BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780346|ref|YP_003064759.1| riboflavin synthase subunit beta [Candidatus Liberibacter asiaticus str. psy62] (149 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780346|ref|YP_003064759.1| riboflavin synthase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 149 Score = 303 bits (776), Expect = 8e-85, Method: Compositional matrix adjust. Identities = 149/149 (100%), Positives = 149/149 (100%) Query: 1 MEVFIPHVLIIEARFYENLSAMLFEGCVNVLHSRAVQWSSIVTPGVLEIPAAVSMVMNAK 60 MEVFIPHVLIIEARFYENLSAMLFEGCVNVLHSRAVQWSSIVTPGVLEIPAAVSMVMNAK Sbjct: 1 MEVFIPHVLIIEARFYENLSAMLFEGCVNVLHSRAVQWSSIVTPGVLEIPAAVSMVMNAK 60 Query: 61 TRSVTYDGIIVLGVVMRGKTAHCDVIAHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAFD 120 TRSVTYDGIIVLGVVMRGKTAHCDVIAHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAFD Sbjct: 61 TRSVTYDGIIVLGVVMRGKTAHCDVIAHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAFD 120 Query: 121 RVSPSHLDRGGCAARSALAMIELKKSLSE 149 RVSPSHLDRGGCAARSALAMIELKKSLSE Sbjct: 121 RVSPSHLDRGGCAARSALAMIELKKSLSE 149 >gi|254780596|ref|YP_003065009.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 438 Score = 22.7 bits (47), Expect = 3.4, Method: Compositional matrix adjust. Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 4/53 (7%) Query: 74 VVMRGKTAHCDVI-AHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAF---DRV 122 ++M + DV+ A + L+DL I G LPI + ++V + ++A DRV Sbjct: 166 LLMDEPFSALDVLTAENLRTDLIDLWIEGRLPIESMLMVTHNIEEAVLMCDRV 218 >gi|254781108|ref|YP_003065521.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus str. psy62] Length = 398 Score = 22.3 bits (46), Expect = 3.9, Method: Compositional matrix adjust. Identities = 7/31 (22%), Positives = 16/31 (51%) Query: 7 HVLIIEARFYENLSAMLFEGCVNVLHSRAVQ 37 H++ I + L A + GC +++ R ++ Sbjct: 21 HIMYIRNQMQSALDAAVLSGCASIVSDRTIK 51 >gi|254780200|ref|YP_003064613.1| ferrochelatase [Candidatus Liberibacter asiaticus str. psy62] Length = 343 Score = 21.9 bits (45), Expect = 4.9, Method: Compositional matrix adjust. Identities = 8/39 (20%), Positives = 20/39 (51%) Query: 63 SVTYDGIIVLGVVMRGKTAHCDVIAHAVTRGLVDLSING 101 + +DGI L ++ G ++ C ++ + ++ +NG Sbjct: 272 KLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNG 310 >537021.9.peg.788_1 Length = 270 Score = 21.9 bits (45), Expect = 5.0, Method: Compositional matrix adjust. Identities = 7/13 (53%), Positives = 12/13 (92%) Query: 105 IGNGIVVVDSEQQ 117 +GNG+VV+D +Q+ Sbjct: 248 LGNGVVVIDWQQR 260 >gi|254780340|ref|YP_003064753.1| proline/glycine betaine ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Score = 21.9 bits (45), Expect = 5.8, Method: Compositional matrix adjust. Identities = 9/19 (47%), Positives = 14/19 (73%) Query: 98 SINGSLPIGNGIVVVDSEQ 116 SING P+ G V+VD+++ Sbjct: 74 SINGLAPVVRGEVLVDTDK 92 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.135 0.389 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,493 Number of Sequences: 1233 Number of extensions: 3276 Number of successful extensions: 10 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 7 length of query: 149 length of database: 328,796 effective HSP length: 66 effective length of query: 83 effective length of database: 247,418 effective search space: 20535694 effective search space used: 20535694 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 34 (17.7 bits)