HHsearch results for GI: 254780353 and protein with PDBid: 1wp5_A

>1wp5_A Topoisomerase IV; broken beta-propeller, hairpin-invaded beta-propeller, six- bladed beta-propeller; 1.79A {Geobacillus stearothermophilus} SCOP: b.68.10.1
Probab=100.00  E-value=0  Score=377.41  Aligned_cols=239  Identities=18%  Similarity=0.215  Sum_probs=215.0

Q ss_pred             CCCCCCCEEEEECCCEEECCCCCCC---CCCCCCCCCCCCCEEEEEECCCCCEEEEECCCEEEEEEHHHCCCC--CCCCC
Q ss_conf             2456670599871010202565544---553223455555401211114781789806882787551121212--34444
Q gi|254780353|r  514 MIEKEPITVVISNRGWIRSLKSHSV---DLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSG--RGHGE  588 (753)
Q Consensus       514 lI~~E~v~V~LS~~GyIKr~k~~~~---~~~~~~~KegD~l~~~~~~~t~d~LLffTs~GkvY~l~a~~Ips~--~~kG~  588 (753)
                      ||++|+|+|++|++|||||++..++   +..+..+|++|++.+++.|+|||+||||||.||+|++++|+||.+  +++|.
T Consensus         1 LI~~E~vvV~lS~~GyIKr~~~~~~~~~~~~~~~~k~~D~v~~~~~~~t~d~ll~fT~~Grvy~i~v~eiP~~~~~~~G~   80 (323)
T 1wp5_A            1 MVASEDVIVTVTKDGYVKRTSLRSYAASNGQDFAMKDTDRLLAMLEMNTKDVLLLFTNKGNYLYCPVHELPDIRWKDLGQ   80 (323)
T ss_dssp             CCSCCEEEEEEETTCEEEEEEHHHHHHTTTCCCCCCTTCCEEEEEEEETTSEEEEEETTSEEEEEEGGGSCBCCTTSCCE
T ss_pred             CCCCCCEEEEEECCCEEEEEEHHHHCCCCCCCCCCCCCCEEEEEEEECCCCEEEEEECCCEEEEEEEEECCCCCCCCCCC
T ss_conf             98888789999379858980679931147887865788438999998589879999389879999905287753335783


Q ss_pred             CCCCCCCCCCCCEEEEEEEEC---CCCEEEEEECCCCEEEEEHHHHHCCCC-CCEEEEEECCCCCEEEEEECCC-CEEEE
Q ss_conf             222235767653078999857---998599997489789963887402333-5627885368980568896189-80999
Q gi|254780353|r  589 AIQLLIDLNHNQDIVTAFVYD---STCKLLVVSSKGNAFIVEESEIIANTR-KGKTFLKVSSEEKMKLVVKVTG-DHVAV  663 (753)
Q Consensus       589 pI~~ll~l~~~EkIv~~~~~~---~~~~lll~Tk~G~ikr~~l~~~~~~~k-~Gk~~ikLk~~D~li~v~~~~~-d~iil  663 (753)
                      ||.++++++++|+|+++++.+   ++.+++|+|++|++||+++++|.++++ +|+.+++|+++|+++++..+.+ +++++
T Consensus        81 ~i~nll~l~~~e~ii~~~~~~~~~~~~~ll~~Tk~G~iKr~~l~e~~~~~~~~g~~~i~L~~~D~l~~v~~~~~~~~i~l  160 (323)
T 1wp5_A           81 HIANIIPIDRDEEIIKAIPINDFELNGYFLFVTRNGMVKKTELKHYKAQRYSKPLTGINLKNDDQVVDVHLTDGMNELFL  160 (323)
T ss_dssp             EGGGTSCCCTTCCEEEEEEESCTTSSCEEEEEETTSEEEEEEGGGGCCSCCSSCEECSCCCTTCCEEEEEEECSCSEEEE
T ss_pred             CCCCCCCCCCCCCEEEECCCCCCCCCCEEEEEECCCCEEEEEHHHHCCCCCCCHHEEEECCCCCCCCCEEECCCCEEEEE
T ss_conf             12122566667635650344545567469999888823386556610112333000243366555551684389848997


Q ss_pred             EECCCCEEEEEHHHCCCCCH-HHCCEEEECCCCCEEEEEEEECCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCCCCCC
Q ss_conf             95699389955787783361-21413342187875689997338883699941775664511432254441366602755
Q gi|254780353|r  664 VGENRKLLIFSIDQIPEMSR-GKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPK  742 (753)
Q Consensus       664 iT~~Gk~LrF~~~eIr~~gR-gkGVk~i~Lkd~~~~~~~~~~~~e~~~il~~t~~g~~k~~~~~~~~~~~RggkG~~~~k  742 (753)
                      +|++|++|||++++||+||| ++||++|+|++++.+..+++..+++..++..+++|++|+++..+|+.++||++|+++++
T Consensus       161 ~t~~G~~lrf~~~~vr~~gr~a~GVk~i~L~~~D~vv~~~~v~~~~~~ll~iT~~G~gKr~~~~e~~~~~Rg~kGv~~~k  240 (323)
T 1wp5_A          161 VTHNGYALWFDESEVSIVGVRAAGVKGMNLKEGDYIVSGQLITSKDESIVVATQRGAVKKMKLTEFEKATRAKRGVVILR  240 (323)
T ss_dssp             EETTSEEEEEEGGGSCBCCSSCCCEECCCCCTTCCEEEEEEECCTTCEEEEEETTSEEEEEEGGGSCCCCTTSCCEECSC
T ss_pred             EECCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCCEEEEEECCCCEEECCHHHHHHCCCCCCCEEEEC
T ss_conf             40498289703454234687656730202478988999999960572699985088147511456331155788706101


Q ss_pred             CCCCCCCEEC
Q ss_conf             2677686104
Q gi|254780353|r  743 GFPRSGKFLS  752 (753)
Q Consensus       743 ~~~K~gklV~  752 (753)
                      .++++|.+|+
T Consensus       241 ~~k~~~~~v~  250 (323)
T 1wp5_A          241 ELKANPHRIS  250 (323)
T ss_dssp             CCSSSCCCEE
T ss_pred             CCCCCCCEEE
T ss_conf             3356782488