RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780344|ref|YP_003064757.1| 7-cyano-7-deazaguanine reductase [Candidatus Liberibacter asiaticus str. psy62] (154 letters) >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Score = 31.8 bits (71), Expect = 0.026 Identities = 12/89 (13%), Positives = 26/89 (29%), Gaps = 2/89 (2%) Query: 53 PVTSQPDFAHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARRLVTILDPKW 112 V + + + L + + + ++C I R Sbjct: 109 KVDVIQGDGQFLDPHHLEVSLTAGDAYEQAAPTGEKKIVAFKNCIIAAGSRAPNGKLISA 168 Query: 113 LRIGAYWYPRGGIPIDIFWQTSAPPEGVF 141 + G RG I +D +T+ P ++ Sbjct: 169 EKAGVAVTDRGFIEVDKQMRTNVP--HIY 195 >d1sr4c_ b.42.2.1 (C:) Cytolethal distending toxin subunit C {Haemophilus ducreyi [TaxId: 730]} Length = 154 Score = 29.5 bits (66), Expect = 0.12 Identities = 6/26 (23%), Positives = 10/26 (38%) Query: 9 LSILGGKAKPCDDPNEALLERIPSQN 34 + LG C D + + IP+ Sbjct: 73 FAFLGKGTTDCKDTDHTVFNLIPTNT 98 >d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Score = 25.8 bits (55), Expect = 1.6 Identities = 6/77 (7%), Positives = 19/77 (24%) Query: 60 FAHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARRLVTILDPKWLRIGAYW 119 + + + + + H ++ L+ Sbjct: 125 WGSLESKNVVNVRESADPASAVKERLETEHILLASGSWPHMPNGRSPRTKDLQLQNAGVM 184 Query: 120 YPRGGIPIDIFWQTSAP 136 GG+ +D + +T+ Sbjct: 185 IKNGGVQVDEYSRTNVS 201 >d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Score = 25.3 bits (54), Expect = 2.4 Identities = 8/30 (26%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Query: 112 WLRIGAYWYPRGGIPIDIFWQTSAPPEGVF 141 +G P+G + ++ + QTS P V+ Sbjct: 200 AKILGLDLGPKGEVLVNEYLQTSVP--NVY 227 >d1nd6a_ c.60.1.2 (A:) Prostatic acid phosphatase {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Score = 24.8 bits (53), Expect = 3.6 Identities = 11/50 (22%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Query: 29 RIPSQNKNLNYVVRFTIPEFTSLCPVTSQPDFAHMILDYIPKDWLIESKS 78 + +N+ + +P + CP+ FA ++ IP+DW E + Sbjct: 296 EMYYRNETQHEPYPLMLPGCSPSCPLE---RFAELVGPVIPQDWSTECMT 342 >d1ftra1 d.58.33.1 (A:1-148) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 148 Score = 24.3 bits (53), Expect = 4.6 Identities = 9/28 (32%), Positives = 12/28 (42%) Query: 91 SFHEDCTIYIARRLVTILDPKWLRIGAY 118 +F E +AR L+T KW I Sbjct: 11 TFAEAFEAKMARVLITAASHKWAMIAVK 38 >d1m5sa1 d.58.33.1 (A:1-145) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Archaeon Methanosarcina barkeri [TaxId: 2208]} Length = 145 Score = 24.3 bits (53), Expect = 5.6 Identities = 9/28 (32%), Positives = 14/28 (50%) Query: 91 SFHEDCTIYIARRLVTILDPKWLRIGAY 118 ++ E I IAR L+T +W + A Sbjct: 11 TYAEAFPIKIARVLITAATKRWALVAAT 38 >d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Length = 81 Score = 24.0 bits (52), Expect = 6.2 Identities = 4/25 (16%), Positives = 12/25 (48%) Query: 90 HSFHEDCTIYIARRLVTILDPKWLR 114 +F + + + + + I+D L+ Sbjct: 51 STFVSERMLALDGKRIKIIDCDRLQ 75 >d1u7la_ e.57.1.1 (A:) Vacuolar ATP synthase subunit C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Score = 23.6 bits (51), Expect = 8.2 Identities = 6/29 (20%), Positives = 10/29 (34%), Gaps = 2/29 (6%) Query: 20 DDPNEALLERIPSQNKNLNYVVRFTIPEF 48 ++ + +V F IPEF Sbjct: 23 GSKTDSWFNE--TLIGGRAFVSDFKIPEF 49 >d1i5pa3 f.1.3.1 (A:1-263) delta-Endotoxin (insectocide), N-terminal domain {Bacillus thuringiensis subsp. kurstaki, CRY2AA [TaxId: 29339]} Length = 263 Score = 23.3 bits (50), Expect = 8.6 Identities = 15/80 (18%), Positives = 30/80 (37%), Gaps = 10/80 (12%) Query: 20 DDPNEALLERIPSQNKNLNYVVRFTIPEFTS------LCPVTSQPDFAHMIL--DYI--P 69 + + I S + + +P+F L P+ +Q H+ D I Sbjct: 136 NPTQNPVPLSITSSVNTMQQLFLNRLPQFQIQGYQLLLLPLFAQAANMHLSFIRDVILNA 195 Query: 70 KDWLIESKSLKLFMASFRNH 89 +W I + +L+ + RN+ Sbjct: 196 DEWGISAATLRTYRDYLRNY 215 >d1uyra2 c.14.1.4 (A:1815-2218) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 404 Score = 23.4 bits (50), Expect = 9.1 Identities = 2/18 (11%), Positives = 8/18 (44%) Query: 18 PCDDPNEALLERIPSQNK 35 D + ++ P+ ++ Sbjct: 8 ETKDTWDRPVDFTPTNDE 25 >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Score = 23.3 bits (49), Expect = 9.2 Identities = 8/21 (38%), Positives = 11/21 (52%), Gaps = 2/21 (9%) Query: 121 PRGGIPIDIFWQTSAPPEGVF 141 RG I +D +TS P +F Sbjct: 169 NRGLIEVDQQCRTSVP--NIF 187 >d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 476 Score = 23.2 bits (49), Expect = 10.0 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 8/45 (17%) Query: 9 LSILGGKAKPCDDPNEALLERIPSQNKNL--------NYVVRFTI 45 L ++ + K D NEALLERI S K +V+RF I Sbjct: 406 LGLVCFRLKGSDGLNEALLERINSARKIHLVPCRLRGQFVLRFAI 450 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.323 0.141 0.461 Gapped Lambda K H 0.267 0.0426 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 646,072 Number of extensions: 29789 Number of successful extensions: 59 Number of sequences better than 10.0: 1 Number of HSP's gapped: 59 Number of HSP's successfully gapped: 17 Length of query: 154 Length of database: 2,407,596 Length adjustment: 78 Effective length of query: 76 Effective length of database: 1,336,656 Effective search space: 101585856 Effective search space used: 101585856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.4 bits)