HHsearch alignment for GI: 254780353 and conserved domain: TIGR01063

>TIGR01063 gyrA DNA gyrase, A subunit; InterPro: IPR005743 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis , . DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA . Type II topoisomerases are ATP-dependent enzymes, and can be subdivided according to their structure and reaction mechanisms: type IIA (topoisomerase II or gyrase, and topoisomerase IV) and type IIB (topoisomerase VI). These enzymes are responsible for relaxing supercoiled DNA as well as for introducing both negative and positive supercoils . Topoisomerase II (called gyrase in bacteria) primarily introduces negative supercoils into DNA. In bacteria, topoisomerase II consists of two polypeptide subunits, gyrA and gyrB, which form a heterotetramer: (BA)2. In most eukaryotes, topoisomerase II consists of a single polypeptide, where the N- and C-terminal regions correspond to gyrB and gyrA, respectively. This entry represents the A subunit (gyrA) as found predominantly in bacteria, but does not include the topoisomerase II enzymes composed of a single polypeptide, as are found in most eukaryotes. GyrA has two functional domains: an N-terminal that forms the covalent DNA-protein bridge that is responsible for the breaking- and rejoining function, and a C-terminal that can bind DNA non-specifically . More information about this protein can be found at Protein of the Month: DNA Topoisomerase .; GO: 0003677 DNA binding, 0003918 DNA topoisomerase (ATP-hydrolyzing) activity, 0005524 ATP binding, 0006265 DNA topological change, 0006268 DNA unwinding during replication, 0005694 chromosome.
Probab=99.89  E-value=1.3e-21  Score=181.95  Aligned_cols=180  Identities=21%  Similarity=0.290  Sum_probs=135.8

Q ss_pred             CCC---CEEEEECCCEEECCCCCC------CCCCCCCCCCCCCCEEEEEECCCCC-EEEEECCCEEEEEEHH--HC-C-C
Q ss_conf             667---059987101020256554------4553223455555401211114781-7898068827875511--21-2-1
Q gi|254780353|r  517 KEP---ITVVISNRGWIRSLKSHS------VDLSALHFKEGDSLKIALHAHTTDR-ILLLSTDGKAYTLPAG--NL-L-S  582 (753)
Q Consensus       517 ~E~---v~V~LS~~GyIKr~k~~~------~~~~~~~~KegD~l~~~~~~~t~d~-LLffTs~GkvY~l~a~--~I-p-s  582 (753)
T Consensus       630 d~~~~~yl~~aTk~G~vKk~~L~~F~~~rs~GiiAi~L~e~D~L~~v~~~~~~~~~v~l~s~~G~~~RF~~~~~~vR~mg  709 (864)
T TIGR01063       630 DEAYDLYLFLATKNGVVKKTSLTEFSNIRSNGIIAIKLDEGDELISVRLVDGDDEKVMLGSKNGKAVRFPEEDEEVREMG  709 (864)
T ss_pred             CCCCCEEEEEECCCCEEEEEECHHHHHHHHCCEEEEEEECCCEEEEEEEEECCCCEEEEEECCCCEEECCCCCCCHHCCC
T ss_conf             55266179997267438874001443545278699997089689999996078865886514884798368853110024


Q ss_pred             CCCCCCCCCCCCCCCCC----------------------------CEEEEEEEECCCC-EEEEEECCCCEEEEEHHHHHC
Q ss_conf             23444422223576765----------------------------3078999857998-599997489789963887402
Q gi|254780353|r  583 GRGHGEAIQLLIDLNHN----------------------------QDIVTAFVYDSTC-KLLVVSSKGNAFIVEESEIIA  633 (753)
Q Consensus       583 ~~~kG~pI~~ll~l~~~----------------------------EkIv~~~~~~~~~-~lll~Tk~G~ikr~~l~~~~~  633 (753)
T Consensus       710 R~~~GV~G---i~L~~~~~v~~~~~~~~i~~~~~D~~~~~L~~NlD~vv~~~~~~e~~~~lL~vt~nGyGKRt~~~~yr~  786 (864)
T TIGR01063       710 RATRGVRG---IKLKNEDSVISMTVLKGINSIKEDRNLEELGVNLDFVVSLEVVSEESQKLLIVTENGYGKRTSIEEYRL  786 (864)
T ss_pred             CCCCCEEE---EEECCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEECCCCCEEEEEEECCCCEECCHHHCCC
T ss_conf             55676013---540677740001344321200222246543742434477786249983789983068420042625763


Q ss_pred             CCCCCEEEEEEC--C-CCCEEEEEECCC-CEEEEEECCCCEEEEEHHHCCCCCH-HHCCEEEECCCCCEEE
Q ss_conf             333562788536--8-980568896189-8099995699389955787783361-2141334218787568
Q gi|254780353|r  634 NTRKGKTFLKVS--S-EEKMKLVVKVTG-DHVAVVGENRKLLIFSIDQIPEMSR-GKGVRLQSYKDGGISD  699 (753)
Q Consensus       634 ~~k~Gk~~ikLk--~-~D~li~v~~~~~-d~iiliT~~Gk~LrF~~~eIr~~gR-gkGVk~i~Lkd~~~~~  699 (753)
T Consensus       787 ~~RGg~Gv~~~~~~~r~G~vVga~~V~~~d~lm~iT~~G~~iR~~~~~vs~~GR~t~GVrL~~l~e~d~vv  857 (864)
T TIGR01063       787 QSRGGKGVKSIKITDRNGQVVGAIAVDDDDELMLITSSGKLIRTSVQDVSIQGRNTQGVRLIRLDEDDKVV  857 (864)
T ss_pred             CCCCCCEEEEEEEECCCCCEEEEEEECCCCHHHHEECCCCEEEEEEEHHCCCCCCCCCEEEEEECCCCCEE
T ss_conf             26566237889986468968789874587400010108837997610321156535655898517876356