HHsearch alignment for GI: 254780353 and conserved domain: pfam00521

>pfam00521 DNA_topoisoIV DNA gyrase/topoisomerase IV, subunit A.
Probab=100.00  E-value=0  Score=1051.50  Aligned_cols=420  Identities=48%  Similarity=0.790  Sum_probs=401.8

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHCCCCCCHHHHHHHHHHHHCCHHHCCCCCCCCCCCCCC
Q ss_conf             04764112897046899999998689998980354053666542768874789999999610013216613267887088
Q gi|254780353|r   41 RAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGN  120 (753)
Q Consensus        41 Ralpd~~DGlKpvqRril~~m~~~~~~~~~~~~K~ar~vg~v~gkyhPHGd~s~y~a~v~maq~~~~~~pli~g~GnfGs  120 (753)
T Consensus         1 RaiP~~~DGLKP~qRkil~~~~~~~l~~~~~~~Kva~l~G~v~~~YHpHGe~sl~~tiv~mAQ~f~~n~~Ll~~~GnFGs   80 (428)
T pfam00521         1 RAIPDVRDGLKPVQRRILYAMFELGLNLDKKYKKVARLVGDVMGKYHPHGDASIYDALVRMAQDFVGNIPLLDGQGNFGS   80 (428)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCEEEEEHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
T ss_conf             99985234787899999999997278889986056433365663568885899999999986763156553216888888


Q ss_pred             C-CCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEEECCCCCHHHHCCCCCHHHHHHHHCCCCCHHHH
Q ss_conf             6-779710024689985599999984218786175216799632422312345267642665046777751677788999
Q gi|254780353|r  121 I-DGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEI  199 (753)
Q Consensus       121 ~-~~d~~Aa~RYte~rl~~~~~~ll~di~~~~v~~~~n~D~~~~EP~~lp~~~P~lL~Ng~~GIavG~at~ipphnl~ev  199 (753)
T Consensus        81 r~~g~~~AA~RYi~trLs~~~~~if~~~d~~~l~~~~~yDg~~~EP~~y~piiP~iLvNG~~GIgtG~sT~IP~hNp~ei  160 (428)
T pfam00521        81 RLDGDKAAAMRYTEARLSKIARELFKDIDKDTVDFVPNYDGSEKEPTVLPPIIPNLLVNGASGIAVGMATNIPPHNLGEV  160 (428)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHCCCCCCHHHHCCCCCCEEHEECCCCCCCHHHH
T ss_conf             88898327788999757499999976426350155057898706751106655676623787301000027788888999


Q ss_pred             HHHHHHHHHCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHCCCCEEEEEEEEEEEECCCCCEEEEEECCCCCCCH
Q ss_conf             99999987286532013443203677887760106988999898503341599999998643788407999524200216
Q gi|254780353|r  200 CEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQK  279 (753)
Q Consensus       200 ~~a~~~~i~~~~~~~~~l~~~i~gPDFPTGG~i~~~~~~i~~~y~tG~G~i~~r~k~~~e~~~~~~~~ivIteiPy~v~k  279 (753)
T Consensus       161 i~~~~~~l~~~~~~~---~~~~~~P~f~~f~g~i-~~~~~~~~y~tG~G~~~~rg~~~i~~----~~~i~ITELP~g~~t  232 (428)
T pfam00521       161 IDALIALLDGPEITL---LLKIPGPDFPTGGGII-GSGGIREAYKTGRGKITVRAKIEIEE----RKTIVITELPYGVWT  232 (428)
T ss_pred             HHHHHHHHCCCCCCC---CCCCCCCCCCCCCEEE-CCCCHHHHHHCCCCEEEEEEEEEEEC----CCEEEEEECCCCCCH
T ss_conf             999999853997223---5757899799986245-66116777643883599987999940----526999944777789


Q ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHCCCCCEEEEEEEECCCCCHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCCCCCHHH
Q ss_conf             89999999986402221345776406766058898504545889999987542000012233113331268972204999
Q gi|254780353|r  280 SRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDG  359 (753)
Q Consensus       280 ~~~ie~I~~lv~~~ki~gi~dirDeSd~~~~~vi~~~~r~~~~~~vl~~Lyk~T~Lq~sf~~N~~~l~~~~~P~~~~l~e  359 (753)
T Consensus       233 ~~~~e~l~~l~~~~ki~~-~di~D~Sd~~vr~vI~lk-~~~~~~~~~~~L~k~~kL~~s~s~nnm~l~d~-~pk~~s~~e  309 (428)
T pfam00521       233 EKLIESIEELVKNGKIKG-SDIRDESDRGVRIVIELK-RGADPEVVLNKLYKKTKLQSSFSTNNLVLFDG-GPKYLNLKE  309 (428)
T ss_pred             HHHHHHHHHHHHCCCCCC-CCCCCCCCCCEEEEEEEC-CCCCHHHHHHHHHHHHHHHEECCCEEEEEECC-CCCHHHHHH
T ss_conf             999999999984588787-731016788567999857-87656789999998630010046379999679-873742999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             99989999899999999999999999999999999864107899997520000---110000002577577889988789
Q gi|254780353|r  360 ILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDK---PKPVMVSRFSLTENQVDAILNLRL  436 (753)
Q Consensus       360 il~~f~~~R~~vi~rr~~~~L~k~~~RlhIleGl~~a~~~ID~vI~iIR~s~~---~k~~L~~~f~lse~QA~aIL~mrL  436 (753)
T Consensus       310 IL~~f~~~R~~~y~kR~~~~l~kl~~~l~iL~gl~~~~~~idfIi~iI~~s~~~~~~k~~L~~--~L~~~q~dyLL~m~L  387 (428)
T pfam00521       310 ILKEFLEHRLEVYKRRKEYLLEKLEERLHILEGLLKALNKIDFVIEVIRGSIDLNKAKKELIE--ELSEIQADYLLDMRL  387 (428)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH--HCCHHHHHHHHHHHH
T ss_conf             999999999999999999999999999999988999998499999999768961689999999--748998999997689


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHH
Q ss_conf             9998899997666789999887765442039788789
Q gi|254780353|r  437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWN  473 (753)
Q Consensus       437 ~rLt~le~~kl~~E~~eL~~~i~~L~~IL~s~~~l~~  473 (753)
T Consensus       388 ~~LT~~e~~kL~~e~~~l~~ei~~l~~~l~s~~~lw~  424 (428)
T pfam00521       388 RRLTKEEIEKLEKEIEELEKEIAELEKILASEKKLWI  424 (428)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHH
T ss_conf             9872889999999999999999999977389999988