PSIBLAST alignment of GI: 254780346 and protein with PDB id: 1kyv

gi|22219132|pdb|1KYV|A Chain A, Lumazine Synthase From S.Pombe Bound To Riboflavin Length = 159
>gi|22219133|pdb|1KYV|B Chain B, Lumazine Synthase From S.Pombe Bound To Riboflavin Length = 159
>gi|22219134|pdb|1KYV|C Chain C, Lumazine Synthase From S.Pombe Bound To Riboflavin Length = 159
>gi|22219135|pdb|1KYV|D Chain D, Lumazine Synthase From S.Pombe Bound To Riboflavin Length = 159
>gi|22219136|pdb|1KYV|E Chain E, Lumazine Synthase From S.Pombe Bound To Riboflavin Length = 159
>gi|22219137|pdb|1KYX|A Chain A, Lumazine Synthase From S.Pombe Bound To Carboxyethyllumazine Length = 159
 Score =  105 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/139 (26%), Positives = 66/139 (47%), Gaps = 9/139 (6%)

Query: 7   HVLIIEARFYENLSAMLFEGCVNV-LHSRAVQ---WSSIVTPGVLEIPAAVSMVMNAKTR 62
            +LI+ AR+       L +G V   +    V+         PG  E+P  +     A   
Sbjct: 19  RILIVHARWNLQAIEPLVKGAVETMIEKHDVKLENIDIESVPGSWELPQGIR----ASIA 74

Query: 63  SVTYDGIIVLGVVMRGKTAHCDVIAHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAFDRV 122
             TYD +I +GV+++G T H + I+ AV  GL+ + ++  +P+  G++ V +E+QA  R 
Sbjct: 75  RNTYDAVIGIGVLIKGSTMHFEYISEAVVHGLMRVGLDSGVPVILGLLTVLNEEQALYRA 134

Query: 123 SPSHL-DRGGCAARSALAM 140
             +   + G     +A+ M
Sbjct: 135 GLNGGHNHGNDWGSAAVEM 153