HHsearch alignment for GI: 254780353 and conserved domain: PRK09631

>PRK09631 DNA topoisomerase IV subunit A; Provisional.
Probab=93.59  E-value=0.67  Score=26.32  Aligned_cols=351  Identities=11%  Similarity=0.085  Sum_probs=142.1

Q ss_pred             EEEEEEECCCCCHHHHHHHHHH--------HCCCCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHH-------------
Q ss_conf             5889850454588999998754--------2000012233113331268972204999999899998-------------
Q gi|254780353|r  310 RIVLFPKNRSLDPDLLMESIFM--------LSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR-------------  368 (753)
Q Consensus       310 ~~vi~~~~r~~~~~~vl~~Lyk--------~T~Lq~sf~~N~~~l~~~~~P~~~~l~eil~~f~~~R-------------  368 (753)
T Consensus       221 ~ivItEiPy~v~k~~lie~I~~~~~~~ki~I~~i~D~s~~~vrIvi-~-lk~~~~~~~vln~Ly~~T~lq~sf~~n~~ai  298 (626)
T PRK09631        221 TIVIRELPFGETTESLIASIEKAIRKNYIKVSSINDFTAENVEIEL-K-LPRGVYASEVIEKLYHYTNCQVSISVNLLLL  298 (626)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEE-E-ECCCCCHHHHHHHHHHHCCHHHEECCEEEEE
T ss_conf             5999956877778999999999997256762114146898279999-9-8999998999999875097132176268999


Q ss_pred             ----------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHH------HHHHHHCCCCCCCCCCCCCCCC----H
Q ss_conf             ----------9999999999999999999999999986410---789------9997520000110000002577----5
Q gi|254780353|r  369 ----------REVLFRRSSFRMQAIDRRVEILKGLLIAYLN---IDE------IIAIIRNEDKPKPVMVSRFSLT----E  425 (753)
Q Consensus       369 ----------~~vi~rr~~~~L~k~~~RlhIleGl~~a~~~---ID~------vI~iIR~s~~~k~~L~~~f~ls----e  425 (753)
T Consensus       299 ~~~~P~~l~l~eiL~~~~~h~~~vl~r~le~~l~k~~er~H~~sLe~IfIe~rIy~~Ie~~~~~e~v~~~i~~~l~pf~~  378 (626)
T PRK09631        299 SDRYPVIYTVTDIIKFHAEHLQKILKMELELERSKILEKIFSKTLEQIFIEKKIYKILETISKEEDVVSIVLSELLPFKS  378 (626)
T ss_pred             ECCEEEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHH
T ss_conf             89982798799999999999999999999988998998689999999986666899988420168899999987776788


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCH
Q ss_conf             77889988789999889999766678999988776544203978878999999999987417743345554200001100
Q gi|254780353|r  426 NQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRA  505 (753)
Q Consensus       426 ~QA~aIL~mrL~rLt~le~~kl~~E~~eL~~~i~~L~~IL~s~~~l~~iI~~EL~eikkkfgd~~~~~~RRT~iie~~~~  505 (753)
T Consensus       379 ~l~r~ite~d~~aLleirL~RI-----------T~~di--dK~~eei~~L~~eI~eI~~~L~~l-----~~~~I~~l~--  438 (626)
T PRK09631        379 SLSRDVTEDDVENLLKIPIRKI-----------SLFDI--DKNNKDIRILNKELKSIESNIKSI-----KGYAINFID--  438 (626)
T ss_pred             HHHHCCCHHHHHHHHHHHHHHH-----------HHHHH--HHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHH--
T ss_conf             7630157999999999899885-----------34308--879999999999999998637768-----999999999--


Q ss_pred             HHHHHHHCCCCCCCCEEEEECCCEEECCCCCCCCCCCCCCCCCCCCEEEEEECCCCCEEEEECCCEEEEEEHHHCCCCCC
Q ss_conf             00001100245667059987101020256554455322345555540121111478178980688278755112121234
Q gi|254780353|r  506 DKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRG  585 (753)
Q Consensus       506 ~~~~~~EdlI~~E~v~V~LS~~GyIKr~k~~~~~~~~~~~KegD~l~~~~~~~t~d~LLffTs~GkvY~l~a~~Ips~~~  585 (753)
T Consensus       439 -------~Lk~kY---------G~~~--~----RKTE---------------------I~lfd~i~aKrVa~~n~Kly~n  475 (626)
T PRK09631        439 -------KLLAKY---------SKEY--K----RKTE---------------------ISLIKSKNVREIATKNMKVYLN  475 (626)
T ss_pred             -------HHHHHH---------CCCC--C----CEEE---------------------EEEECCEEEEEEECCCCEEEEC
T ss_conf             -------999873---------5477--7----2579---------------------9976444369957023325665


Q ss_pred             CCCCCCCCCCCCCCCEEEEEEEECCCCEEEEEECCCCEEEEEHHHHHCCCCCCEEEEEECCCC--C-EEEEEECCCCEEE
Q ss_conf             444222235767653078999857998599997489789963887402333562788536898--0-5688961898099
Q gi|254780353|r  586 HGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEE--K-MKLVVKVTGDHVA  662 (753)
Q Consensus       586 kG~pI~~ll~l~~~EkIv~~~~~~~~~~lll~Tk~G~ikr~~l~~~~~~~k~Gk~~ikLk~~D--~-li~v~~~~~d~ii  662 (753)
T Consensus       476 r~~GFiG-tslKkdDfV~~C---Sd~DdILvF-~dG~ykV~kV~~K~Fvgk~i~~v~v~~k~d~~~tiyn~IYrDgk---  547 (626)
T PRK09631        476 LETGFVG-TSLIDGEFIGNA---SYYDKILIF-KDGSYVLKNIEDKTFIDKKNVCVLVYDINNSKEQVFSIIYRDKL---  547 (626)
T ss_pred             CCCCEEE-ECCCCCCEEEEC---CCCCEEEEE-ECCEEEEEECCCCCEECCCCEEEEEEECCCCCCEEEEEEEECCC---
T ss_conf             8885561-035678456733---566539999-89859999857760546883799998527876507999998699---


Q ss_pred             EEECCCCEEEEEHHHCCCCCHHHCCEEEECCCCCEEEEEEEECCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCCCCCC
Q ss_conf             99569938995578778336121413342187875689997338883699941775664511432254441366602755
Q gi|254780353|r  663 VVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPK  742 (753)
Q Consensus       663 liT~~Gk~LrF~~~eIr~~gRgkGVk~i~Lkd~~~~~~~~~~~~e~~~il~~t~~g~~k~~~~~~~~~~~RggkG~~~~k  742 (753)
T Consensus       548 --~g~~yiKRF~V~~~t---rdK~Y~l~--~~~s--~~l~fs~n~nl~~~-~~~k~~~~~~df~~~~iKgr~skGn~vtk  617 (626)
T PRK09631        548 --DNFYYVKRFKIDKFI---LDKVYEFL--PEND--EFLDFSLNPEFVPF-SRSKDIVKMIEIDNFMVKSRSSKGKRISS  617 (626)
T ss_pred             --CCCEEEEEEEECCEE---ECCCCCCC--CCCC--EEEEEEECCCCCCC-CCCCCEEEEECHHHEEEECCCCCCEEEEC
T ss_conf             --883689998832388---42522457--9998--79999977765745-44245147732114034144455517631


Q ss_pred             C
Q ss_conf             2
Q gi|254780353|r  743 G  743 (753)
Q Consensus       743 ~  743 (753)
T Consensus       618 ~  618 (626)
T PRK09631        618 R  618 (626)
T ss_pred             C
T ss_conf             4