 TIGR00063, folE, GTP cyclohydrolase I. GTP cyclohydrolase I (EC 3.5.4.16) catalyzes the biosynthesis of formic acid and dihydroneopterin triphosphate from GTP. This reaction is the first step in the biosynthesis of tetrahydrofolate in prokaryotes, of tetrahydrobiopterin in vertebrates, and of pteridine-containing pigments in insects. Length = 180 Score = 36.3 bits (84), Expect = 0.004 Identities = 20/64 (31%), Positives = 25/64 (39%) Query: 47 EFTSLCPVTSQPDFAHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARRLVT 106 FTS C P + YIPKD +I + + F E T IA L Sbjct: 66 TFTSTCEHHLVPFDGKAHVAYIPKDKVIGLSKIARIVEFFARRPQVQERLTQQIAEALQE 125 Query: 107 ILDP 110 IL+P Sbjct: 126 ILEP 129 >gnl|CDD|116302 pfam07688, KaiA, KaiA domain. The cyanobacterial clock proteins KaiA and KaiB are proposed as regulators of the circadian rhythm in cyanobacteria. The overall fold of the KaiA monomer is that of a four-helix bundle, which forms a dimer in the known structure. Length = 283 Score = 27.1 bits (60), Expect = 1.8 Identities = 14/49 (28%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Query: 16 AKPCDDPNE-----ALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQPD 59 AKP D A + SQ L V I F L P+ + P+ Sbjct: 83 AKPTDPHPTIVYHNAEIHLPESQLSQLPTQVDRAIAHFLHLGPICTLPN 131 >gnl|CDD|179372 PRK02114, PRK02114, formylmethanofuran--tetrahydromethanopterin formyltransferase; Provisional. Length = 297 Score = 25.9 bits (58), Expect = 4.4 Identities = 9/28 (32%), Positives = 14/28 (50%) Query: 91 SFHEDCTIYIARRLVTILDPKWLRIGAY 118 +F E + + R L+T KW +I A Sbjct: 11 TFAEAFPMKVTRVLITAATKKWAKIAAT 38 >gnl|CDD|180000 PRK05298, PRK05298, excinuclease ABC subunit B; Provisional. Length = 652 Score = 25.8 bits (58), Expect = 5.3 Identities = 8/16 (50%), Positives = 11/16 (68%), Gaps = 3/16 (18%) Query: 64 ILDYIPKDWLI---ES 76 +LDY P D+L+ ES Sbjct: 325 LLDYFPDDFLLFIDES 340 >gnl|CDD|152431 pfam11996, DUF3491, Protein of unknown function (DUF3491). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 286 to 3225 amino acids in length. This protein is found associated with pfam04488. This protein is found associated with pfam04488. Length = 934 Score = 25.5 bits (56), Expect = 5.5 Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Query: 121 PRGGIPIDIFWQTSAPPEG--VFLPNQDVP 148 PR +P+ + W+ PE V + QD+P Sbjct: 402 PRYALPLTVSWKEETLPEQTRVEINPQDIP 431 >gnl|CDD|162699 TIGR02094, more_P_ylases, alpha-glucan phosphorylases. This family consists of known phosphorylases, and homologs believed to share the function of using inorganic phosphate to cleave an alpha 1,4 linkage between the terminal glucose residue and the rest of the polymer (maltodextrin, glycogen, etc.). The name of the glucose storage polymer substrate, and therefore the name of this enzyme, depends on the chain lengths and branching patterns. A number of the members of this family have been shown to operate on small maltodextrins, as may be obtained by utilization of exogenous sources. This family represents a distinct clade from the related family modeled by TIGR02093/PF00343. Length = 601 Score = 25.4 bits (56), Expect = 6.3 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 83 MASFRNHHSFHEDCTIYIARRLVTILDPKWL 113 FR F E+ I +AR LV+ +D WL Sbjct: 453 RPEFRGRIVFLENYDINLARYLVSGVD-VWL 482 Score = 25.4 bits (56), Expect = 6.6 Identities = 7/20 (35%), Positives = 12/20 (60%) Query: 11 ILGGKAKPCDDPNEALLERI 30 + GKA P D + +++RI Sbjct: 428 VFAGKAHPADGEGKEIIQRI 447 >gnl|CDD|152338 pfam11902, DUF3422, Protein of unknown function (DUF3422). This family of proteins are functionally uncharacterized. This protein is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 426 to 444 amino acids in length. Length = 419 Score = 25.2 bits (56), Expect = 6.7 Identities = 9/30 (30%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Query: 47 EFTSL---CPVTSQPDFAHMILDYIPKDWL 73 EF++ P F L+ +P+DWL Sbjct: 82 EFSTYTFFRPGPGDEPFDPPALELLPQDWL 111 >gnl|CDD|182474 PRK10456, PRK10456, arginine succinyltransferase; Provisional. Length = 344 Score = 25.5 bits (56), Expect = 7.0 Identities = 12/41 (29%), Positives = 20/41 (48%), Gaps = 6/41 (14%) Query: 51 LCPVTSQPDFAHMILDYIPKDWLIESKSLKLFMASFRNHHS 91 LC + PD+ + + SKS +FMA+FR+ + Sbjct: 122 LCTLFLDPDWRK------EGNGYLLSKSRFMFMAAFRDKFN 156 >gnl|CDD|183693 PRK12705, PRK12705, hypothetical protein; Provisional. Length = 508 Score = 25.1 bits (55), Expect = 7.2 Identities = 8/22 (36%), Positives = 11/22 (50%), Gaps = 2/22 (9%) Query: 88 NHHSFHEDCTIYIARRLVTILD 109 +HH+ T+Y LV I D Sbjct: 393 SHHNKVNPETVY--SVLVQIAD 412 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.323 0.141 0.461 Gapped Lambda K H 0.267 0.0719 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,676,454 Number of extensions: 160890 Number of successful extensions: 286 Number of sequences better than 10.0: 1 Number of HSP's gapped: 284 Number of HSP's successfully gapped: 21 Length of query: 154 Length of database: 5,994,473 Length adjustment: 85 Effective length of query: 69 Effective length of database: 4,157,793 Effective search space: 286887717 Effective search space used: 286887717 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (24.2 bits)