BLAST/PSIBLAST alignment of GI: 254780353 and GI: 327192117 at iteration 1
>gi|327192117|gb|EGE59094.1| DNA topoisomerase IV protein, subunit A [Rhizobium etli CNPAF512] Length = 751
 Score = 1026 bits (2653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/737 (64%), Positives = 618/737 (83%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           ++N++ V L+ ALE+RYLAYALSTI  RA+PD+RDG KPVHRRI++AM+EMGL   +AF+
Sbjct: 13  DDNIQPVDLKAALEQRYLAYALSTIMHRALPDVRDGLKPVHRRIVYAMNEMGLRPTSAFR 72

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K A+IVGEV+G  HPHGDQS+YD+L RLAQ F QRY L++GQGNFGNIDGDS AA RYTE
Sbjct: 73  KCAKIVGEVMGNYHPHGDQSIYDALARLAQDFSQRYTLVNGQGNFGNIDGDSPAAMRYTE 132

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ++MT V+EL+L+G+D+DAVDFRDTY+E +SEP+V P  FPNLLANG+SGIAVGMATSIPS
Sbjct: 133 SKMTAVSELLLEGIDQDAVDFRDTYDESNSEPIVLPGAFPNLLANGSSGIAVGMATSIPS 192

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN  E+C+AAL LI +P+ ++EKL+E+I GPDFPTGGII++SR+SI+ESYR GRGGFRVR
Sbjct: 193 HNAHELCDAALHLIKHPDATVEKLVEFIPGPDFPTGGIIIDSRDSIIESYRTGRGGFRVR 252

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           A+W  E++GRG + IVVTEIP+QVQKSRLIEKIAEL+IA+++PLLEDIRDESAED+RIVL
Sbjct: 253 AKWQTEDLGRGGYQIVVTEIPFQVQKSRLIEKIAELLIARKLPLLEDIRDESAEDIRIVL 312

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            PK+R++DP +LMES+F L+++E+RFPLNMNVLSMGR+P+VM L+ +LKEWL HRREVL 
Sbjct: 313 VPKSRTVDPTILMESMFKLTELESRFPLNMNVLSMGRIPKVMALNEVLKEWLDHRREVLQ 372

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS FR+ AID+R+EIL GLL+AYLNIDE+I IIR ED+PKPVM++R+ LT+NQV+AILN
Sbjct: 373 RRSRFRLAAIDKRLEILGGLLVAYLNIDEVIRIIREEDEPKPVMMARWDLTDNQVEAILN 432

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
           +RLR+LRKLEE++I+ E D L  EK +I++LL S  +QW  +A EI EVK+ F+K+T++G
Sbjct: 433 MRLRALRKLEEFEIRKEFDELTKEKGEIEALLASDDKQWQTVAWEIGEVKKKFAKATEVG 492

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
           RRRT F +   AD+  +QQAMIEKEPITVVIS +GWIR+LK H  D + L FKEGD LK+
Sbjct: 493 RRRTQFADAPEADEEAIQQAMIEKEPITVVISEKGWIRALKGHIADTATLTFKEGDGLKV 552

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
           A  A TTD+IL+++T GKA+TL    L  GRGHGE +++++D++++Q ++TAFV+D   K
Sbjct: 553 AFPAQTTDKILIVTTGGKAFTLGGDKLPGGRGHGEPLRIMVDMDNDQAVLTAFVHDPARK 612

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
            L+VS+ GN F+V E+E+IANTRKGK  + V+  E+ +L+V V+GDHVAVVGENRKLL+F
Sbjct: 613 QLIVSTAGNGFVVAEAELIANTRKGKQIMNVALPEETQLLVPVSGDHVAVVGENRKLLVF 672

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
            + Q+PEM+RGKGVRLQ YKDGGISDV CF + +GL W DSAGR++ +++++L  WLG R
Sbjct: 673 PLAQVPEMTRGKGVRLQRYKDGGISDVRCFAMSDGLVWEDSAGRTFTKNKDELAEWLGDR 732

Query: 734 GGVGSLVPKGFPRSGKF 750
              G  VPKGFPRSGKF
Sbjct: 733 ASAGRTVPKGFPRSGKF 749