HHsearch results for GI: 254780353 and protein with PDBid: 3l6v_A

>3l6v_A GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, GYRA C-terminal domain, DNA wrapping, beta-strand-bearing proline, ATP-binding; HET: DNA; 2.19A {Xanthomonas campestris PV}
Probab=99.89  E-value=4.9e-21  Score=176.11  Aligned_cols=183  Identities=17%  Similarity=0.250  Sum_probs=151.0

Q ss_pred             CCCCEEEEECCCEEECCCCCCC------CCCCCCCCCCCCCEEEEEECCCCCEEEEECCCEEEEEEHHHCCCC--CCCCC
Q ss_conf             6670599871010202565544------553223455555401211114781789806882787551121212--34444
Q gi|254780353|r  517 KEPITVVISNRGWIRSLKSHSV------DLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSG--RGHGE  588 (753)
Q Consensus       517 ~E~v~V~LS~~GyIKr~k~~~~------~~~~~~~KegD~l~~~~~~~t~d~LLffTs~GkvY~l~a~~Ips~--~~kG~  588 (753)
                      ++...+++|++|++|+.+...+      +...++++++|.+..+..+...+.++++|+.|++.+++..++|..  .++|.
T Consensus       112 ~~~~lv~~T~~G~iKr~~l~~f~~~~~~g~~aikLk~~Delv~v~~~~~~~~i~l~T~~G~~lrf~~~~v~~~gr~a~GV  191 (370)
T 3l6v_A          112 DNRYVFMATRNGTVKKTPLSEFAFRLARGKIAINLDEGDALVGVALTDGDRDVLLFASNGKTVRFGESTVRSMGRTATGV  191 (370)
T ss_dssp             TTCEEEEEETTSEEEEEEGGGGCSCCTTCEESSCCCTTCCEEEEEEECSCCEEEEEETTSEEEEEEGGGSCBCCTTCCCE
T ss_pred             CCCEEEEEECCCCEEECCHHHHHHCCCCCCEEEECCCCCEEEEEEEECCCEEEEEEECCCEEEEEEECEECCCCCCCCCE
T ss_conf             77669999789858966579941113354078984899879978974598139999316518998601132368765643


Q ss_pred             CCCCCCCCCCCCEEEEEEEEC-----------------------------------CCCEEEEEECCCCEEEEEHHHHHC
Q ss_conf             222235767653078999857-----------------------------------998599997489789963887402
Q gi|254780353|r  589 AIQLLIDLNHNQDIVTAFVYD-----------------------------------STCKLLVVSSKGNAFIVEESEIIA  633 (753)
Q Consensus       589 pI~~ll~l~~~EkIv~~~~~~-----------------------------------~~~~lll~Tk~G~ikr~~l~~~~~  633 (753)
                      .   .+.|.++++|+++...+                                   ++.+++++|++|++||+++++|..
T Consensus       192 k---~i~L~~~d~vv~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~vT~~G~~Kr~~~~e~~~  268 (370)
T 3l6v_A          192 R---GIRLAKGEEVVSLIVSERAGGVEDEVEDESAEEVVETTDGAEPAVIDVADNGDVAYILTATENGYGKRTPLAEYPR  268 (370)
T ss_dssp             E---CCCCCTTCCEEEEEEECCC-----------------------------------CEEEEEETTSEEEEEEGGGSCC
T ss_pred             E---EEEECCCCEEEEEEEECCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCEEECCHHHCCC
T ss_conf             6---6770899989998964155543211002200110013454431000001367850799971688427677776573


Q ss_pred             CCC--CCEEEEEEC-CCCCEEEEEECCC-CEEEEEECCCCEEEEEHHHCCCCCH-HHCCEEEECCCCCEEEEEE
Q ss_conf             333--562788536-8980568896189-8099995699389955787783361-2141334218787568999
Q gi|254780353|r  634 NTR--KGKTFLKVS-SEEKMKLVVKVTG-DHVAVVGENRKLLIFSIDQIPEMSR-GKGVRLQSYKDGGISDVIC  702 (753)
Q Consensus       634 ~~k--~Gk~~ikLk-~~D~li~v~~~~~-d~iiliT~~Gk~LrF~~~eIr~~gR-gkGVk~i~Lkd~~~~~~~~  702 (753)
                      ..|  +|..++++. .+|+++.+..+.. |+++++|+.|+++||+.++||.+|| ++||++|+|++++.+.++.
T Consensus       269 ~~Rg~~G~~~~k~~~~~d~lv~~~~v~~~d~ill~T~~G~~~r~~~~~I~~~gR~t~Gv~~i~L~~~d~v~sv~  342 (370)
T 3l6v_A          269 KGRGTQGVIGIQTTERNGKLVRAVLLGSTDEVMLISDGGTLVRTRGSEISRVGRNTQGVTLIRLSKGEKLQAVE  342 (370)
T ss_dssp             BCTTSCCEESSCCCTTTCSEEEEEEECTTCEEEEEETTCCEEEEEGGGSCBCCSSSCCEESSCCCTTCCEEEEE
T ss_pred             CCCCCCCEEEEEECCCCCEEEEEEEECCCCEEEEEECCCEEEEEEHHHCCCCCCCCCCEEEEECCCCCEEEEEE
T ss_conf             35886651666874787349999992699759999589989998934547678878984768889999999999