BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780353|ref|YP_003064766.1| DNA topoisomerase IV subunit A
[Candidatus Liberibacter asiaticus str. psy62]
         (753 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780353|ref|YP_003064766.1| DNA topoisomerase IV subunit A [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040030|gb|ACT56826.1| DNA topoisomerase IV subunit A [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 753

 Score = 1537 bits (3980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 753/753 (100%), Positives = 753/753 (100%)

Query: 1   MGVDNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHA 60
           MGVDNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHA
Sbjct: 1   MGVDNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHA 60

Query: 61  MSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGN 120
           MSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGN
Sbjct: 61  MSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGN 120

Query: 121 IDGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGT 180
           IDGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGT
Sbjct: 121 IDGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGT 180

Query: 181 SGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIV 240
           SGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIV
Sbjct: 181 SGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIV 240

Query: 241 ESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLED 300
           ESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLED
Sbjct: 241 ESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLED 300

Query: 301 IRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGI 360
           IRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGI
Sbjct: 301 IRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGI 360

Query: 361 LKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSR 420
           LKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSR
Sbjct: 361 LKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSR 420

Query: 421 FSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIR 480
           FSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIR
Sbjct: 421 FSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIR 480

Query: 481 EVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDL 540
           EVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDL
Sbjct: 481 EVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDL 540

Query: 541 SALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQ 600
           SALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQ
Sbjct: 541 SALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQ 600

Query: 601 DIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH 660
           DIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH
Sbjct: 601 DIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH 660

Query: 661 VAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYN 720
           VAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYN
Sbjct: 661 VAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYN 720

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPRSGKFLSS 753
           RSENDLLGWLGKRGGVGSLVPKGFPRSGKFLSS
Sbjct: 721 RSENDLLGWLGKRGGVGSLVPKGFPRSGKFLSS 753


>gi|315122223|ref|YP_004062712.1| DNA topoisomerase IV subunit A [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495625|gb|ADR52224.1| DNA topoisomerase IV subunit A [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 753

 Score = 1335 bits (3456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 642/752 (85%), Positives = 695/752 (92%)

Query: 1   MGVDNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHA 60
           MG D   NS+ LVEEN  +VSL+ ALEERYLAYALSTIKERAIPD RDGFKPVHRRIIHA
Sbjct: 1   MGSDKTPNSDDLVEENFNSVSLKSALEERYLAYALSTIKERAIPDSRDGFKPVHRRIIHA 60

Query: 61  MSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGN 120
           MSEMGLDF AAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQ FVQRYPLI GQGNFGN
Sbjct: 61  MSEMGLDFNAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQSFVQRYPLIRGQGNFGN 120

Query: 121 IDGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGT 180
           IDGDSAAAYRYTEARMTQVA+LILQGVDE+AVDFRDTYNEEDSEPVVFP KFPNLLANG+
Sbjct: 121 IDGDSAAAYRYTEARMTQVADLILQGVDENAVDFRDTYNEEDSEPVVFPGKFPNLLANGS 180

Query: 181 SGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIV 240
           SGIAVGMATSIPSHNV+EICEAAL LI++PE S+EKLLE+IIGPDFPTGGIIVESRESI 
Sbjct: 181 SGIAVGMATSIPSHNVEEICEAALILINDPESSLEKLLEHIIGPDFPTGGIIVESRESIF 240

Query: 241 ESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLED 300
           ESYR GRGGFRVRA+WCVE++GRGSWCIVV+EIPYQVQKSRLIEKIA+LI+ KRIPLLED
Sbjct: 241 ESYRSGRGGFRVRAKWCVEDLGRGSWCIVVSEIPYQVQKSRLIEKIADLIMTKRIPLLED 300

Query: 301 IRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGI 360
           IRDESAED+RIVLFPKNRS+DPDLLMES+F+LSD+ETRFPLNMNVLSMGRVPQVM LDG+
Sbjct: 301 IRDESAEDIRIVLFPKNRSVDPDLLMESMFVLSDLETRFPLNMNVLSMGRVPQVMSLDGV 360

Query: 361 LKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSR 420
           LKEWL HRREVL RRSSFRMQAIDRRVE+LKGL IAYLNIDEIIAIIRNEDKPK VM+SR
Sbjct: 361 LKEWLVHRREVLLRRSSFRMQAIDRRVEVLKGLSIAYLNIDEIIAIIRNEDKPKSVMISR 420

Query: 421 FSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIR 480
           FSLTENQ DAILNLRLRSLRKLEEYQIKSELDNLL EK+ ++ LLNS K+QW+QIACEIR
Sbjct: 421 FSLTENQADAILNLRLRSLRKLEEYQIKSELDNLLLEKDNLNLLLNSEKKQWDQIACEIR 480

Query: 481 EVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDL 540
           EVKEIFSKSTDLGRRRT FCE  + DK  +QQAMIEKEP+TVVIS RGWIRSLK HS+DL
Sbjct: 481 EVKEIFSKSTDLGRRRTVFCEALKTDKVAVQQAMIEKEPVTVVISKRGWIRSLKGHSIDL 540

Query: 541 SALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQ 600
           SAL+FKEGD LKIA HA+TT+RILL STDG+AYTLP GNLLSGRGHGEAIQLLID+NHNQ
Sbjct: 541 SALNFKEGDGLKIAFHAYTTERILLFSTDGRAYTLPVGNLLSGRGHGEAIQLLIDINHNQ 600

Query: 601 DIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH 660
           DI+ AFV D TCKLL VS+KGNAFIV+ES+II NTRKGK F KVSS + MKLVVKV GD+
Sbjct: 601 DIMAAFVQDPTCKLLFVSNKGNAFIVQESQIIPNTRKGKQFFKVSSGDSMKLVVKVIGDN 660

Query: 661 VAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYN 720
           VAVVGENRKLLIF IDQIPEM+RGKGVRLQSYKDGG+SDV+CF I EGLTW+DSAGRS+N
Sbjct: 661 VAVVGENRKLLIFPIDQIPEMNRGKGVRLQSYKDGGVSDVVCFNISEGLTWVDSAGRSFN 720

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPRSGKFLS 752
           RS++DL+ WLGKRGG GSLVPKGFPRSG F S
Sbjct: 721 RSKDDLIRWLGKRGGAGSLVPKGFPRSGNFFS 752


>gi|116251375|ref|YP_767213.1| DNA topoisomerase IV subunit A [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115256023|emb|CAK07104.1| putative topoisomerase IV subunit [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 751

 Score = 1043 bits (2696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/737 (65%), Positives = 618/737 (83%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           +++++ V L+ ALE+RYLAYALSTI  RA+PD+RDG KPVHRRI++AM+EMGL   +AF+
Sbjct: 13  DDHIQPVDLKAALEQRYLAYALSTIMHRALPDVRDGLKPVHRRIVYAMNEMGLRPNSAFR 72

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K A+IVGEV+G  HPHGDQS+YD+L RLAQ F QRY L++GQGNFGNIDGDS AA RYTE
Sbjct: 73  KCAKIVGEVMGNYHPHGDQSIYDALARLAQDFSQRYTLVNGQGNFGNIDGDSPAAMRYTE 132

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ++MT V+EL+L+G+D+DAVDFRDTY+E +SEPVV P  FPNLLANG+SGIAVGMATSIPS
Sbjct: 133 SKMTAVSELLLEGIDQDAVDFRDTYDESNSEPVVLPGAFPNLLANGSSGIAVGMATSIPS 192

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN  E+C+AAL LI +P+ ++EKL+E+I GPDFPTGGII+++RESI+ESYR GRGGFRVR
Sbjct: 193 HNAHELCDAALHLIKHPDATVEKLVEFIPGPDFPTGGIIIDNRESIIESYRTGRGGFRVR 252

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           A+W  E++GRG + IV+TEIP+QVQKSRLIEKIAEL+IA+++PLLEDIRDESAED+R+VL
Sbjct: 253 AKWQTEDLGRGGYQIVITEIPFQVQKSRLIEKIAELLIARKLPLLEDIRDESAEDIRVVL 312

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            PK RS+DP +LMES+F L+++E+RFPLNMNVLSMGR+P+VM L+ +LKEWL HRREVL 
Sbjct: 313 VPKTRSVDPTILMESMFKLTELESRFPLNMNVLSMGRIPRVMALNEVLKEWLDHRREVLQ 372

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS FR+ AIDRR+EIL GLL+AYLNIDE+I IIR ED+PKPVM++R+ LT+NQV+AILN
Sbjct: 373 RRSRFRLAAIDRRLEILSGLLVAYLNIDEVIRIIREEDEPKPVMMARWDLTDNQVEAILN 432

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
           +RLR+LRKLEE++I+ E D L  EK +I++LL+S  +QW  +A EI EVK+ F+K+T++G
Sbjct: 433 MRLRALRKLEEFEIRKEFDELTKEKGEIEALLSSDDKQWQTVAWEIGEVKKKFAKATEVG 492

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
           RRRT F +    D+  +QQAMIEKEPITVVIS +GWIR+LK H  D +AL FKEGD LKI
Sbjct: 493 RRRTQFADAPETDEEAIQQAMIEKEPITVVISEKGWIRALKGHIADTAALTFKEGDGLKI 552

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
           A  A TTD+IL+++T GKA+TL    L  GRGHGE +++++D++++Q ++TAFV+D + K
Sbjct: 553 AFPAQTTDKILIVTTGGKAFTLGGDKLPGGRGHGEPLRIIVDMDNDQAVLTAFVHDPSRK 612

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
            L+VS+ GN F+V E+E++ANTRKGK  + V   E+ +L+V V+GDHVAVVGENRKLL+F
Sbjct: 613 QLIVSTAGNGFVVPEAELVANTRKGKQIMNVGLPEETQLLVPVSGDHVAVVGENRKLLVF 672

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
            + Q+PEMSRGKGVRLQ YKDGGISDV CF I +GL W DSAGR++ +S+++L+ WL  R
Sbjct: 673 PLAQVPEMSRGKGVRLQRYKDGGISDVRCFAISDGLVWEDSAGRTFTKSKDELVEWLADR 732

Query: 734 GGVGSLVPKGFPRSGKF 750
              G  VPKGFPRSGKF
Sbjct: 733 ATAGRTVPKGFPRSGKF 749


>gi|150396031|ref|YP_001326498.1| DNA topoisomerase IV subunit A [Sinorhizobium medicae WSM419]
 gi|150027546|gb|ABR59663.1| DNA topoisomerase IV, A subunit [Sinorhizobium medicae WSM419]
          Length = 758

 Score = 1042 bits (2695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/745 (66%), Positives = 611/745 (82%), Gaps = 8/745 (1%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           ++N++ V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRIIHAMSEMGL   ++FK
Sbjct: 12  DDNIQPVDLKAALEERYLAYALSTIMHRALPDVRDGLKPVHRRIIHAMSEMGLRPNSSFK 71

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+VIGK HPHGDQSVYD+LVRLAQ F QRYP++ GQGNFGNIDGD+AAAYRYTE
Sbjct: 72  KCARIVGDVIGKFHPHGDQSVYDALVRLAQDFSQRYPVVDGQGNFGNIDGDNAAAYRYTE 131

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           A+MT+VA L+L+G+D+DAVDFR TYNEED EP V P  FPNLLANG SGIAVGMATSIP 
Sbjct: 132 AKMTEVAALLLEGIDQDAVDFRPTYNEEDQEPTVLPGAFPNLLANGASGIAVGMATSIPP 191

Query: 194 HNVQEICEAALALIDNPEISIEKLL--------EYIIGPDFPTGGIIVESRESIVESYRL 245
           HN  E+C+AAL LI +P+  +E LL          I GPDFPTGG+IVESR S++ESYR 
Sbjct: 192 HNAHELCDAALYLIRHPDAPLEALLFDPANPQRGGIEGPDFPTGGVIVESRTSMMESYRT 251

Query: 246 GRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDES 305
           GRGGFRVRARW VE++GRG + IVVTEIPYQVQKSRLIEKIAEL+IA+++PLLEDIRDES
Sbjct: 252 GRGGFRVRARWTVEDLGRGGFQIVVTEIPYQVQKSRLIEKIAELLIARKLPLLEDIRDES 311

Query: 306 AEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWL 365
           AEDVR+VL PK+RS+D ++LMES+F L+++E+R PLNMNVLSMGRVP+VM L+ +L EWL
Sbjct: 312 AEDVRVVLVPKSRSVDANILMESLFKLTELESRIPLNMNVLSMGRVPRVMALNEVLSEWL 371

Query: 366 AHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTE 425
           AHRREVL RRS  R+ AIDRR+EIL G LIAYLNIDE+I IIR ED+PK VM+ RF LT+
Sbjct: 372 AHRREVLQRRSRHRLAAIDRRLEILGGYLIAYLNIDEVIRIIREEDEPKAVMIERFGLTD 431

Query: 426 NQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEI 485
            Q +AILN+RLRSLRKLEE++I++E D L  EK +I++LL S  +QW  +A EI EVK+ 
Sbjct: 432 VQAEAILNMRLRSLRKLEEFEIRTEFDALSKEKAEIEALLASDDKQWQAVAWEIGEVKKK 491

Query: 486 FSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHF 545
           F+K+T+LG+RR+TF +   AD   +QQAMIEKEPITVVIS +GWIR+LK H  D ++L F
Sbjct: 492 FAKATELGKRRSTFADAPEADVEAIQQAMIEKEPITVVISEKGWIRALKGHIADTTSLQF 551

Query: 546 KEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTA 605
           K+GD+LK++  A TTD+IL+ +T GK YTL +  L  GRGHGE +++++D+ ++QD++TA
Sbjct: 552 KDGDALKVSFPAQTTDKILIFTTGGKVYTLGSDKLPGGRGHGEPLRIMVDMENDQDVLTA 611

Query: 606 FVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVG 665
           FV+D   KL+V S+ GN F+V ES+I+ANTRKGK  + VS  ++ KLVV V GDH+AVVG
Sbjct: 612 FVHDPARKLVVSSTAGNGFVVTESDIVANTRKGKQVMNVSMPDEAKLVVPVKGDHLAVVG 671

Query: 666 ENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSEND 725
           ENRK+L+F + Q+PEM+RGKGVRLQ YKDGGISD+ CF I EGLTW DSAGR + +++++
Sbjct: 672 ENRKMLVFPLAQVPEMARGKGVRLQRYKDGGISDIRCFSIAEGLTWEDSAGRVFTKTKDE 731

Query: 726 LLGWLGKRGGVGSLVPKGFPRSGKF 750
           LL W+G R G G +VPKGFPRSGKF
Sbjct: 732 LLEWMGDRAGAGRVVPKGFPRSGKF 756


>gi|15964952|ref|NP_385305.1| DNA topoisomerase IV subunit A [Sinorhizobium meliloti 1021]
 gi|307301023|ref|ZP_07580792.1| DNA topoisomerase IV, A subunit [Sinorhizobium meliloti BL225C]
 gi|7387990|sp|Q59749|PARC_RHIME RecName: Full=DNA topoisomerase 4 subunit A; AltName:
           Full=Topoisomerase IV subunit A
 gi|15074131|emb|CAC45778.1| Probable topoisomerase IV subunit A [Sinorhizobium meliloti 1021]
 gi|306903978|gb|EFN34564.1| DNA topoisomerase IV, A subunit [Sinorhizobium meliloti BL225C]
          Length = 758

 Score = 1041 bits (2693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/745 (65%), Positives = 610/745 (81%), Gaps = 8/745 (1%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           ++N++ V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRIIHAMSEMGL   ++FK
Sbjct: 12  DDNIQPVDLKAALEERYLAYALSTIMHRALPDVRDGLKPVHRRIIHAMSEMGLRPNSSFK 71

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+VIGK HPHGDQSVYD+LVRLAQ F QRYP++ GQGNFGNIDGD+AAAYRYTE
Sbjct: 72  KCARIVGDVIGKFHPHGDQSVYDALVRLAQDFSQRYPVVDGQGNFGNIDGDNAAAYRYTE 131

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           A+MT+VA L+L+G+D+DAVDFR TYNEED EP V P  FPNLLANG SGIAVGMATSIP 
Sbjct: 132 AKMTEVAALLLEGIDQDAVDFRPTYNEEDQEPTVLPGAFPNLLANGASGIAVGMATSIPP 191

Query: 194 HNVQEICEAALALIDNPEISIEKLL--------EYIIGPDFPTGGIIVESRESIVESYRL 245
           HN  E+C+AAL LI +P+ ++E LL          I GPDFPTGG+IVESR S+ ESYR 
Sbjct: 192 HNAHELCDAALHLIKHPDATVEDLLFDPANPQRGGIEGPDFPTGGVIVESRASMAESYRT 251

Query: 246 GRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDES 305
           GRGGFRVRARW VE++GRG + IVVTEIPYQVQKSRLIEKIAEL+IA+++PLLEDIRDES
Sbjct: 252 GRGGFRVRARWAVEDLGRGGFQIVVTEIPYQVQKSRLIEKIAELLIARKLPLLEDIRDES 311

Query: 306 AEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWL 365
           AEDVR+VL PK+RS+D ++LMES+F L+++E+R PLNMNVLSMGRVP+VM L+ +L EWL
Sbjct: 312 AEDVRVVLVPKSRSVDANILMESLFKLTELESRIPLNMNVLSMGRVPRVMALNEVLSEWL 371

Query: 366 AHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTE 425
           AHRREVL RRS  R+ AIDRR+EIL G LIAYLNIDE+I IIR ED+PK VM+ RF LT+
Sbjct: 372 AHRREVLQRRSRHRLAAIDRRLEILGGYLIAYLNIDEVIRIIREEDEPKAVMIERFGLTD 431

Query: 426 NQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEI 485
            Q +AILN+RLRSLRKLEE++I++E D+L  EK +I++LL SG +QW  +A EI EVK+ 
Sbjct: 432 VQAEAILNMRLRSLRKLEEFEIRTEFDSLSKEKAEIEALLASGDKQWQAVAWEIGEVKKK 491

Query: 486 FSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHF 545
           F+K+T+LG+RR+TF +   AD   +QQAMIEKEPITVVIS +GWIR+LK H  D S+L F
Sbjct: 492 FAKATELGKRRSTFSDAPDADVEAIQQAMIEKEPITVVISEKGWIRALKGHIADTSSLQF 551

Query: 546 KEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTA 605
           K+GD LK++  A TTD+IL+ +T GKAYTL    L  GRGHGE +++++D+ ++QD++TA
Sbjct: 552 KDGDGLKVSFPAQTTDKILIFTTGGKAYTLGGDKLPGGRGHGEPLRIMVDMENDQDVLTA 611

Query: 606 FVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVG 665
           FV+D   KL+V S+ GN F+V ES+I+ANTRKGK  + V+  ++ KLVV V GDH+AVVG
Sbjct: 612 FVHDPARKLIVSSTAGNGFVVTESDIVANTRKGKQVMNVTMPDEAKLVVPVKGDHLAVVG 671

Query: 666 ENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSEND 725
           ENRK+L+F + Q+PEM+RGKGVRLQ YKDGG+SD+  F I EGLTW DSAGR + ++ ++
Sbjct: 672 ENRKMLVFPLVQVPEMARGKGVRLQRYKDGGVSDIRSFAIAEGLTWEDSAGRVFTKTRDE 731

Query: 726 LLGWLGKRGGVGSLVPKGFPRSGKF 750
           L+ W+G R G G +VPKGFPRSGKF
Sbjct: 732 LIEWMGDRAGAGRVVPKGFPRSGKF 756


>gi|307317757|ref|ZP_07597195.1| DNA topoisomerase IV, A subunit [Sinorhizobium meliloti AK83]
 gi|306896519|gb|EFN27267.1| DNA topoisomerase IV, A subunit [Sinorhizobium meliloti AK83]
          Length = 758

 Score = 1041 bits (2692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/745 (65%), Positives = 610/745 (81%), Gaps = 8/745 (1%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           ++N++ V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRIIHAMSEMGL   ++FK
Sbjct: 12  DDNIQPVDLKAALEERYLAYALSTIMHRALPDVRDGLKPVHRRIIHAMSEMGLRPNSSFK 71

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+VIGK HPHGDQSVYD+LVRLAQ F QRYP++ GQGNFGNIDGD+AAAYRYTE
Sbjct: 72  KCARIVGDVIGKFHPHGDQSVYDALVRLAQDFSQRYPVVDGQGNFGNIDGDNAAAYRYTE 131

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           A+MT+VA L+L+G+D+DAVDFR TYNEED EP V P  FPNLLANG SGIAVGMATSIP 
Sbjct: 132 AKMTEVAALLLEGIDQDAVDFRPTYNEEDQEPTVLPGAFPNLLANGASGIAVGMATSIPP 191

Query: 194 HNVQEICEAALALIDNPEISIEKLL--------EYIIGPDFPTGGIIVESRESIVESYRL 245
           HN  E+C+AAL LI +P+ ++E LL          I GPDFPTGG+IVESR S+ ESYR 
Sbjct: 192 HNAHELCDAALHLIKHPDATVEDLLFDPANPRRGGIEGPDFPTGGVIVESRASMAESYRT 251

Query: 246 GRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDES 305
           GRGGFRVRARW VE++GRG + IVVTEIPYQVQKSRLIEKIAEL+IA+++PLLEDIRDES
Sbjct: 252 GRGGFRVRARWAVEDLGRGGFQIVVTEIPYQVQKSRLIEKIAELLIARKLPLLEDIRDES 311

Query: 306 AEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWL 365
           AEDVR+VL PK+RS+D ++LMES+F L+++E+R PLNMNVLSMGRVP+VM L+ +L EWL
Sbjct: 312 AEDVRVVLVPKSRSVDANILMESLFKLTELESRIPLNMNVLSMGRVPRVMALNEVLSEWL 371

Query: 366 AHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTE 425
           AHRREVL RRS  R+ AIDRR+EIL G LIAYLNIDE+I IIR ED+PK VM+ RF LT+
Sbjct: 372 AHRREVLQRRSRHRLAAIDRRLEILGGYLIAYLNIDEVIRIIREEDEPKAVMIERFGLTD 431

Query: 426 NQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEI 485
            Q +AILN+RLRSLRKLEE++I++E D+L  EK +I++LL SG +QW  +A EI EVK+ 
Sbjct: 432 VQAEAILNMRLRSLRKLEEFEIRTEFDSLSKEKAEIEALLASGDKQWQAVAWEIGEVKKK 491

Query: 486 FSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHF 545
           F+K+T+LG+RR+TF +   AD   +QQAMIEKEPITVVIS +GWIR+LK H  D S+L F
Sbjct: 492 FAKATELGKRRSTFSDAPDADVEAIQQAMIEKEPITVVISEKGWIRALKGHIADTSSLQF 551

Query: 546 KEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTA 605
           K+GD LK++  A TTD+IL+ +T GKAYTL    L  GRGHGE +++++D+ ++QD++TA
Sbjct: 552 KDGDGLKVSFPAQTTDKILIFTTGGKAYTLGGDKLPGGRGHGEPLRIMVDMENDQDVLTA 611

Query: 606 FVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVG 665
           FV+D   KL+V S+ GN F+V ES+I+ANTRKGK  + V+  ++ KLVV V GDH+AVVG
Sbjct: 612 FVHDPARKLIVSSTAGNGFVVTESDIVANTRKGKQVMNVTMPDEAKLVVPVKGDHLAVVG 671

Query: 666 ENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSEND 725
           ENRK+L+F + Q+PEM+RGKGVRLQ YKDGG+SD+  F I EGLTW DSAGR + ++ ++
Sbjct: 672 ENRKMLVFPLVQVPEMARGKGVRLQRYKDGGVSDIRSFAIAEGLTWEDSAGRVFTKTRDE 731

Query: 726 LLGWLGKRGGVGSLVPKGFPRSGKF 750
           L+ W+G R G G +VPKGFPRSGKF
Sbjct: 732 LIEWMGDRAGAGRVVPKGFPRSGKF 756


>gi|227821521|ref|YP_002825491.1| DNA topoisomerase IV subunit A [Sinorhizobium fredii NGR234]
 gi|227340520|gb|ACP24738.1| DNA topoisomerase IV subunit A [Sinorhizobium fredii NGR234]
          Length = 753

 Score = 1035 bits (2676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/745 (65%), Positives = 608/745 (81%), Gaps = 8/745 (1%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           ++N++ V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRIIHAMSEMGL   ++FK
Sbjct: 7   DDNIQPVDLKAALEERYLAYALSTIMHRALPDVRDGLKPVHRRIIHAMSEMGLRPNSSFK 66

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+VIGK HPHGDQSVYD+LVRLAQ F QRYP++ GQGNFGNIDGD+AAAYRYTE
Sbjct: 67  KCARIVGDVIGKFHPHGDQSVYDALVRLAQDFSQRYPVVDGQGNFGNIDGDNAAAYRYTE 126

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           A+MT+VA L+L+G+D+DAVDFR TYNEED EP V P  FPNLLANG SGIAVGMATSIP 
Sbjct: 127 AKMTEVAALLLEGIDQDAVDFRPTYNEEDEEPGVLPGAFPNLLANGASGIAVGMATSIPP 186

Query: 194 HNVQEICEAALALIDNPEISIEKLL--------EYIIGPDFPTGGIIVESRESIVESYRL 245
           HN  E+C+AAL LI +P+  +E LL          I GPDFPTGGIIVESR S++ESYR 
Sbjct: 187 HNAHELCDAALHLIRHPKAPLEDLLFDPANPQRGGIEGPDFPTGGIIVESRASMLESYRT 246

Query: 246 GRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDES 305
           GRGGFRVRARW VE++GRG + IVVTEIPYQVQKSRLIEKIAEL+IA+++PLLEDIRDES
Sbjct: 247 GRGGFRVRARWSVEDLGRGGYQIVVTEIPYQVQKSRLIEKIAELLIARKLPLLEDIRDES 306

Query: 306 AEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWL 365
           AEDVR+VL PK+RS+D ++LMES+F L+++E+R PLNMNVLSMGRVP+VM L+ +L EWL
Sbjct: 307 AEDVRVVLVPKSRSVDANILMESLFKLTELESRIPLNMNVLSMGRVPRVMALNEVLSEWL 366

Query: 366 AHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTE 425
           AHRREVL RRS  R+ AIDRR+EIL G L+AYLNIDE+I IIR ED+PK +M+ RF+LT+
Sbjct: 367 AHRREVLQRRSRHRLAAIDRRLEILGGYLVAYLNIDEVIRIIREEDEPKAMMIERFALTD 426

Query: 426 NQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEI 485
            Q +AILN+RLRSLRKLEE++I++E D L  EK +I++LL S  +QW  +A EI EVK+ 
Sbjct: 427 VQAEAILNMRLRSLRKLEEFEIRTEFDALSKEKAEIEALLASDDKQWQAVAWEIGEVKKK 486

Query: 486 FSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHF 545
           F+K+T+LG+RR+TF +   AD   +QQAMIEKEPITVVIS +GWIR+LK H  D SAL F
Sbjct: 487 FAKATELGKRRSTFADAPDADIEAIQQAMIEKEPITVVISEKGWIRALKGHISDTSALQF 546

Query: 546 KEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTA 605
           K+GD+LK+A  A TTD+IL+ +T GK YTL    L  GRGHGE +++++D+ ++QD++TA
Sbjct: 547 KDGDALKVAFPAQTTDKILVFTTGGKVYTLGGDKLPGGRGHGEPLRIMVDMENDQDVLTA 606

Query: 606 FVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVG 665
            V+D   KL+V S+ GN F+V ES+I+ANTRKGK  + V   ++ KLVV   GDHVAVVG
Sbjct: 607 LVHDPARKLIVSSAAGNGFVVTESDIVANTRKGKQVMNVVMPDEAKLVVPTKGDHVAVVG 666

Query: 666 ENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSEND 725
           +NRK+L+F + QIPEM+RGKGVRLQ YKDGGISD+ CF + EGLTW DSAGR + +++++
Sbjct: 667 DNRKMLVFPLAQIPEMARGKGVRLQRYKDGGISDIRCFTMAEGLTWEDSAGRVFTKTKDE 726

Query: 726 LLGWLGKRGGVGSLVPKGFPRSGKF 750
           L+ WLG R G G LVPKGFPRSG+F
Sbjct: 727 LVEWLGDRAGAGRLVPKGFPRSGRF 751


>gi|222148193|ref|YP_002549150.1| DNA topoisomerase IV subunit A [Agrobacterium vitis S4]
 gi|221735181|gb|ACM36144.1| DNA topoisomerase IV A subunit [Agrobacterium vitis S4]
          Length = 758

 Score = 1031 bits (2666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/744 (65%), Positives = 603/744 (81%), Gaps = 8/744 (1%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           +NV  + L++ALEERYLAYALSTI  RA+PD+RDG KPVHRRIIHAMSEMG+   +AFKK
Sbjct: 13  DNVTPIDLKYALEERYLAYALSTIMHRALPDVRDGLKPVHRRIIHAMSEMGIRPNSAFKK 72

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEA 134
            ARIVG+VIGK HPHGDQSVYD+LVRLAQ F QRYP++ GQGNFGNIDGDSAAAYRYTEA
Sbjct: 73  CARIVGDVIGKFHPHGDQSVYDALVRLAQDFSQRYPVVDGQGNFGNIDGDSAAAYRYTEA 132

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           RMT VA L+L+G+++DAVDFR TYNEED EPVV P  FPNLLANG SGIAVGMATSIP H
Sbjct: 133 RMTDVAGLLLEGIEQDAVDFRPTYNEEDDEPVVLPGAFPNLLANGASGIAVGMATSIPPH 192

Query: 195 NVQEICEAALALIDNPEISIEKLLE--------YIIGPDFPTGGIIVESRESIVESYRLG 246
           N  E+C+AAL LI N   S+E+L           I GPDFPTGGI++ESRES++E+YR G
Sbjct: 193 NAHELCDAALYLIKNRSASVEELFADPAHPQRGGIEGPDFPTGGIVIESRESMLETYRTG 252

Query: 247 RGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESA 306
           RGGFRVRA+W  E++GRG + IV+T+IP+QVQKSRLIEKIAEL+IAKR+PLLEDIRDESA
Sbjct: 253 RGGFRVRAKWETEDLGRGGYQIVITQIPFQVQKSRLIEKIAELLIAKRLPLLEDIRDESA 312

Query: 307 EDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLA 366
           EDVR+VL PK+R++DP +LMES+F LS++E+R PLNMNVLS G+VP+VM L+ +L EWL 
Sbjct: 313 EDVRVVLVPKSRTVDPTILMESLFKLSELESRIPLNMNVLSQGKVPKVMALNEVLLEWLD 372

Query: 367 HRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTEN 426
           HR++VL RRS FR+ AIDRR+EIL GLLIAYLN+DE+I IIR ED+ K  +++RF LT+N
Sbjct: 373 HRKDVLVRRSRFRLAAIDRRLEILGGLLIAYLNLDEVIRIIREEDEAKDALIARFELTDN 432

Query: 427 QVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIF 486
           Q +AILN+RLR+LRKLEE++I+ E D L  EK +I++LL S   QW  IA EI EVK+ +
Sbjct: 433 QAEAILNMRLRNLRKLEEFEIRKEHDALSKEKAEIETLLASDDLQWGTIASEIGEVKKKY 492

Query: 487 SKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFK 546
           +K+TD+GRRRT F     AD   +QQAMIEKEPITVVIS +GWIR+LK HS D  +L FK
Sbjct: 493 AKATDIGRRRTLFANAPDADVDAIQQAMIEKEPITVVISEKGWIRALKGHSYDKVSLTFK 552

Query: 547 EGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAF 606
           EGD L++A  A TTD+ILL++T GK YTL    L  GRGHGE I++++D+ ++QD++TAF
Sbjct: 553 EGDGLRVAFPAQTTDKILLVTTGGKVYTLGGDKLPGGRGHGEPIRIMVDMENDQDVLTAF 612

Query: 607 VYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGE 666
           V+D   KLL+ S+ GN FIV ES+I ANTRKGK  + V   ++ KLVV ++GDHVAVVGE
Sbjct: 613 VHDPARKLLIASTGGNGFIVAESDITANTRKGKQVMNVGMPDETKLVVPISGDHVAVVGE 672

Query: 667 NRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDL 726
           NRK+++F + Q+PEMSRGKGVRLQ YKDGG+SD+ CF + +GL+W DSAGRS+ RS+++L
Sbjct: 673 NRKMVVFPLAQVPEMSRGKGVRLQRYKDGGVSDIKCFTLADGLSWEDSAGRSFTRSKDEL 732

Query: 727 LGWLGKRGGVGSLVPKGFPRSGKF 750
           L WLG R G G  VPKGFPRSGKF
Sbjct: 733 LEWLGDRAGPGRTVPKGFPRSGKF 756


>gi|190891181|ref|YP_001977723.1| DNA topoisomerase IV protein, subunit A [Rhizobium etli CIAT 652]
 gi|190696460|gb|ACE90545.1| DNA topoisomerase IV protein, subunit A [Rhizobium etli CIAT 652]
          Length = 751

 Score = 1026 bits (2653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/737 (65%), Positives = 618/737 (83%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           ++N++ V L+ ALE+RYLAYALSTI  RA+PD+RDG KPVHRRI++AM+EMGL   +AF+
Sbjct: 13  DDNIQPVDLKAALEQRYLAYALSTIMHRALPDVRDGLKPVHRRIVYAMNEMGLRPTSAFR 72

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K A+IVGEV+G  HPHGDQS+YD+L RLAQ F QRY L++GQGNFGNIDGDS AA RYTE
Sbjct: 73  KCAKIVGEVMGNYHPHGDQSIYDALARLAQDFSQRYTLVNGQGNFGNIDGDSPAAMRYTE 132

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ++MT V+EL+L+G+D+DAVDFRDTY+E +SEP+V P  FPNLLANG+SGIAVGMATSIPS
Sbjct: 133 SKMTAVSELLLEGIDQDAVDFRDTYDESNSEPIVLPGAFPNLLANGSSGIAVGMATSIPS 192

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN  E+C+AAL LI +P+ ++EKL+E+I GPDFPTGGII++SR+SI+ESYR GRGGFRVR
Sbjct: 193 HNAHELCDAALHLIKHPDATVEKLVEFIPGPDFPTGGIIIDSRDSIIESYRTGRGGFRVR 252

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           A+W  E++GRG + IVVTEIP+QVQKSRLIEKIAEL+IA+++PLLEDIRDESAED+RIVL
Sbjct: 253 AKWQTEDLGRGGYQIVVTEIPFQVQKSRLIEKIAELLIARKLPLLEDIRDESAEDIRIVL 312

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            PK+R++DP +LMES+F L+++E+RFPLNMNVLSMGR+P+VM L+ +LKEWL HRREVL 
Sbjct: 313 VPKSRTVDPTILMESMFKLTELESRFPLNMNVLSMGRIPKVMALNEVLKEWLDHRREVLQ 372

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS FR+ AID+R+EIL GLLIAYLNIDE+I IIR ED+PKPVM++R+ LT+NQV+AILN
Sbjct: 373 RRSRFRLAAIDKRLEILGGLLIAYLNIDEVIRIIREEDEPKPVMMARWDLTDNQVEAILN 432

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
           +RLR+LRKLEE++I+ E D L  EK +I++LL S  +QW  +A EI EVK+ F+K+T++G
Sbjct: 433 MRLRALRKLEEFEIRKEFDELTKEKGEIEALLASDDKQWQTVAWEIGEVKKKFAKATEVG 492

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
           RRRT F +   AD+  +QQAMIEKEPITVVIS +GWIR+LK H  D + L FKEGD LK+
Sbjct: 493 RRRTQFADAPEADEEAIQQAMIEKEPITVVISEKGWIRALKGHIADTATLTFKEGDGLKV 552

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
           A  A TTD+IL+++T GKA+TL    L  GRGHGE +++++D++++Q ++TAFV+D   K
Sbjct: 553 AFPAQTTDKILIVTTGGKAFTLGGDKLPGGRGHGEPLRIMVDMDNDQAVLTAFVHDPARK 612

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
            L+VS+ GN F+V E+E+IANTRKGK  + V+  E+ +L+V V+GDHVAVVGENRKLL+F
Sbjct: 613 QLIVSTAGNGFVVAEAELIANTRKGKQIMNVALPEETQLLVPVSGDHVAVVGENRKLLVF 672

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
            + Q+PEM+RGKGVRLQ YKDGGISDV CF + +GL W DSAGR++ +++++L  WLG R
Sbjct: 673 PLAQVPEMTRGKGVRLQRYKDGGISDVRCFAMSDGLVWEDSAGRTFTKNKDELAEWLGDR 732

Query: 734 GGVGSLVPKGFPRSGKF 750
              G  VPKGFPRSGKF
Sbjct: 733 ASAGRTVPKGFPRSGKF 749


>gi|327192117|gb|EGE59094.1| DNA topoisomerase IV protein, subunit A [Rhizobium etli CNPAF512]
          Length = 751

 Score = 1026 bits (2653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/737 (64%), Positives = 618/737 (83%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           ++N++ V L+ ALE+RYLAYALSTI  RA+PD+RDG KPVHRRI++AM+EMGL   +AF+
Sbjct: 13  DDNIQPVDLKAALEQRYLAYALSTIMHRALPDVRDGLKPVHRRIVYAMNEMGLRPTSAFR 72

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K A+IVGEV+G  HPHGDQS+YD+L RLAQ F QRY L++GQGNFGNIDGDS AA RYTE
Sbjct: 73  KCAKIVGEVMGNYHPHGDQSIYDALARLAQDFSQRYTLVNGQGNFGNIDGDSPAAMRYTE 132

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ++MT V+EL+L+G+D+DAVDFRDTY+E +SEP+V P  FPNLLANG+SGIAVGMATSIPS
Sbjct: 133 SKMTAVSELLLEGIDQDAVDFRDTYDESNSEPIVLPGAFPNLLANGSSGIAVGMATSIPS 192

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN  E+C+AAL LI +P+ ++EKL+E+I GPDFPTGGII++SR+SI+ESYR GRGGFRVR
Sbjct: 193 HNAHELCDAALHLIKHPDATVEKLVEFIPGPDFPTGGIIIDSRDSIIESYRTGRGGFRVR 252

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           A+W  E++GRG + IVVTEIP+QVQKSRLIEKIAEL+IA+++PLLEDIRDESAED+RIVL
Sbjct: 253 AKWQTEDLGRGGYQIVVTEIPFQVQKSRLIEKIAELLIARKLPLLEDIRDESAEDIRIVL 312

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            PK+R++DP +LMES+F L+++E+RFPLNMNVLSMGR+P+VM L+ +LKEWL HRREVL 
Sbjct: 313 VPKSRTVDPTILMESMFKLTELESRFPLNMNVLSMGRIPKVMALNEVLKEWLDHRREVLQ 372

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS FR+ AID+R+EIL GLL+AYLNIDE+I IIR ED+PKPVM++R+ LT+NQV+AILN
Sbjct: 373 RRSRFRLAAIDKRLEILGGLLVAYLNIDEVIRIIREEDEPKPVMMARWDLTDNQVEAILN 432

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
           +RLR+LRKLEE++I+ E D L  EK +I++LL S  +QW  +A EI EVK+ F+K+T++G
Sbjct: 433 MRLRALRKLEEFEIRKEFDELTKEKGEIEALLASDDKQWQTVAWEIGEVKKKFAKATEVG 492

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
           RRRT F +   AD+  +QQAMIEKEPITVVIS +GWIR+LK H  D + L FKEGD LK+
Sbjct: 493 RRRTQFADAPEADEEAIQQAMIEKEPITVVISEKGWIRALKGHIADTATLTFKEGDGLKV 552

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
           A  A TTD+IL+++T GKA+TL    L  GRGHGE +++++D++++Q ++TAFV+D   K
Sbjct: 553 AFPAQTTDKILIVTTGGKAFTLGGDKLPGGRGHGEPLRIMVDMDNDQAVLTAFVHDPARK 612

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
            L+VS+ GN F+V E+E+IANTRKGK  + V+  E+ +L+V V+GDHVAVVGENRKLL+F
Sbjct: 613 QLIVSTAGNGFVVAEAELIANTRKGKQIMNVALPEETQLLVPVSGDHVAVVGENRKLLVF 672

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
            + Q+PEM+RGKGVRLQ YKDGGISDV CF + +GL W DSAGR++ +++++L  WLG R
Sbjct: 673 PLAQVPEMTRGKGVRLQRYKDGGISDVRCFAMSDGLVWEDSAGRTFTKNKDELAEWLGDR 732

Query: 734 GGVGSLVPKGFPRSGKF 750
              G  VPKGFPRSGKF
Sbjct: 733 ASAGRTVPKGFPRSGKF 749


>gi|15888496|ref|NP_354177.1| DNA topoisomerase IV subunit A [Agrobacterium tumefaciens str. C58]
 gi|15156198|gb|AAK86962.1| topoisomerase IV subunit A [Agrobacterium tumefaciens str. C58]
          Length = 750

 Score = 1025 bits (2651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/750 (66%), Positives = 612/750 (81%), Gaps = 2/750 (0%)

Query: 1   MGVDNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHA 60
           MG D +  S    ++N+  V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRIIHA
Sbjct: 1   MGKDLVPPSGG--DDNIHPVDLKAALEERYLAYALSTIMHRALPDVRDGLKPVHRRIIHA 58

Query: 61  MSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGN 120
           MSEMG+   +AFKK ARIVG+VIGK HPHGDQSVYD+LVRLAQ F QRYP++ GQGNFGN
Sbjct: 59  MSEMGIRPNSAFKKCARIVGDVIGKFHPHGDQSVYDALVRLAQDFSQRYPIVDGQGNFGN 118

Query: 121 IDGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGT 180
           IDGD AAAYRYTEARMT VA L+L+G+ EDAVDFR TYNEED EPVV P  FPNLLANG 
Sbjct: 119 IDGDGAAAYRYTEARMTDVAALLLEGIGEDAVDFRATYNEEDEEPVVLPGAFPNLLANGA 178

Query: 181 SGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIV 240
           SGIAVGMATSIP HN  E+C+AAL LI +P+ ++EKL+E+I GPD PTGG+I+ESRE+I+
Sbjct: 179 SGIAVGMATSIPPHNAHELCDAALHLIKHPDATVEKLVEFIPGPDLPTGGVIIESRENIL 238

Query: 241 ESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLED 300
           ++Y+ GRGGFRVRA+W  E++GRG + IV+TEIP+QVQKSRLIEKIAEL+IA+++PLLED
Sbjct: 239 DAYKTGRGGFRVRAKWETEDLGRGGYQIVITEIPFQVQKSRLIEKIAELLIARKLPLLED 298

Query: 301 IRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGI 360
           +RDESAEDVRIVL PKNR++D  LLMES+F LSD+E+R PLNMNVLS+G+VP+VM L+ +
Sbjct: 299 VRDESAEDVRIVLVPKNRTVDATLLMESLFRLSDLESRLPLNMNVLSLGKVPKVMALNEV 358

Query: 361 LKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSR 420
           L EWLAHR++VL RRS  R+ AIDRR+EIL GLLIAYLN+DE+I IIR ED+PK VM++R
Sbjct: 359 LSEWLAHRKDVLVRRSRHRLAAIDRRLEILGGLLIAYLNLDEVIRIIREEDEPKQVMMAR 418

Query: 421 FSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIR 480
           +SLT+NQ +AILN+RLR+LRKLEE++I+ E D+L  EK +I+ LL S  +QW  +A EI 
Sbjct: 419 WSLTDNQAEAILNMRLRNLRKLEEFEIRKEHDDLSKEKSEIEGLLASDDKQWQTVAWEIG 478

Query: 481 EVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDL 540
           EVK+ ++K+T++GRRRT F +   AD   +QQAMIEKEP+T+VIS +GWIR+LK H  D 
Sbjct: 479 EVKKKYAKATEIGRRRTQFADAPDADIEAIQQAMIEKEPVTIVISQKGWIRALKGHMSDT 538

Query: 541 SALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQ 600
           SAL FKEGD  K+A  A TTD++LLL+T GKAYTL A  L  GRGHGE I++++D+ ++Q
Sbjct: 539 SALTFKEGDGPKLAFPAQTTDKLLLLTTGGKAYTLGADKLPGGRGHGEPIRIMVDMENDQ 598

Query: 601 DIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH 660
           DI+TAFV+D + KLL+VS+ GN FIV ESE+IANTRKGK  + VS  ++ KL V VTGDH
Sbjct: 599 DILTAFVHDPSRKLLLVSTGGNGFIVAESEMIANTRKGKQIMNVSMPDEAKLAVPVTGDH 658

Query: 661 VAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYN 720
           VAVVGENRKLL F + Q+PEMSRGKGVRLQ YKDGG+ DV CF + +GL+W D+AGR++ 
Sbjct: 659 VAVVGENRKLLAFPLSQVPEMSRGKGVRLQRYKDGGVVDVKCFALADGLSWSDTAGRAFT 718

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           +   +L  WL  R  VG  VPKGFPRSGKF
Sbjct: 719 KVGEELREWLADRATVGRTVPKGFPRSGKF 748


>gi|241203990|ref|YP_002975086.1| DNA topoisomerase IV subunit A [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857880|gb|ACS55547.1| DNA topoisomerase IV, A subunit [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 751

 Score = 1025 bits (2649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/737 (65%), Positives = 616/737 (83%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           +++++ V L+ ALE+RYLAYALSTI  RA+PD+RDG KPVHRRI++AM+EMGL   +AF+
Sbjct: 13  DDHIQPVDLKAALEQRYLAYALSTIMHRALPDVRDGLKPVHRRIVYAMNEMGLRPNSAFR 72

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K A+IVGEV+G  HPHGDQS+YD+L RLAQ F QRY L++GQGNFGNIDGDS AA RYTE
Sbjct: 73  KCAKIVGEVMGNYHPHGDQSIYDALARLAQDFSQRYTLVNGQGNFGNIDGDSPAAMRYTE 132

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ++MT V+EL+L+G+D+DAVDFRDTY+E +SEPVV P  FPNLLANG+SGIAVGMATSIPS
Sbjct: 133 SKMTAVSELLLEGIDQDAVDFRDTYDESNSEPVVLPGAFPNLLANGSSGIAVGMATSIPS 192

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN  E+C+AAL LI +P+ ++EKL+E+I GPDFPTGGII++SR+SI+ESYR GRGGFRVR
Sbjct: 193 HNAHELCDAALHLIKHPDATVEKLVEFIPGPDFPTGGIIIDSRDSIIESYRTGRGGFRVR 252

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           A+W  E++GRG + IV+TEIP+QVQKSRLIEKIAEL+IA+++PLLEDIRDESAED+R+VL
Sbjct: 253 AKWQTEDLGRGGYQIVITEIPFQVQKSRLIEKIAELLIARKLPLLEDIRDESAEDIRVVL 312

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            PK RS+DP +LMES+F L+++E+RFPLNMNVLSMGR+P+VM L+ +LKEWL HRREVL 
Sbjct: 313 VPKTRSVDPTILMESMFKLTELESRFPLNMNVLSMGRIPRVMALNEVLKEWLDHRREVLQ 372

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS FR+ AIDRR+EIL GLL+AYLNIDE+I IIR ED+PKPVM++R+ LT+NQV+AILN
Sbjct: 373 RRSRFRLAAIDRRLEILSGLLVAYLNIDEVIRIIREEDEPKPVMMARWDLTDNQVEAILN 432

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
           +RLR+LRKLEE++I+ E D L  EK +I++LL+S  +QW  +A EI EVK+ F+K+T++G
Sbjct: 433 MRLRALRKLEEFEIRKEFDELTKEKGEIETLLSSDDKQWQTVAWEIGEVKKKFAKATEIG 492

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
           RRRT F +    D+  +QQAMIEKEPITVVIS +GWIR+LK H  D + L FKEGD LKI
Sbjct: 493 RRRTQFADAPETDEEAIQQAMIEKEPITVVISEKGWIRALKGHIADTATLTFKEGDGLKI 552

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
           A  A TTD+IL+L+T GKA+TL    L  GRGHGE +++++D++++Q ++TAFV+D + K
Sbjct: 553 AFPAQTTDKILILTTGGKAFTLGGDKLPGGRGHGEPLRIIVDMDNDQAVLTAFVHDPSRK 612

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
            L+VS+ GN F+V E+E++ANTRKGK  + V   E+ +L+V V+GDHVAVVGENRKLL+F
Sbjct: 613 QLIVSTAGNGFVVPEAELVANTRKGKQIMNVGLPEETQLLVPVSGDHVAVVGENRKLLVF 672

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
            + Q+PEMSRGKGVRLQ YKDGGISDV CF I +GL W DSAGR++ +++++L  WL  R
Sbjct: 673 PLAQVPEMSRGKGVRLQRYKDGGISDVRCFAISDGLVWEDSAGRTFTKNKDELAEWLADR 732

Query: 734 GGVGSLVPKGFPRSGKF 750
              G  VPKGFPRSGKF
Sbjct: 733 ATAGRTVPKGFPRSGKF 749


>gi|86357137|ref|YP_469029.1| DNA topoisomerase IV subunit A [Rhizobium etli CFN 42]
 gi|86281239|gb|ABC90302.1| DNA topoisomerase IV subunit A protein [Rhizobium etli CFN 42]
          Length = 751

 Score = 1018 bits (2631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/737 (65%), Positives = 619/737 (83%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           ++N++ V L+ ALE+RYLAYALSTI  RA+PD+RDG KPVHRRI++AM+EMGL   +AF+
Sbjct: 13  DDNIQPVDLKAALEQRYLAYALSTIMHRALPDVRDGLKPVHRRIVYAMNEMGLRPTSAFR 72

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K A+IVGEV+G  HPHGDQS+YD+L RLAQ F QRY L++GQGNFGNIDGDS AA RYTE
Sbjct: 73  KCAKIVGEVMGNYHPHGDQSIYDALARLAQDFSQRYTLVNGQGNFGNIDGDSPAAMRYTE 132

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ++MT V+EL+L+G+D+DAVDFRDTY+E +SEPVV P  FPNLLANG+SGIAVGMATSIPS
Sbjct: 133 SKMTAVSELLLEGIDQDAVDFRDTYDESNSEPVVLPGAFPNLLANGSSGIAVGMATSIPS 192

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN  E+C+AAL LI +P+ ++EKL+E+I GPDFPTGGII++SR+SI+ESYR GRGGFRVR
Sbjct: 193 HNAHELCDAALHLIKHPDATVEKLVEFIPGPDFPTGGIIIDSRDSIIESYRTGRGGFRVR 252

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           A+W  E++GRG + I++TEIP+QVQKSRLIEKIAEL+IA+++PLLEDIRDESAED+RIVL
Sbjct: 253 AKWQTEDLGRGGYQIIITEIPFQVQKSRLIEKIAELLIARKLPLLEDIRDESAEDIRIVL 312

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            PK+RS+DP +LMES+F L+++E+RFPLNMNVLSMGR+P+VM L+ +LKEWL HRREVL 
Sbjct: 313 VPKSRSVDPTILMESMFKLTELESRFPLNMNVLSMGRIPKVMALNEVLKEWLDHRREVLQ 372

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS FR+ AID+R+EIL GLLIAYLNIDE+I IIR ED+PKPVM++R+ LT+NQV+AILN
Sbjct: 373 RRSRFRLAAIDKRLEILGGLLIAYLNIDEVIRIIREEDEPKPVMMARWDLTDNQVEAILN 432

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
           +RLR+LRKLEE++I+ E D L  EK +I++LL S  +QW  +A EI EVK+ F+K+T++G
Sbjct: 433 MRLRALRKLEEFEIRKEFDELTKEKSEIEALLASDDKQWQTVAWEIGEVKKKFAKATEVG 492

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
           RRRT F E   AD+  +QQAMIEKEPITVVIS +GWIR+LK H  + + L FKEGD LK+
Sbjct: 493 RRRTQFAEAPEADEEAIQQAMIEKEPITVVISEKGWIRALKGHISETATLTFKEGDGLKV 552

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
           A  A TTD+IL+++T GKA+TL    L  GRGHGE +++++D++++Q ++TAFV+D T K
Sbjct: 553 AFPAQTTDKILIVTTGGKAFTLGGDKLPGGRGHGEPLRIMVDMDNDQAVLTAFVHDPTRK 612

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
            L+VS+ GN F+V E+E++ANTRKGK  + V+  E+ +L+V V+GDHVAVVGENRKLL+F
Sbjct: 613 QLIVSTAGNGFVVPEAELVANTRKGKQIMNVALPEETQLLVPVSGDHVAVVGENRKLLVF 672

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
            + Q+PEMSRGKGVRLQ YKDGGISDV CF I +GL W DSAGR++ +++++L  WLG R
Sbjct: 673 PLAQVPEMSRGKGVRLQRYKDGGISDVRCFAISDGLFWEDSAGRTFTKNKDELAEWLGDR 732

Query: 734 GGVGSLVPKGFPRSGKF 750
              G  VPKGFPRSGKF
Sbjct: 733 ASAGRTVPKGFPRSGKF 749


>gi|209548711|ref|YP_002280628.1| DNA topoisomerase IV subunit A [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534467|gb|ACI54402.1| DNA topoisomerase IV, A subunit [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 751

 Score = 1016 bits (2628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/737 (64%), Positives = 613/737 (83%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           ++ ++ V L+ ALE+RYLAYALSTI  RA+PD+RDG KPVHRRI++AM+EMGL   +AF+
Sbjct: 13  DDYIQPVDLKAALEQRYLAYALSTIMHRALPDVRDGLKPVHRRIVYAMNEMGLRPTSAFR 72

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K A+IVGEV+G  HPHGDQS+YD+L RLAQ F QRY L++GQGNFGNIDGDS AA RYTE
Sbjct: 73  KCAKIVGEVMGNYHPHGDQSIYDALARLAQDFSQRYTLVNGQGNFGNIDGDSPAAMRYTE 132

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ++MT V+EL+L+G+D+DAVDFRDTY+E +SEP V P  FPNLLANG+SGIAVGMATSIPS
Sbjct: 133 SKMTAVSELLLEGIDQDAVDFRDTYDESNSEPTVLPGAFPNLLANGSSGIAVGMATSIPS 192

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN  E+C+AAL LI +P+ ++EKL+E+I GPDFPTGGII++SR+SI+ESYR GRGGFRVR
Sbjct: 193 HNAHELCDAALHLIKHPDATVEKLVEFIPGPDFPTGGIIIDSRDSIIESYRTGRGGFRVR 252

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           A+W  E++GRG + IV+TEIP+QVQKSRLIEKIAEL+IA+++PLLEDIRDESAED+R+VL
Sbjct: 253 AKWQTEDLGRGGYQIVITEIPFQVQKSRLIEKIAELLIARKLPLLEDIRDESAEDIRVVL 312

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            PK RS+DP +LMES+F L+++E+RFPLNMNVLSMGR+P+VM L+ +LKEWL HRREVL 
Sbjct: 313 VPKTRSVDPTILMESMFKLTELESRFPLNMNVLSMGRIPRVMALNEVLKEWLDHRREVLQ 372

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS FR+ AIDRR+EIL GLLIAYLNIDE+I IIR ED+PKPVM++R+ LT+ QV+AILN
Sbjct: 373 RRSRFRLAAIDRRLEILGGLLIAYLNIDEVIRIIREEDEPKPVMMARWDLTDIQVEAILN 432

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
           +RLR+LRKLEE++I+ E D L  EK +I++LL S  +QW  +A EI EVK+ F+K+T++G
Sbjct: 433 MRLRALRKLEEFEIRKEFDELTKEKGEIEALLASDDKQWQTVAWEIGEVKKKFAKATEVG 492

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
           RRRT F +   AD+  +QQAMIEKEPITVVIS +GWIR+LK H  D + L FKEGD LKI
Sbjct: 493 RRRTQFADAPEADEEAIQQAMIEKEPITVVISEKGWIRALKGHIADTATLTFKEGDGLKI 552

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
           A  A TTD+IL+++T GKA+TL    L  GRGHGE +++++D++++Q ++TAFV+D + K
Sbjct: 553 AFPAQTTDKILIVTTGGKAFTLGGDKLPGGRGHGEPLRIMVDMDNDQAVLTAFVHDPSRK 612

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
            L+VS+ GN F+V E+E++ANTRKGK  + V+  E+ +L+V V+GDHVAVVGENRKLL+F
Sbjct: 613 QLIVSTAGNGFVVPEAELVANTRKGKQIMNVALPEETQLLVPVSGDHVAVVGENRKLLVF 672

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
            + Q+PEMSRGKGVRLQ YKDGGISDV CF I  GL W DSAGR++ +++++L  WL  R
Sbjct: 673 PLAQVPEMSRGKGVRLQRYKDGGISDVRCFAISGGLVWEDSAGRTFTKNKDELAEWLADR 732

Query: 734 GGVGSLVPKGFPRSGKF 750
              G  VPKGFPRSGKF
Sbjct: 733 ATAGRTVPKGFPRSGKF 749


>gi|163759186|ref|ZP_02166272.1| putative topoisomerase IV subunit [Hoeflea phototrophica DFL-43]
 gi|162283590|gb|EDQ33875.1| putative topoisomerase IV subunit [Hoeflea phototrophica DFL-43]
          Length = 748

 Score = 1015 bits (2624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/736 (63%), Positives = 603/736 (81%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           ++++ V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRI++AMS+MGL  G +FKK
Sbjct: 12  DDIQGVDLKKALEERYLAYALSTIMHRALPDVRDGLKPVHRRIVYAMSDMGLRSGGSFKK 71

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEA 134
            A+IVGEV+G  HPHGDQS+YD+LVRLAQ F  RYPL++GQGNFGNIDGD+AAA RYTE+
Sbjct: 72  CAKIVGEVMGNFHPHGDQSIYDALVRLAQDFAVRYPLVNGQGNFGNIDGDNAAAMRYTES 131

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           +MT VAEL+++G+ EDAVDFR TY+EE+SEP V P  FPNLLANG +GIAVGMATSIP H
Sbjct: 132 KMTAVAELLIEGIGEDAVDFRTTYDEENSEPTVLPGAFPNLLANGATGIAVGMATSIPPH 191

Query: 195 NVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
           N  E+C+AAL LI  P+ ++E LLE++ GPDFPTGGI++ESRE+++E+Y+ GRGGFRVRA
Sbjct: 192 NAAELCDAALLLIRKPDATVEDLLEHVQGPDFPTGGIVIESREAMLEAYKTGRGGFRVRA 251

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLF 314
           +W  E+ GRG + IV+TE+PYQVQKSRLIEKIAEL+IA+R+PLL+D+RDESAEDVR+VL 
Sbjct: 252 KWETEDTGRGGYQIVITEMPYQVQKSRLIEKIAELLIARRLPLLDDVRDESAEDVRLVLI 311

Query: 315 PKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFR 374
           PK+RS+DP LLMES+F L+D+E+R PLN+NVLSMGRVP+VM L  +L EWLAHRREVL R
Sbjct: 312 PKSRSVDPTLLMESLFRLTDLESRIPLNLNVLSMGRVPKVMGLGEVLSEWLAHRREVLQR 371

Query: 375 RSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNL 434
           RS  R+ AI+RR+E+L G LIAYLN+DE+I IIR ED+PK  ++  F L++ Q +AILN+
Sbjct: 372 RSRHRLAAIERRLELLSGFLIAYLNLDEVIRIIREEDEPKLELMKTFELSDVQAEAILNM 431

Query: 435 RLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGR 494
           RLRSLRKLEE +I+ E D L AEK +I+SLL S  +QW  +A E+  V++ FSK T+LG 
Sbjct: 432 RLRSLRKLEELEIRKEFDALTAEKAEIESLLASDAKQWQTVAWEVGNVRKTFSKETELGA 491

Query: 495 RRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIA 554
           RRT F E   AD A ++QAMIEKEPITVVIS +GWIR +K H  D ++L FK+GD LK+A
Sbjct: 492 RRTNFAEAPVADLAAIEQAMIEKEPITVVISEKGWIRGMKGHLPDFASLQFKDGDGLKLA 551

Query: 555 LHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKL 614
            HA+TTD++++++T GKAYTL A  L  GRGHGE +++++D++++Q ++TAFV+DS  KL
Sbjct: 552 FHANTTDKLVIVTTGGKAYTLGADKLPGGRGHGEPLRIMVDMDNDQAVLTAFVHDSARKL 611

Query: 615 LVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
           L+ S+ GN FIV ES+++ANTRKGK  + V   ++ +L V V+GDHVAV+GENRK+LIF+
Sbjct: 612 LMASTAGNGFIVAESDMVANTRKGKQIMNVGLPDETRLCVPVSGDHVAVIGENRKMLIFA 671

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
           + Q+PEMSRGKGVRLQ YKDGGI+D+ CF + +GLTW DSAGR++NR++ +L  W+  R 
Sbjct: 672 LSQLPEMSRGKGVRLQRYKDGGIADIRCFAMADGLTWEDSAGRAHNRTQAELTEWIADRA 731

Query: 735 GVGSLVPKGFPRSGKF 750
             G LVPKGFPRSGKF
Sbjct: 732 QAGRLVPKGFPRSGKF 747


>gi|325292532|ref|YP_004278396.1| DNA topoisomerase IV subunit A [Agrobacterium sp. H13-3]
 gi|325060385|gb|ADY64076.1| DNA topoisomerase IV subunit A [Agrobacterium sp. H13-3]
          Length = 750

 Score = 1004 bits (2597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/737 (66%), Positives = 607/737 (82%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           ++N+  V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRIIHAMSEMG+   +AFK
Sbjct: 12  DDNIHPVDLKAALEERYLAYALSTIMHRALPDVRDGLKPVHRRIIHAMSEMGIRPNSAFK 71

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+VIGK HPHGDQSVYD+LVRLAQ F QRYP++ GQGNFGNIDGD AAAYRYTE
Sbjct: 72  KCARIVGDVIGKFHPHGDQSVYDALVRLAQDFSQRYPIVDGQGNFGNIDGDGAAAYRYTE 131

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT VA L+L+G+ EDAVDFR TYNEED EPVV P  FPNLLANG SGIAVGMATSIP 
Sbjct: 132 ARMTDVAALLLEGIGEDAVDFRATYNEEDEEPVVLPGAFPNLLANGASGIAVGMATSIPP 191

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN  E+C+AAL LI +P+ ++EKL+E+I GPD PTGG+I+ESRE+I+E+Y+ GRGGFRVR
Sbjct: 192 HNAHELCDAALHLIKHPDATVEKLVEFIPGPDLPTGGVIIESRENILEAYKTGRGGFRVR 251

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           A+W  E++GRG + IV+TEIP+QVQKSRLIEKIAEL++A+++PLLED+RDESAEDVRIVL
Sbjct: 252 AKWETEDLGRGGYQIVITEIPFQVQKSRLIEKIAELLLARKLPLLEDVRDESAEDVRIVL 311

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            PKNR++D  LLMES+F LSD+E+R PLNMNVLS+GRVP+VM L+ +L EWLAHR++VL 
Sbjct: 312 VPKNRTVDATLLMESLFRLSDLESRLPLNMNVLSLGRVPKVMALNEVLSEWLAHRKDVLV 371

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS  R+ AIDRR+EIL GLL+AYLN+DE+I IIR ED+PK VM++++SLT+NQ +AILN
Sbjct: 372 RRSRHRLAAIDRRLEILGGLLVAYLNLDEVIRIIREEDEPKQVMMAKWSLTDNQAEAILN 431

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
           +RLR+LRKLEE++I+ E D L +EK +I+ LL S ++QW  +A EI EVK+ ++K+T++G
Sbjct: 432 MRLRNLRKLEEFEIRKEFDELSSEKAEIEGLLASDEKQWQTVAWEIGEVKKKYAKATEIG 491

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
           RRRT F +   AD   +QQAMIEKEP+T+VIS +GWIR+LK H  D SAL FKEGD  K+
Sbjct: 492 RRRTQFADAPDADIEAIQQAMIEKEPVTIVISQKGWIRALKGHMSDTSALTFKEGDGPKL 551

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
           A  A TTD++LLL+T GKAYTL A  L  GRGHGE I++++D+ ++QDI+TAFV+D + K
Sbjct: 552 AFPAQTTDKLLLLTTGGKAYTLGADKLPGGRGHGEPIRIMVDMENDQDILTAFVHDPSRK 611

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
           LL+VS+ GN FIV ESE++ANTRKGK  + V+  ++ KL V VTGDHVAVVGENRKLL F
Sbjct: 612 LLLVSTGGNGFIVAESEMVANTRKGKQIMNVAMPDEAKLAVPVTGDHVAVVGENRKLLAF 671

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
            + Q+PEMSRGKGVRLQ YKDGG+ DV CF + +GL+W D+AGR + +   +L  WL  R
Sbjct: 672 PLSQVPEMSRGKGVRLQRYKDGGVVDVKCFALADGLSWSDTAGRLFTKVGEELREWLADR 731

Query: 734 GGVGSLVPKGFPRSGKF 750
             VG  VPKGFPRSGKF
Sbjct: 732 ATVGRTVPKGFPRSGKF 748


>gi|240850737|ref|YP_002972137.1| DNA topoisomerase IV subunit A [Bartonella grahamii as4aup]
 gi|240267860|gb|ACS51448.1| DNA topoisomerase IV subunit A [Bartonella grahamii as4aup]
          Length = 749

 Score =  994 bits (2570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/739 (63%), Positives = 599/739 (81%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           +E+++ + LR AL+ERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+ G ++ 
Sbjct: 11  KEHIEPIELRSALQERYLAYALSTITHRALPDVRDGLKPVHRRIVHAMRLLKLNPGQSYA 70

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+V+GK HPHGD S+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTE
Sbjct: 71  KCARIVGDVMGKFHPHGDASIYDALVRLAQSFAVRYPLVDGQGNFGNIDGDNAAAMRYTE 130

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT+VA L+L+G++E+A+DFR TYNEED EPVV P  FPNLLANG+SGIAVGMATSIP 
Sbjct: 131 ARMTEVAALLLEGINENAIDFRLTYNEEDEEPVVLPGAFPNLLANGSSGIAVGMATSIPP 190

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV E+C+AAL LI +P+++ E+L ++++GPDFPTGGI+VE ++SI ESYR+GRG FR+R
Sbjct: 191 HNVAELCDAALHLIAHPDVNDEELNQFVLGPDFPTGGILVEPKKSIEESYRVGRGFFRLR 250

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           +RW  E   RGS+ IVVTEIPYQ+QKSRLIEK AEL++A+R+P+LEDI+DESAED+RIVL
Sbjct: 251 SRWHQESGSRGSYVIVVTEIPYQIQKSRLIEKTAELLLARRLPMLEDIQDESAEDIRIVL 310

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            PKNR++DP+LLMES+F L+D E RFPLN+NVLS+G++P V+ L   L++WL HR+EVL 
Sbjct: 311 VPKNRTVDPELLMESLFKLTDFEVRFPLNLNVLSLGKIPNVLSLRESLQQWLEHRQEVLI 370

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS +R+  ID R+EIL G LIAYLN+DE+I IIR ED+PK  ++SRF LTENQ +AILN
Sbjct: 371 RRSHYRLDQIDCRLEILHGYLIAYLNLDEVIQIIREEDEPKKQLISRFELTENQAEAILN 430

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
           +RLRSLRKLEE++I+ E ++L AEKEK+ +LL S  +QW  I+ EI++V+  F   T LG
Sbjct: 431 MRLRSLRKLEEFEIRKEFESLKAEKEKLQNLLASPIKQWKIISEEIKKVRNTFGPETPLG 490

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
           +RRTTF E  R D   +QQAMIEKEPIT+VIS +GW+R+LK H  D  AL FKEGDSLK+
Sbjct: 491 KRRTTFEEAPRHDLDDIQQAMIEKEPITIVISEKGWMRALKGHLNDYKALSFKEGDSLKL 550

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
           A  A TTD+I+L+ST GK + + A +L  GRGHGE I+LL+D++   D++TAFV+ +  K
Sbjct: 551 AFPAFTTDKIVLISTGGKFFAIGANSLPGGRGHGEPIRLLVDMDDEHDVLTAFVHHAEEK 610

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
           LL+VSS GN FIV  +E+IANTRKGK  + V + +K+KL V+V GDHVAVVGENRK+LIF
Sbjct: 611 LLLVSSHGNGFIVSSAEVIANTRKGKQVMNVKAPDKVKLCVQVNGDHVAVVGENRKMLIF 670

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
           SI+QIPEM+RGKGVRLQ YK+GG+ D   F + EGL+W D+A R +NR  +DL  W+G R
Sbjct: 671 SIEQIPEMNRGKGVRLQRYKEGGVVDAKTFNLSEGLSWQDTAERIFNRQADDLFEWMGMR 730

Query: 734 GGVGSLVPKGFPRSGKFLS 752
            GVG LVP+GFP+SGKF++
Sbjct: 731 AGVGRLVPRGFPKSGKFIN 749


>gi|222085496|ref|YP_002544026.1| DNA topoisomerase IV, A subunit [Agrobacterium radiobacter K84]
 gi|221722944|gb|ACM26100.1| DNA topoisomerase IV, A subunit [Agrobacterium radiobacter K84]
          Length = 752

 Score =  992 bits (2565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/738 (64%), Positives = 614/738 (83%), Gaps = 1/738 (0%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           ++++  V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRI++AMSEMGL   AAF+
Sbjct: 13  DDSIVPVDLKAALEERYLAYALSTIMHRALPDVRDGLKPVHRRIVYAMSEMGLRPNAAFR 72

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K A+IVGEV+G  HPHGDQS+YD+L RLAQ F QRY L++GQGNFGNIDGDS AA RYTE
Sbjct: 73  KCAKIVGEVMGNYHPHGDQSIYDALARLAQDFSQRYTLVNGQGNFGNIDGDSPAAMRYTE 132

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ++MT V+EL+L+G+D+DAVDFRDTY+E +SEP+V P  FPNLLANG+SGIAVGMATSIPS
Sbjct: 133 SKMTAVSELLLEGIDQDAVDFRDTYDESNSEPIVLPGAFPNLLANGSSGIAVGMATSIPS 192

Query: 194 HNVQEICEAALALIDNPEISIEKLLE-YIIGPDFPTGGIIVESRESIVESYRLGRGGFRV 252
           HN  E+C+AAL LI + + ++E L+E YI GPDFPTGGII++ R SI+ESY+ GRGGFRV
Sbjct: 193 HNAHELCDAALHLIKDRDATVETLVELYIPGPDFPTGGIIIDDRRSIIESYKTGRGGFRV 252

Query: 253 RARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIV 312
           RA+W +E++GRG + IV+TEIP+QVQKSRLIEKIAEL++A+++PLLEDIRDESAED+R+V
Sbjct: 253 RAKWEIEDLGRGGYQIVITEIPFQVQKSRLIEKIAELLLARKLPLLEDIRDESAEDIRVV 312

Query: 313 LFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVL 372
           L PK+R++D  +LMES+F LS++E+RFPLNMNVLSMGR+P+VM L+ +LKEWL HRREVL
Sbjct: 313 LIPKSRTVDATILMESMFKLSELESRFPLNMNVLSMGRIPKVMALNEVLKEWLDHRREVL 372

Query: 373 FRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAIL 432
            RRS FR+ AI++R+EIL G LIAYLNIDE+IAIIR ED+PKPVM+ RF LT+NQV+AIL
Sbjct: 373 QRRSRFRLAAIEKRLEILGGFLIAYLNIDEVIAIIREEDEPKPVMMERFGLTDNQVEAIL 432

Query: 433 NLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDL 492
           N+RLRSLRKLEE++I+ E D L  EK +I+ LL S ++QW  +A EI EVK+ F+K+T++
Sbjct: 433 NMRLRSLRKLEEFEIRKEFDGLSKEKSEIEVLLASDEKQWQTVAWEIGEVKKKFAKATEV 492

Query: 493 GRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLK 552
           GRRRT F E   AD A LQQAMIEKEPITVV+S +GWIR+LK H  + S L FKEGD+LK
Sbjct: 493 GRRRTQFAEAPEADDAALQQAMIEKEPITVVVSEKGWIRALKGHISETSTLTFKEGDALK 552

Query: 553 IALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTC 612
           +A  A TTD+IL+++T GKAYTL    L  GRGHGE +++++D+ ++QD++TAFV+D   
Sbjct: 553 VAFPAQTTDKILIITTGGKAYTLGGDKLPGGRGHGEPLRIMVDMENDQDVLTAFVHDPQR 612

Query: 613 KLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLI 672
           K LV S+ GN F+V E+E++ANTRKGK  + +++ ++ KL+V V+GDHVAVVGENRK+++
Sbjct: 613 KQLVASTAGNGFVVAETELVANTRKGKQIMNLTTPDETKLLVPVSGDHVAVVGENRKMVV 672

Query: 673 FSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGK 732
           F + QIPEMSRGKGVRLQ YKDGG+SD+ CF I +GLTW DSAGR++ +++++L  WLG 
Sbjct: 673 FPLSQIPEMSRGKGVRLQRYKDGGVSDIKCFAIADGLTWEDSAGRTFTKTKDELAEWLGD 732

Query: 733 RGGVGSLVPKGFPRSGKF 750
           R   G  VPKGFPR+G+F
Sbjct: 733 RSAAGRAVPKGFPRTGRF 750


>gi|163868505|ref|YP_001609714.1| DNA topoisomerase IV subunit A [Bartonella tribocorum CIP 105476]
 gi|161018161|emb|CAK01719.1| topoisomerase IV subunit A [Bartonella tribocorum CIP 105476]
          Length = 749

 Score =  991 bits (2561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/737 (63%), Positives = 593/737 (80%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           +E+++ + LR AL+ERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+ G ++ 
Sbjct: 11  KEHIEPIELRSALQERYLAYALSTITHRALPDVRDGLKPVHRRIVHAMRLLKLNPGQSYA 70

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+V+GK HPHGD S+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTE
Sbjct: 71  KCARIVGDVMGKFHPHGDASIYDALVRLAQSFAVRYPLVDGQGNFGNIDGDNAAAMRYTE 130

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT+VA L+L+G++E+A+DFR TYNEED EPVV P  FPNLLANG+SGIAVGMATSIP 
Sbjct: 131 ARMTEVAALLLEGINENAIDFRLTYNEEDEEPVVLPGAFPNLLANGSSGIAVGMATSIPP 190

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV E+C+AAL LI +P+   E L ++++GPDFPTGGI+VE +ESI ESYR+GRG FR+R
Sbjct: 191 HNVAELCDAALHLIAHPDTRDEDLNQFVLGPDFPTGGILVEPKESIEESYRIGRGFFRLR 250

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           +RW  E   RGS+ IVVTEIPYQVQKSRLIEK AEL++A+R+P+LEDI+DESAED+RIVL
Sbjct: 251 SRWHQETGSRGSYVIVVTEIPYQVQKSRLIEKTAELLLARRLPMLEDIQDESAEDIRIVL 310

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            PKNRS+DP+LLMES+F L+D E RFPLN+NVLS+G++P V+ L   L++WL HR+EVL 
Sbjct: 311 VPKNRSVDPELLMESLFKLTDFEVRFPLNLNVLSLGKIPNVLSLRESLQQWLVHRQEVLI 370

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS +R+  ID R+EIL G LIAYLN+DE+I IIR ED+PK  +++RF LTENQ +AILN
Sbjct: 371 RRSHYRLDQIDCRLEILHGYLIAYLNLDEVIQIIREEDEPKRKLINRFELTENQAEAILN 430

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
           +RLRSLRKLEE++I+ E + L AEKEK+ +LL S  +QW  ++ EI++V+  F   T LG
Sbjct: 431 MRLRSLRKLEEFEIRKEFETLKAEKEKLQNLLASPIKQWKIVSEEIKKVRNTFGPETLLG 490

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
           +RRTTF E  R D   +QQAMIEKEP+TVVIS +GW+R+LK H  D  AL FKEGDSLK+
Sbjct: 491 KRRTTFEEAPRHDLDDIQQAMIEKEPVTVVISEKGWMRALKGHLNDYKALSFKEGDSLKL 550

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
           A  A TTD+I+L+ST GK + L A +L  GRGHGE I+LL+D++   D++TAFV+ +  K
Sbjct: 551 AFPAFTTDKIVLISTGGKFFALGANSLPGGRGHGEPIRLLVDMDDEHDVLTAFVHHAEEK 610

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
           LL+VSS+GN FIV  +E+IANTRKGK  + V S +K+KL   V GDHVAVVGENRK+LIF
Sbjct: 611 LLLVSSQGNGFIVPAAEVIANTRKGKQVMNVKSPDKVKLCAPVHGDHVAVVGENRKMLIF 670

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
           SI+QIPEM+RGKGVRLQ YK+GGI D   F + EGL+W D+A R +NR  +DL+ W+G R
Sbjct: 671 SIEQIPEMNRGKGVRLQRYKEGGIVDAKTFNLSEGLSWQDTAERIFNRQADDLIEWMGIR 730

Query: 734 GGVGSLVPKGFPRSGKF 750
            GVG +VPKGFP+SGKF
Sbjct: 731 AGVGRMVPKGFPKSGKF 747


>gi|110633477|ref|YP_673685.1| DNA topoisomerase IV subunit A [Mesorhizobium sp. BNC1]
 gi|110284461|gb|ABG62520.1| DNA topoisomerase IV subunit A [Chelativorans sp. BNC1]
          Length = 750

 Score =  988 bits (2555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/738 (61%), Positives = 586/738 (79%), Gaps = 2/738 (0%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           ++   V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRI+H M  + L+    F K
Sbjct: 12  DSASPVDLKKALEERYLAYALSTIMHRALPDVRDGLKPVHRRIMHTMRLLRLNPEQGFAK 71

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEA 134
            ARIVG+V+GK HPHGDQS+YD+LVRLAQPF  RYPL+ GQGNFGNIDGD+AAA RYTEA
Sbjct: 72  CARIVGDVMGKFHPHGDQSIYDALVRLAQPFAMRYPLVDGQGNFGNIDGDNAAAMRYTEA 131

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           RMT+VA  +L G+ EDAVDFR TYNEED EP+V P  FPNLL NG+SGIAVGMATS+P H
Sbjct: 132 RMTEVAAELLSGITEDAVDFRPTYNEEDEEPIVLPGAFPNLLCNGSSGIAVGMATSVPPH 191

Query: 195 NVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
           N  E+C+AALALID+P++ + +LL+++ GPDFPTGGIIVE R SI E+Y  GRGGFR+RA
Sbjct: 192 NAAEVCDAALALIDDPDVPVSRLLDFVQGPDFPTGGIIVEGRASIREAYETGRGGFRLRA 251

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLF 314
           RW  E+ GRG+W +VVTEIPY VQKSRLIEKIAELI+A+++PLLED+RDESAED+R+VL 
Sbjct: 252 RWHKEDQGRGTWNVVVTEIPYGVQKSRLIEKIAELILARKLPLLEDVRDESAEDIRVVLV 311

Query: 315 PKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFR 374
           PK+R+++P+LLMES+F L+D+ETRFPLNMNVLS G+VP V+ L  +L+EWL HRREVL R
Sbjct: 312 PKSRAVEPELLMESLFRLTDLETRFPLNMNVLSRGKVPSVLSLKDVLREWLDHRREVLVR 371

Query: 375 RSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNL 434
           RS  R+  I++R+EIL G L+AYLNIDE+I IIR ED+PKPVM+ RF+LT+NQ +AILN+
Sbjct: 372 RSQHRLAEIEKRLEILAGYLVAYLNIDEVIGIIREEDEPKPVMMERFNLTDNQAEAILNM 431

Query: 435 RLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFS--KSTDL 492
           RLR+LRKLEE++I++E D L  EK +I++LL S  +QW  +  E+ +V++ F   K+  L
Sbjct: 432 RLRALRKLEEFEIRTEFDKLSEEKTQIEALLASEAKQWKTVRWEVAKVRQTFDPEKNPAL 491

Query: 493 GRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLK 552
           GRRRTTF +    D   +QQAMIE+EPITV++S +GW+R++K H  DLS + FKEGDSLK
Sbjct: 492 GRRRTTFGDAPSHDLEDVQQAMIEREPITVILSEKGWLRAMKGHLTDLSTVVFKEGDSLK 551

Query: 553 IALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTC 612
           ++ HA TTD+ILL +T GK YT+    L  GRGHGE +++++D+ ++Q +VTAF +D   
Sbjct: 552 LSFHAQTTDKILLFTTGGKFYTIGGDRLPGGRGHGEPVRIMVDMENDQAVVTAFAHDPER 611

Query: 613 KLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLI 672
           +LL+ S  GN FIV E E++ANTRKGK  + V + ++ +L + V+GDH A+VGENRKLL+
Sbjct: 612 RLLIASYAGNGFIVPEKEVVANTRKGKQIMNVKTPDEARLCIPVSGDHAAIVGENRKLLV 671

Query: 673 FSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGK 732
           F ++Q+PEM RGKGVRLQ YKDGGI+D+  F I +GLTW DSA R++ RS+++L  W+G 
Sbjct: 672 FPLEQVPEMVRGKGVRLQRYKDGGIADLKTFAIADGLTWQDSADRTFTRSKDELAEWIGD 731

Query: 733 RGGVGSLVPKGFPRSGKF 750
           R   G + PKGFPR+GKF
Sbjct: 732 RAAAGRMAPKGFPRTGKF 749


>gi|319404169|emb|CBI77762.1| topoisomerase IV subunit A [Bartonella rochalimae ATCC BAA-1498]
          Length = 749

 Score =  986 bits (2550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/739 (62%), Positives = 591/739 (79%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           +E+++ + LR AL+ERYLAYALSTI  RA+PD+RDG KPVHRRIIHAM  + L+ G A+ 
Sbjct: 11  KEHIEPIELRSALQERYLAYALSTITHRALPDVRDGLKPVHRRIIHAMRLLRLNPGQAYA 70

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+V+GK HPHGD S+YD+LVRLAQ F  RYPLI GQGNFGNIDGD+AAA RYTE
Sbjct: 71  KCARIVGDVMGKFHPHGDASIYDALVRLAQSFSVRYPLIDGQGNFGNIDGDNAAAMRYTE 130

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT+VA L+L+G++E+A+DFR TYNEED EP+V P  FPNLLANG++GIAVGMATSIP 
Sbjct: 131 ARMTEVAILLLEGINENAIDFRLTYNEEDEEPIVLPGAFPNLLANGSAGIAVGMATSIPP 190

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV E+C+AAL LI NP    + L ++++GPDFPTGGI+VE ++SI +SYR GRG FR+R
Sbjct: 191 HNVAELCDAALYLIANPHADHKDLSQFVLGPDFPTGGILVEPKKSIEDSYRTGRGLFRLR 250

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           +RW  EE  RGS+ IVVTEIPYQVQKSRLIEK AEL++A+R+P+LEDI DESAED+RIVL
Sbjct: 251 SRWHQEEGNRGSYVIVVTEIPYQVQKSRLIEKTAELLLARRLPMLEDIHDESAEDIRIVL 310

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            PKNR++DP+LLMES+F L+D E RFPLN+NVL++G+VP V+ L   L++WL HR+EVL 
Sbjct: 311 VPKNRTIDPELLMESLFKLTDFEVRFPLNLNVLTLGKVPNVLSLRESLQQWLQHRKEVLI 370

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS++R+  ID R+EIL+G LIAYLN++E+I IIR  D+PK  ++ RF LTENQ ++ILN
Sbjct: 371 RRSNYRLNEIDCRLEILQGYLIAYLNLNEVIQIIREHDEPKKELILRFKLTENQAESILN 430

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
           +RLRSLRKLEE+Q++ E D+L  EKEK+ +LLNS  +QW  IA EI  V++IF   T LG
Sbjct: 431 MRLRSLRKLEEFQLRKEFDSLKIEKEKLQNLLNSNIKQWKVIAEEITRVRKIFGPETFLG 490

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
           +RRTTF +  R D+  + QAMIEKEP+T+VIS +GW+R+LK H  D   L FKEGD LK+
Sbjct: 491 KRRTTFEDAPRHDENDIHQAMIEKEPVTIVISEKGWVRALKGHLNDYKTLSFKEGDGLKL 550

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
           A  A TTD+I+++ST GK +T+ A  L  GRGHGE I++L+D+N+  DI+TAFV++   K
Sbjct: 551 AFPAFTTDKIIVISTGGKFFTISANTLPGGRGHGEPIRILVDMNNEHDILTAFVHNVQGK 610

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
            L++SS GN FIV E++IIANTRKGK  + V S + +KL + V GD++A+VGENRK+LIF
Sbjct: 611 RLLISSYGNGFIVSETDIIANTRKGKQVMNVKSLDSLKLCIPVEGDYIAIVGENRKMLIF 670

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
           SI+QIPEMSRGKGVRLQ YKDGGI D   F + EGL+W D+A RS+NR  N+L+ W+G R
Sbjct: 671 SIEQIPEMSRGKGVRLQRYKDGGIVDAKTFTLSEGLSWQDTAERSFNRQANELVEWMGTR 730

Query: 734 GGVGSLVPKGFPRSGKFLS 752
            G G LVPKGFP+SGKF S
Sbjct: 731 AGTGRLVPKGFPKSGKFFS 749


>gi|319407186|emb|CBI80825.1| topoisomerase IV subunit A [Bartonella sp. 1-1C]
          Length = 749

 Score =  986 bits (2548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/739 (62%), Positives = 591/739 (79%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           +E+++ + LR AL+ERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+ G A+ 
Sbjct: 11  KEHIEPIELRSALQERYLAYALSTITHRALPDVRDGLKPVHRRIVHAMRLLRLNPGQAYA 70

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+V+GK HPHGD S+YD+LVRLAQ F  RYPLI GQGNFGNIDGD+AAA RYTE
Sbjct: 71  KCARIVGDVMGKFHPHGDASIYDALVRLAQSFSVRYPLIDGQGNFGNIDGDNAAAMRYTE 130

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT+VA L+L+G++E+A+DFR TYNEED EP+V P  FPNLLANG++GIAVGMATSIP 
Sbjct: 131 ARMTEVAILLLEGINENAIDFRLTYNEEDEEPIVLPGAFPNLLANGSAGIAVGMATSIPP 190

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV E+C+AAL LI NP    + L ++++GPDFPTGGI+VE ++SI +SYR GRG FR+R
Sbjct: 191 HNVAELCDAALYLIANPHADHKDLSQFVLGPDFPTGGILVEPKKSIEDSYRTGRGLFRLR 250

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           +RW  EE  RGS+ IVVTEIPYQVQKSRLIEK AEL++A+R+P+LEDI DESAED+RIVL
Sbjct: 251 SRWHQEEGNRGSYVIVVTEIPYQVQKSRLIEKTAELLLARRLPMLEDIHDESAEDIRIVL 310

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            PKNR++DP+LLMES+F L+D E RFPLN+NVL++G+VP V+ L   L++WL HR+EVL 
Sbjct: 311 VPKNRTIDPELLMESLFKLTDFEVRFPLNLNVLTLGKVPNVLSLRESLQQWLQHRKEVLI 370

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS++R+  ID R+EIL+G LIAYLN++E+I IIR  D+PK  ++ RF LTENQ ++ILN
Sbjct: 371 RRSNYRLNEIDCRLEILQGYLIAYLNLNEVIQIIREHDEPKKELILRFKLTENQAESILN 430

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
           +RLRSLRKLEE+Q++ E D+L  EKEK+ SLLNS  +QW  IA EI  V++IF   T LG
Sbjct: 431 MRLRSLRKLEEFQLRKEFDSLKIEKEKLQSLLNSNIKQWKVIAEEITRVRKIFGPETFLG 490

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
           +RRTTF +  R D+  + QAMIEKEP+T+VIS +GW+R+LK H  D   L FKEGD LK+
Sbjct: 491 KRRTTFEDAPRHDENDIHQAMIEKEPVTIVISEKGWVRALKGHLNDYKTLSFKEGDGLKL 550

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
           A  A TTD+I+++ST GK +T+ A  L  GRGHGE I++L+D+N+  DI+TAFV++   K
Sbjct: 551 AFPAFTTDKIIVISTGGKFFTISANTLPGGRGHGEPIRILVDMNNEHDILTAFVHNVQGK 610

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
            L++SS GN FIV E++IIANTRKGK  + V S + +KL + V GD++A+VGENRK+LIF
Sbjct: 611 RLLISSYGNGFIVSETDIIANTRKGKQVMNVKSLDSLKLCIPVEGDYIAIVGENRKMLIF 670

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
           SI+QIPEMSRGKGVRLQ YKDGGI D   F + EGL+W D+A RS+NR  N+L+ W+G R
Sbjct: 671 SIEQIPEMSRGKGVRLQRYKDGGIVDAKTFTLSEGLSWQDTAERSFNRQANELVEWMGTR 730

Query: 734 GGVGSLVPKGFPRSGKFLS 752
            G G LVPKGFP+SGKF S
Sbjct: 731 AGTGRLVPKGFPKSGKFSS 749


>gi|49475728|ref|YP_033769.1| DNA topoisomerase IV subunit A [Bartonella henselae str. Houston-1]
 gi|49238535|emb|CAF27771.1| Topoisomerase IV subunit a [Bartonella henselae str. Houston-1]
          Length = 749

 Score =  979 bits (2531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/737 (62%), Positives = 591/737 (80%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           +E+++++ LR AL+ERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+ G ++ 
Sbjct: 11  KEHIESIELRSALQERYLAYALSTITHRALPDVRDGLKPVHRRIVHAMRLLKLNPGHSYA 70

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+V+GK HPHGD S+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTE
Sbjct: 71  KCARIVGDVMGKFHPHGDASIYDALVRLAQNFAVRYPLVDGQGNFGNIDGDNAAAMRYTE 130

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT+VA L+L+G++E+A+DFR TYNEED EP+V P  FPNLLANG+SGIAVGMATSIP 
Sbjct: 131 ARMTEVAALLLEGINENAIDFRLTYNEEDEEPIVLPGAFPNLLANGSSGIAVGMATSIPP 190

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV E+C+AAL LI +P    E+L  +++GPDFPTGGI+VE ++SI ESYR+GRG FR+R
Sbjct: 191 HNVSELCDAALHLIAHPNARDEELNHFVLGPDFPTGGILVEPKKSIEESYRVGRGFFRLR 250

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           +RW  E   RGS+ +VVTEIPYQVQKSRLIEK AEL++A+R+P+LEDIRDESAED+RIVL
Sbjct: 251 SRWHQETGNRGSYVLVVTEIPYQVQKSRLIEKTAELLLARRLPMLEDIRDESAEDIRIVL 310

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            PKNR++DP++LMES+F L+D E RFPLN+NVLS G+VP V+ L   LK+WL HR+EVL 
Sbjct: 311 IPKNRTVDPEILMESLFKLTDFEIRFPLNLNVLSFGKVPNVLSLRESLKQWLEHRQEVLI 370

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS +++  I+RR+EIL G LI YLN+DE+I IIR ED+PK  ++ RF LTENQ +AILN
Sbjct: 371 RRSRYQLDEIERRLEILHGYLITYLNLDEVIQIIREEDEPKKKLIDRFELTENQAEAILN 430

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
           +RLRSLRKLEE++I+ E + L AEKEK+ +LL+S  +QW  I+ EI +V+++F   T LG
Sbjct: 431 MRLRSLRKLEEFEIRKEFETLRAEKEKLQNLLDSRTKQWKIISEEIIKVRKVFGPHTLLG 490

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
           +RRTTF E  R D   + QAMIEKEP+T+VIS +GW+R+LK H  D +AL FKEGD LK+
Sbjct: 491 KRRTTFEEAPRHDFDDIYQAMIEKEPVTIVISEKGWMRALKGHLSDYNALSFKEGDCLKL 550

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
           A  A TTD+I+++ST GK + + A +L  GRGHGE I++L+D++   D++TAFV+ +  K
Sbjct: 551 AFPAFTTDKIVVISTGGKFFAIAANSLPGGRGHGEPIRILVDMDDEHDLLTAFVHHTQEK 610

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
           LL+VSS GN FIV  +E+IANTRKGK  + V   +K+KL V V GDHVAVVGENRK+LIF
Sbjct: 611 LLLVSSHGNGFIVPATEVIANTRKGKQVMNVKFPDKVKLCVPVKGDHVAVVGENRKMLIF 670

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
           +I+QIPEMSRGKGVRLQ YK GG+ DV  F + EGL+W D+A R +NR  +DL+ W+G R
Sbjct: 671 AIEQIPEMSRGKGVRLQRYKQGGVVDVKTFNLSEGLSWQDTAERCFNRQASDLIEWMGVR 730

Query: 734 GGVGSLVPKGFPRSGKF 750
            GVG +VPKGFP+SGKF
Sbjct: 731 SGVGRVVPKGFPKSGKF 747


>gi|319784192|ref|YP_004143668.1| DNA topoisomerase IV subunit alpha [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170080|gb|ADV13618.1| DNA topoisomerase IV, A subunit [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 750

 Score =  978 bits (2527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/736 (61%), Positives = 585/736 (79%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           ++++ V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+    F K
Sbjct: 14  DHIEPVDLKKALEERYLAYALSTIMHRALPDVRDGLKPVHRRIMHAMRLLRLNPDQGFAK 73

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEA 134
            ARIVGEV+GK HPHGDQS+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTEA
Sbjct: 74  CARIVGEVMGKFHPHGDQSIYDALVRLAQDFSMRYPLVDGQGNFGNIDGDNAAAMRYTEA 133

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           RMT VA  +L G+ EDAVD+R TYNEED EPVV P  FPNLLANG+SGIAVGMATSIP H
Sbjct: 134 RMTDVATELLSGITEDAVDYRPTYNEEDEEPVVLPGAFPNLLANGSSGIAVGMATSIPPH 193

Query: 195 NVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
           N  E+C+AAL LI+N +  + KL++++ GPDFPTGGIIV+SR SI+E+Y  GRGGFRVR+
Sbjct: 194 NAAELCDAALHLIENRDAPVAKLMDFVQGPDFPTGGIIVDSRASILEAYETGRGGFRVRS 253

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLF 314
           +W  E+ GRG+W IVVTEIPY VQK+RLIEKIAEL++A+++PLLEDIRDESAEDVR+VL 
Sbjct: 254 KWFQEDQGRGTWSIVVTEIPYGVQKARLIEKIAELLMARKLPLLEDIRDESAEDVRVVLV 313

Query: 315 PKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFR 374
           PK+RS+DP +LMES+F L+++E+RFPLNMNVLS G+VP V+ L G+L+EWL HRR+VL R
Sbjct: 314 PKSRSVDPGILMESLFKLTELESRFPLNMNVLSRGKVPNVLSLKGVLQEWLEHRRDVLVR 373

Query: 375 RSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNL 434
           RS  R+  I+RR+EIL G LIAYLNIDE+I IIR ED+PK VM++R+SLT+ Q +AILN+
Sbjct: 374 RSKHRLGEIERRLEILAGYLIAYLNIDEVIRIIREEDEPKQVMMARWSLTDTQAEAILNM 433

Query: 435 RLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGR 494
           RLR+LRKLEE++I+ E D L AEK++I++LL S ++QW  I  E+  +++ F   T+LG+
Sbjct: 434 RLRALRKLEEFEIRKEFDGLSAEKKQIEALLASNEKQWATIKWEVTNIRDKFGPETELGK 493

Query: 495 RRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIA 554
           RRT F +    D   +  AMIE+EP+TVV+S +GW+R++K H  DLS L FKEGDSLK+A
Sbjct: 494 RRTQFADAPEHDLTDIAHAMIEREPVTVVVSEKGWLRAMKGHLADLSTLTFKEGDSLKLA 553

Query: 555 LHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKL 614
            HA TTD++L+ +T GK YT+ A  L  GRGHGE I++++D++++QDIVTAFV+D+  KL
Sbjct: 554 FHAQTTDKVLVFTTGGKFYTIGADRLPGGRGHGEPIRIIVDMDNDQDIVTAFVHDAKRKL 613

Query: 615 LVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
           L+ S   N FIV E E++ANTRKGK  + V + ++ K  + VTGDH+A+VGENRK+L+F+
Sbjct: 614 LLASHDANGFIVPEEEVVANTRKGKQVMNVKAPDEAKRCIPVTGDHLAIVGENRKMLVFA 673

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
           + +IPEM RGKGVRLQ YKDGG+ D+  F +  GL+W DSA R++ RS  +L  W+G R 
Sbjct: 674 LAEIPEMGRGKGVRLQKYKDGGLLDLKPFTLESGLSWQDSADRTFTRSREELAEWIGARA 733

Query: 735 GVGSLVPKGFPRSGKF 750
             G +VPKGFPR+GKF
Sbjct: 734 SAGRMVPKGFPRTGKF 749


>gi|49474341|ref|YP_032383.1| DNA topoisomerase IV subunit A [Bartonella quintana str. Toulouse]
 gi|49239845|emb|CAF26238.1| Topoisomerase IV subunit a [Bartonella quintana str. Toulouse]
          Length = 749

 Score =  978 bits (2527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/739 (61%), Positives = 592/739 (80%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           +E+++ + LRFAL+ERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+   ++ 
Sbjct: 11  KEHIEPIELRFALQERYLAYALSTITHRALPDVRDGLKPVHRRIVHAMRLLKLNPEQSYA 70

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+V+GK HPHGD S+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTE
Sbjct: 71  KCARIVGDVMGKFHPHGDASIYDALVRLAQSFAVRYPLVDGQGNFGNIDGDNAAAMRYTE 130

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT+VA L+L+G++E+A+DFR TYNEED EPVV P  FPNLLANG+SGIAVGMATSIP 
Sbjct: 131 ARMTEVAALLLEGINENAIDFRLTYNEEDEEPVVLPGAFPNLLANGSSGIAVGMATSIPP 190

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN  E+C+AAL LI +P+ + EKL ++++GPDFPTGGI+VE ++SI ESYR+GRG FR+R
Sbjct: 191 HNAAELCDAALHLIAHPDANDEKLNQFVLGPDFPTGGILVEPKKSIEESYRIGRGFFRLR 250

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           +RW  E   RGS+ I+VTEIPYQVQKSRLIEK AEL++A+R+P+LEDI DESAED+RIVL
Sbjct: 251 SRWHQETGSRGSYVIIVTEIPYQVQKSRLIEKTAELLLARRLPMLEDIHDESAEDIRIVL 310

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            PKNR++DP+LLMES+F L+D E RFPLN+NVLS+G+VP V+ L   L++WL HR++VL 
Sbjct: 311 VPKNRTVDPELLMESLFKLTDFEVRFPLNLNVLSLGKVPNVLSLRESLQQWLEHRQQVLI 370

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS++R+  ID R+EIL G LIAYLN+DE+I IIR ED+PK  +++ F LTENQ +AILN
Sbjct: 371 RRSTYRLNEIDCRLEILHGYLIAYLNLDEVIQIIREEDEPKKELINCFELTENQAEAILN 430

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
           +RLRSL KLEE++I+ E D L A+KEK+ +LL S  +QW  I+ EIR+V++IF   T LG
Sbjct: 431 MRLRSLHKLEEFEIRKEFDALKADKEKLQNLLASSTKQWKMISEEIRKVRKIFGPETLLG 490

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
           +RRTTF E  R     + QAMIEKEP+T+VIS +GW+R+L+ H  D  AL FKEGD LK+
Sbjct: 491 KRRTTFEEAPRHAIDDIHQAMIEKEPVTIVISEKGWMRALRGHLSDYKALSFKEGDCLKL 550

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
           A  A TTD+I ++ST GK + + A +L  GRGHGE I++L+D++   DI+TAFV++   K
Sbjct: 551 AFPAFTTDKITMISTGGKFFCINANDLPGGRGHGEPIRILVDMDDEHDILTAFVHNVEEK 610

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
           LL++SS GN FIV  +E+IANTRKGK  + V   +K+KL + V GDH+AV+GENRK+LIF
Sbjct: 611 LLLISSYGNGFIVPATEVIANTRKGKQVMNVKFLDKVKLCIPVKGDHLAVIGENRKMLIF 670

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
           +I+QIPEMSRGKGVRLQ YK+GG+ D   F + EGL+W D+A RS+NR  +DL+ W+G R
Sbjct: 671 AIEQIPEMSRGKGVRLQRYKEGGVVDAKTFNLSEGLSWQDTAERSFNRQAHDLIEWMGTR 730

Query: 734 GGVGSLVPKGFPRSGKFLS 752
            GVG +VPKGFP+SGKF++
Sbjct: 731 AGVGRMVPKGFPKSGKFIN 749


>gi|13476904|ref|NP_108473.1| DNA topoisomerase IV subunit A [Mesorhizobium loti MAFF303099]
 gi|14027665|dbj|BAB53934.1| DNA topoisomerase IV subunit A [Mesorhizobium loti MAFF303099]
          Length = 750

 Score =  974 bits (2518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/736 (61%), Positives = 584/736 (79%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           ++++ V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+    F K
Sbjct: 14  DHIEPVDLKKALEERYLAYALSTIMHRALPDVRDGLKPVHRRIMHAMRLLRLNPDQGFAK 73

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEA 134
            ARIVGEV+GK HPHGDQS+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTEA
Sbjct: 74  CARIVGEVMGKFHPHGDQSIYDALVRLAQDFSMRYPLVDGQGNFGNIDGDNAAAMRYTEA 133

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           RMT VA  +L G+ EDAVD+R TYNEED EPVV P  FPNLLANG+SGIAVGMATSIP H
Sbjct: 134 RMTDVATELLAGITEDAVDYRPTYNEEDEEPVVLPGAFPNLLANGSSGIAVGMATSIPPH 193

Query: 195 NVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
           N  E+C+AAL LI++ +  + KL++++ GPDFPTGGIIV+SR SI+E+Y  GRGGFRVR+
Sbjct: 194 NAAELCDAALHLIEHRDAPVSKLMDFVQGPDFPTGGIIVDSRASILEAYETGRGGFRVRS 253

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLF 314
           +W  E+ GRG+W IVVTEIPY VQK+RLIEKIAEL++A+++PLLEDIRDESAED+R+VL 
Sbjct: 254 KWSQEDQGRGTWSIVVTEIPYGVQKARLIEKIAELLMARKLPLLEDIRDESAEDIRVVLV 313

Query: 315 PKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFR 374
           PK+RS+DP +LMES+F L+++E+RFPLNMNVLS G+VP V+ L G+L+EWL HRR+VL R
Sbjct: 314 PKSRSVDPGILMESLFKLTELESRFPLNMNVLSRGKVPNVLSLKGVLQEWLDHRRDVLIR 373

Query: 375 RSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNL 434
           RS  R+  I+RR+EIL G LIAYLNIDE+I IIR ED+PK VM++R+SLT+NQ +AILN+
Sbjct: 374 RSRHRLGEIERRLEILAGYLIAYLNIDEVIKIIREEDEPKQVMMARWSLTDNQAEAILNM 433

Query: 435 RLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGR 494
           RLR+LRKLEE++I+ E D L AEK++I++LL S  +QW+ I  E+  +++ F   T+LG+
Sbjct: 434 RLRALRKLEEFEIRKEFDGLSAEKKQIEALLASDAKQWSTIKWEVTNIRDKFGPETELGK 493

Query: 495 RRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIA 554
           RRT F +    D   +  AMIE+EP+TVV+S +GW+R++K H  DLS L FKEGDSLK+A
Sbjct: 494 RRTQFADAPEHDLTDIAHAMIEREPVTVVVSEKGWLRAMKGHLADLSTLTFKEGDSLKLA 553

Query: 555 LHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKL 614
            HA TTD++L+ +T GK YT+ A  L  GRGHGE I++++D++++QDIVTAFV+D   KL
Sbjct: 554 FHAQTTDKVLVFTTGGKFYTIGADRLPGGRGHGEPIRIIVDMDNDQDIVTAFVHDPKRKL 613

Query: 615 LVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
           L+ S   N FIV E E++ANTRKGK  + V + ++ K  V + GDH+A+VGENRK+L+F+
Sbjct: 614 LLASYDANGFIVPEEEVVANTRKGKQVMNVKAPDEAKRCVPLIGDHLAIVGENRKMLVFA 673

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
           + +IPEM RGKGVRLQ YKDGG+ D+  F +  GL+W DSA R++ RS  +L  W+G R 
Sbjct: 674 LSEIPEMGRGKGVRLQKYKDGGLLDLKPFTLETGLSWQDSADRTFTRSREELAEWIGARA 733

Query: 735 GVGSLVPKGFPRSGKF 750
             G +VPKGFPR+GKF
Sbjct: 734 SAGRMVPKGFPRTGKF 749


>gi|260466877|ref|ZP_05813061.1| DNA topoisomerase IV, A subunit [Mesorhizobium opportunistum
           WSM2075]
 gi|259029379|gb|EEW30671.1| DNA topoisomerase IV, A subunit [Mesorhizobium opportunistum
           WSM2075]
          Length = 750

 Score =  973 bits (2516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/736 (61%), Positives = 582/736 (79%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           ++++ V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+    F K
Sbjct: 14  DHIEPVDLKKALEERYLAYALSTIMHRALPDVRDGLKPVHRRIMHAMRLLRLNPDQGFAK 73

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEA 134
            ARIVGEV+GK HPHGDQS+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTEA
Sbjct: 74  CARIVGEVMGKFHPHGDQSIYDALVRLAQDFSMRYPLVDGQGNFGNIDGDNAAAMRYTEA 133

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           RMT VA  +L G+ EDAVD+R TYNEED EPVV P  FPNLLANG+SGIAVGMATSIP H
Sbjct: 134 RMTDVATELLAGITEDAVDYRPTYNEEDEEPVVLPGAFPNLLANGSSGIAVGMATSIPPH 193

Query: 195 NVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
           N  E+C+AAL LI++ +  + KL++++ GPDFPTGGIIV+SR SI+E+Y  GRGGFRVR+
Sbjct: 194 NAAELCDAALHLIEHRDAPVAKLMDFVQGPDFPTGGIIVDSRASILEAYETGRGGFRVRS 253

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLF 314
           RW  E+ GRG+W IVVTEIPY VQK+RLIEKIAEL++A+++PLLEDIRDESAED+R+VL 
Sbjct: 254 RWSQEDQGRGTWSIVVTEIPYGVQKARLIEKIAELLMARKLPLLEDIRDESAEDIRVVLV 313

Query: 315 PKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFR 374
           PK+RS+DP +LMES+F L+++E+RFPLNMNVLS G+VP V+ L G+L+EWL HRR+VL R
Sbjct: 314 PKSRSVDPGILMESLFKLTELESRFPLNMNVLSRGKVPNVLSLKGVLQEWLDHRRDVLVR 373

Query: 375 RSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNL 434
           RS  R+  I+RR+EIL G LIAYLNIDE+I IIR ED+PK VM++R+SLT+ Q +AILN+
Sbjct: 374 RSKHRLGEIERRLEILAGYLIAYLNIDEVIKIIREEDEPKQVMMARWSLTDTQAEAILNM 433

Query: 435 RLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGR 494
           RLR+LRKLEE++I+ E D L  EK++I++LL S  +QW+ I  E+  +++ F   T+LG+
Sbjct: 434 RLRALRKLEEFEIRKEFDGLTTEKKQIEALLASDAKQWSTIKWEVTSIRDKFGPETELGK 493

Query: 495 RRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIA 554
           RRT F +    D   +  AMIE+EP+TVV+S +GW+R++K H  DLS L FKEGDSLK+A
Sbjct: 494 RRTQFADAPEHDLTDIAHAMIEREPVTVVVSEKGWLRAMKGHLADLSTLTFKEGDSLKLA 553

Query: 555 LHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKL 614
            HA TTD++L+ +T GK YT+ A  L  GRGHGE I++++D++++QDIVTAFV+D   KL
Sbjct: 554 FHAQTTDKVLVFTTGGKFYTIGADRLPGGRGHGEPIRIIVDMDNDQDIVTAFVHDPKRKL 613

Query: 615 LVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
           L+ S   N FIV E E++ANTRKGK  + V + ++ K  V +TGDH+A+VGENRK+L+F+
Sbjct: 614 LLASYDANGFIVPEEEVVANTRKGKQVMNVKAPDEAKRCVPLTGDHLAIVGENRKMLVFA 673

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
           +  IPEM RGKGVRLQ YKDGG+ D+  F +  GL+W DSA R++ RS  +L  W+G R 
Sbjct: 674 LSDIPEMGRGKGVRLQKYKDGGLLDLKPFTLETGLSWQDSADRTFTRSREELAEWIGARA 733

Query: 735 GVGSLVPKGFPRSGKF 750
             G +VPKGFPR+GKF
Sbjct: 734 SAGRMVPKGFPRTGKF 749


>gi|121602784|ref|YP_989154.1| DNA topoisomerase IV subunit A [Bartonella bacilliformis KC583]
 gi|120614961|gb|ABM45562.1| DNA topoisomerase IV, A subunit [Bartonella bacilliformis KC583]
          Length = 745

 Score =  971 bits (2511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/742 (60%), Positives = 594/742 (80%)

Query: 9   SNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDF 68
           S+ + EE+++ + LR AL+ERYLAYALSTI  RA+PD+RDG KPVHRRIIHAM  + L+ 
Sbjct: 2   SDKIDEEHIEPIELRSALQERYLAYALSTITHRALPDVRDGLKPVHRRIIHAMRLLKLNP 61

Query: 69  GAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAA 128
             ++ K ARIVG+V+GK HPHGD S+YD+LVRLAQ F  RYPLI GQGNFGNIDGD+AAA
Sbjct: 62  AQSYAKCARIVGDVMGKFHPHGDASIYDALVRLAQDFAVRYPLIDGQGNFGNIDGDNAAA 121

Query: 129 YRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMA 188
            RYTEARMT+VAEL+L+G++E+A+DFR TYNEED EP+V P  FPNLLANG+SGIAVGMA
Sbjct: 122 MRYTEARMTEVAELLLEGINENAIDFRLTYNEEDEEPIVLPGAFPNLLANGSSGIAVGMA 181

Query: 189 TSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRG 248
           TSIP HNV E+C+AAL LI + + S E L ++++GPDFPTGGI+VE ++SI E+YR GRG
Sbjct: 182 TSIPPHNVAELCDAALHLIAHSDASHEDLNQFVLGPDFPTGGILVEPKKSIEEAYRTGRG 241

Query: 249 GFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED 308
            FR+R+RW  E   R S+ IV+TEIPYQ+QKSRL+EK AEL++A+R+P+LEDI+DESAED
Sbjct: 242 SFRLRSRWHQETGNRNSYVIVITEIPYQIQKSRLVEKTAELLLARRLPMLEDIQDESAED 301

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
           VRIVL PKNR++DP+LLMES+F L+D E RFPLN+NVL++G+ P V+ L   L++WL HR
Sbjct: 302 VRIVLTPKNRTVDPELLMESLFKLTDFEVRFPLNLNVLTLGKTPNVLSLRESLQQWLEHR 361

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           +EVL RRS+ R+  I+ R+EIL G LIAYLN+D++I IIR ED+PK  +++ F LTENQ 
Sbjct: 362 QEVLIRRSNHRLGQINSRLEILHGYLIAYLNLDKVIQIIREEDEPKKELLTHFQLTENQA 421

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AILN+RLRSLRKLEE++I+ E +NL AE+EK+ +LL S  +QW  I+ EI++V++ F+ 
Sbjct: 422 EAILNMRLRSLRKLEEFEIRKEFENLKAEEEKLQALLGSNVKQWQMISEEIKKVRKKFAP 481

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
            T LG+RRTTF +  + D   + QAMIEKEP+T+VIS +GW+R+LK H  D  AL FKEG
Sbjct: 482 ETSLGKRRTTFEDSPKRDVDDIYQAMIEKEPVTIVISEKGWMRALKGHLNDYKALSFKEG 541

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           D LK+A  A TTD+I+++ST GK +T+ A  L  GRGHGE I++L+D+++  DI+TAFV+
Sbjct: 542 DCLKLAFPAFTTDKIVVVSTGGKFFTIGANTLPGGRGHGEPIRILVDMDNEHDILTAFVH 601

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENR 668
           ++  KLL+VSS GN FI+ E+E+IANTRKGK  + V S +K+KL + V GDH+AV+GENR
Sbjct: 602 NAQGKLLLVSSYGNGFIISETEVIANTRKGKQIMNVKSPDKVKLCIPVKGDHIAVIGENR 661

Query: 669 KLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLG 728
           K+LIF I+QIPE+SRGKGVRLQ YKDG + D   F + EGL+W D+A RS+NR  ++L+ 
Sbjct: 662 KMLIFPIEQIPEISRGKGVRLQRYKDGVVVDAKTFNLSEGLSWQDTAERSFNRQADELIE 721

Query: 729 WLGKRGGVGSLVPKGFPRSGKF 750
           W+G R G G L+P+GFP+SGKF
Sbjct: 722 WMGTRAGAGRLLPRGFPKSGKF 743


>gi|319405615|emb|CBI79238.1| topoisomerase IV subunit A [Bartonella sp. AR 15-3]
          Length = 749

 Score =  971 bits (2511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/737 (62%), Positives = 587/737 (79%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           +E+++++ LR AL+ERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+ G  + 
Sbjct: 11  KEHIESIELRSALQERYLAYALSTITHRALPDVRDGLKPVHRRIVHAMRLLKLNPGQPYA 70

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+V+GK HPHGD S+YD+LVRLAQ F  RYPLI GQGNFGNIDGD+AAA RYTE
Sbjct: 71  KCARIVGDVMGKFHPHGDASIYDALVRLAQSFSVRYPLIDGQGNFGNIDGDNAAAMRYTE 130

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT+VA L+L+G++E+A+DFR TYNEED EPVV P  FPNLLANG+SGIAVGMATSIP 
Sbjct: 131 ARMTEVAILLLEGINENAIDFRLTYNEEDKEPVVLPGAFPNLLANGSSGIAVGMATSIPP 190

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV E+C+AAL LI NP    E L ++++GPDFPTGGI+VE ++SI +SYR GRG FR+R
Sbjct: 191 HNVAELCDAALYLIANPHADHEDLNQFVLGPDFPTGGILVEPKKSIEDSYRTGRGLFRLR 250

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           +RW  EE  RGS+ IVVTEIPYQ+QKSRLIEK AEL++A+R+P+LEDI DESAED+RIVL
Sbjct: 251 SRWHQEEGNRGSYVIVVTEIPYQIQKSRLIEKTAELLLARRLPMLEDIHDESAEDIRIVL 310

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            PKNR++DP+LLMES+F L+D E RFPLN+NVL++G+VP ++ L   L++WL HR+EVL 
Sbjct: 311 VPKNRTIDPELLMESLFKLTDFEVRFPLNLNVLTLGKVPNLLSLRESLQQWLQHRKEVLI 370

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS +R+  ID R+EIL+G LIAYLN+DE++ IIR  D+PK  ++ RF LTENQ ++ILN
Sbjct: 371 RRSDYRLNEIDCRLEILQGYLIAYLNLDEVLQIIRESDEPKKELILRFKLTENQAESILN 430

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
           +RLRSLRKLEE+QI+ E ++L  EKEK+ +LL S  +QW  IA EI  V++IF   T LG
Sbjct: 431 MRLRSLRKLEEFQIRKEFESLKIEKEKLQNLLASNIKQWKIIAEEITRVRKIFGPETFLG 490

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
           +RRTTF E  R D   + QAMIEKEP+T+VIS +GW+R+LK H  D   L FKEGD LK+
Sbjct: 491 KRRTTFEEAPRHDVNDIHQAMIEKEPVTIVISEKGWMRALKGHLNDYKTLSFKEGDCLKL 550

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
           A  A TTD+I+++ST GK +T+ A  L  GRGHGE I++L+D+++  +I+TAFV+++  K
Sbjct: 551 AFSAFTTDKIIVISTGGKFFTISANILPGGRGHGEPIRILVDMDNEHNILTAFVHNTQRK 610

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
            L++SS GN FIV ES+IIANTRKGK  + V S + +KL + V GD++A+VGENRK+LIF
Sbjct: 611 RLLISSYGNGFIVSESDIIANTRKGKQVMNVKSPDSLKLCIPVEGDYIAIVGENRKMLIF 670

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
           SI+QIPEMSRGKGVRLQ YKD  + DV  F + EGL+W D+A RS+NR  ++L+ W+G R
Sbjct: 671 SIEQIPEMSRGKGVRLQRYKDSVVVDVKTFTLSEGLSWQDTAERSFNRRADELVEWMGTR 730

Query: 734 GGVGSLVPKGFPRSGKF 750
            G G LVPKGFP+SGKF
Sbjct: 731 AGAGRLVPKGFPKSGKF 747


>gi|319408644|emb|CBI82299.1| topoisomerase IV subunit A [Bartonella schoenbuchensis R1]
          Length = 749

 Score =  970 bits (2507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/746 (61%), Positives = 593/746 (79%)

Query: 5   NISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEM 64
           ++  S    +E ++ V L  AL+ERYLAYALSTI  RA+PD+RDG KPVHRRIIHAM  +
Sbjct: 2   SVKMSQPFDKECIEPVELCSALQERYLAYALSTITHRALPDVRDGLKPVHRRIIHAMRLL 61

Query: 65  GLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGD 124
            L+ G ++ K ARIVG+V+GK HPHGD S+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD
Sbjct: 62  KLNPGQSYAKCARIVGDVMGKFHPHGDASIYDALVRLAQDFAVRYPLVDGQGNFGNIDGD 121

Query: 125 SAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIA 184
           +AAA RYTEARMT+VA L+L+G++ED++DFR TYNEED EPVV P  FPNLLANG+SGIA
Sbjct: 122 NAAAMRYTEARMTEVAALLLEGINEDSIDFRLTYNEEDEEPVVLPGAFPNLLANGSSGIA 181

Query: 185 VGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYR 244
           VGMATSIP HNV E+C+AAL LI +P  + E L ++++GPDFPTGGI+VE ++SI ESYR
Sbjct: 182 VGMATSIPPHNVAELCDAALHLIAHPNANNEDLNKFVLGPDFPTGGILVEPKKSIEESYR 241

Query: 245 LGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDE 304
            GRG FR+R+RW  E+  RGS+ IVVTEIPYQVQKSRLIEK AEL++A+R+P+LEDI DE
Sbjct: 242 TGRGLFRLRSRWHQEQSSRGSYVIVVTEIPYQVQKSRLIEKTAELLLARRLPMLEDIHDE 301

Query: 305 SAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEW 364
           SAED+RIVL PKNR++D +LLMES+F L+D E RFPLN+NVL++G+VP V+ L   L++W
Sbjct: 302 SAEDIRIVLVPKNRTVDAELLMESLFKLTDFEVRFPLNLNVLTLGKVPNVLSLRESLQQW 361

Query: 365 LAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLT 424
           L HR+EVL RRSS+R+  I+RR+EIL G LIAYLN+D++I I+R ED+PK  ++  F LT
Sbjct: 362 LEHRKEVLVRRSSYRLNEINRRLEILNGYLIAYLNLDKVIQILREEDEPKKELIEHFKLT 421

Query: 425 ENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKE 484
           +NQ +AILN+RLRSLRKLEE++I+ E ++L  E+ ++ +LL S  +QW  I+ EI +V++
Sbjct: 422 DNQAEAILNMRLRSLRKLEEFEIRKEFESLKTEEAQLQALLASNIKQWKMISDEITKVRK 481

Query: 485 IFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALH 544
           IF   T LG+RRTTF +  + D   +QQAMIE+EP+T++IS +GW+R+LK H  D   L 
Sbjct: 482 IFGPETILGKRRTTFEDAPKHDVNDIQQAMIEREPVTIIISEKGWMRALKGHLNDYKMLS 541

Query: 545 FKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVT 604
           FKEGD LK+AL A TTD+I+++ST GK +T+ A  L  GRGHGE I++L+D++   DI+T
Sbjct: 542 FKEGDCLKLALPAFTTDKIVVVSTGGKFFTIGANVLPGGRGHGEPIRILVDMDGEHDILT 601

Query: 605 AFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVV 664
           AFV+++  K L+VS+ GN FIV E+E+IANTRKGK  + V S +K+KL V V GD+VAVV
Sbjct: 602 AFVHNAQEKRLLVSAYGNGFIVSENEVIANTRKGKQIMHVKSPDKVKLCVPVNGDYVAVV 661

Query: 665 GENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSEN 724
           GENRKLLIF+I+QIPEMSRGKGVRLQ YKDGG+ D   F + EGL+W D+A RS+NR  +
Sbjct: 662 GENRKLLIFAIEQIPEMSRGKGVRLQRYKDGGVVDAKTFNLSEGLSWQDTAERSFNRQSD 721

Query: 725 DLLGWLGKRGGVGSLVPKGFPRSGKF 750
           +L+ W+G R GVG LVPKGFP+SGKF
Sbjct: 722 ELIEWMGTRAGVGRLVPKGFPKSGKF 747


>gi|319898853|ref|YP_004158946.1| topoisomerase IV subunit A [Bartonella clarridgeiae 73]
 gi|319402817|emb|CBI76368.1| topoisomerase IV subunit A [Bartonella clarridgeiae 73]
          Length = 749

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/739 (62%), Positives = 585/739 (79%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           +E+++ + LR AL+ERYLAYALSTI  RA+PD+RDG KPVHRRIIHAM  + L+ G A+ 
Sbjct: 11  KEHIEPIELRSALQERYLAYALSTITHRALPDVRDGLKPVHRRIIHAMRLLRLNPGKAYT 70

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+V+GKLHPHGD S+YD+LVRLAQ F  RYPLI GQGNFGNIDGD+AAA RYTE
Sbjct: 71  KCARIVGDVMGKLHPHGDVSIYDALVRLAQSFAVRYPLIDGQGNFGNIDGDNAAAMRYTE 130

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT+VA L+L+G++E+A+DFR TYNEED EP+V P  FPNLLANG+SGIAVGMATSIP 
Sbjct: 131 ARMTEVAILLLEGINENAIDFRLTYNEEDEEPIVLPGAFPNLLANGSSGIAVGMATSIPP 190

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV E+C+AAL LI NP    + L ++++GPDFPTGGI+VE ++SI +SYR GRG FR+R
Sbjct: 191 HNVAELCDAALYLIANPHADHKDLNQFVLGPDFPTGGILVEPKKSIEDSYRTGRGLFRLR 250

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           +RW  EE  RGS+ IVVTEIPYQ+QKSRLIEK AEL++A+R+P+LEDI DESAED+RIVL
Sbjct: 251 SRWHQEEGNRGSYVIVVTEIPYQIQKSRLIEKTAELLLARRLPMLEDIHDESAEDIRIVL 310

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            PKNR++DP+LLMES+F L+D E RFPLN+NVL++G+VP V+ L   L++WL HR+EVL 
Sbjct: 311 VPKNRTIDPELLMESLFKLTDFEVRFPLNLNVLTLGKVPNVLSLRESLQQWLQHRKEVLI 370

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS++R+  ID R+EIL+G LIAYLN+DE++ IIR  D+PK  ++  F LTENQ ++ILN
Sbjct: 371 RRSNYRLNEIDCRLEILQGYLIAYLNLDELVQIIRENDEPKKELIVCFKLTENQAESILN 430

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
           +RLRSLRKLEE++I+ E D+L  EKEK+ +LL S  +QW  IA EI  V++ F   T LG
Sbjct: 431 MRLRSLRKLEEFEIRKEFDSLKIEKEKLQNLLASNIKQWKIIAEEITRVRKSFGPDTFLG 490

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
           +RRTTF +  R D   + QAMIEKEP+T+VIS +GW+R+LK H  D   L FKEGD LK+
Sbjct: 491 KRRTTFEDAPRHDVNDIHQAMIEKEPVTIVISEKGWMRALKGHLNDYKTLSFKEGDCLKL 550

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
           A  A TTD+I+++ST GK +T+ A  L  GRGHGE I++L+D++   DI+TAFVY+   K
Sbjct: 551 AFPAFTTDKIIVISTGGKFFTISANTLPGGRGHGEPIRILVDMDKEHDILTAFVYNMEGK 610

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
            L++SS GN FIV E +IIANTRKGK  + + S + +KL + V GD++AVVGENRK+LIF
Sbjct: 611 RLLISSYGNGFIVSEIDIIANTRKGKQVMNIKSPDSLKLCIPVKGDYIAVVGENRKMLIF 670

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
           SI+QIPEMSRGKGVRLQ YKDGG+ D   F + EGL+W D+A RS+NR  ++L+ W+G R
Sbjct: 671 SIEQIPEMSRGKGVRLQRYKDGGVVDAKTFTLSEGLSWQDTAERSFNRQADELVEWMGTR 730

Query: 734 GGVGSLVPKGFPRSGKFLS 752
            G G  VPKGFP+SGKF S
Sbjct: 731 AGAGRFVPKGFPKSGKFSS 749


>gi|306843699|ref|ZP_07476299.1| DNA topoisomerase IV, A subunit [Brucella sp. BO1]
 gi|306276009|gb|EFM57718.1| DNA topoisomerase IV, A subunit [Brucella sp. BO1]
          Length = 770

 Score =  956 bits (2470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/759 (60%), Positives = 588/759 (77%), Gaps = 22/759 (2%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           EE+++ V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+   A+ 
Sbjct: 12  EEHIERVDLKSALEERYLAYALSTIMHRALPDVRDGLKPVHRRIMHAMRLLRLNPDQAYA 71

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+V+GK HPHGD S+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTE
Sbjct: 72  KCARIVGDVMGKFHPHGDASIYDALVRLAQDFAVRYPLVDGQGNFGNIDGDNAAAMRYTE 131

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT+VA L+L+G++E+A+DFR TYNEED EP+V P  FPNLLANG++GIAVGMAT+IP 
Sbjct: 132 ARMTEVATLLLEGINENAIDFRPTYNEEDEEPIVLPGAFPNLLANGSAGIAVGMATNIPP 191

Query: 194 HNVQEICEAALALIDNPEISIEKLLEY----------------------IIGPDFPTGGI 231
           HNV E+C +AL LI++P+  +E+L+                        + GPDFPTGGI
Sbjct: 192 HNVAELCSSALYLINHPDAPVEELVTSPEQWAEIEQESKTDPAALLKCKVRGPDFPTGGI 251

Query: 232 IVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELII 291
           +VE   +I+E+YR GRG FRVRARW  EE  RG+W IVVTEIPYQVQKSRLIEKIAEL++
Sbjct: 252 LVEEHGNILEAYRTGRGAFRVRARWHKEEGNRGTWVIVVTEIPYQVQKSRLIEKIAELLL 311

Query: 292 AKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRV 351
           AK++PLL+DIRDESAED+RIVL PKNR++DP+LLMES+F L+++E+R  LNMNVLS G+V
Sbjct: 312 AKKLPLLDDIRDESAEDIRIVLEPKNRTVDPELLMESLFKLTELESRVSLNMNVLSHGKV 371

Query: 352 PQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNED 411
           P V+ L  +L+EWL HR+EVL RRS FR+  I+RR+EIL G LIAYLN+DE+I IIR ED
Sbjct: 372 PNVLSLGAVLREWLEHRKEVLVRRSQFRLAEIERRLEILGGFLIAYLNLDEVIRIIREED 431

Query: 412 KPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQ 471
           +PK  ++  F LT+ Q ++ILN+RLRSLRKLEE++I+ E D+L AEK  ++ LL SG +Q
Sbjct: 432 EPKQELMRAFELTDVQAESILNMRLRSLRKLEEFEIRKEFDDLTAEKTDLEGLLASGTRQ 491

Query: 472 WNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIR 531
           W +I+ EI+ V+E F  +T LG+RRTTF      D   + QAMIE+EP+T+V+S +GW+R
Sbjct: 492 WKKISAEIKAVREKFGPTTRLGKRRTTFAHAPMHDLEDIHQAMIEREPVTIVVSEKGWLR 551

Query: 532 SLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQ 591
           ++K H  D S L FKEGD LK+A HA TTD++L  +T GK +T+ A  L  GRGHGE I+
Sbjct: 552 AMKGHLADFSTLSFKEGDKLKLAFHAETTDKLLFFTTGGKFFTIGANTLPGGRGHGEPIR 611

Query: 592 LLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMK 651
           +L+D+ ++QDI+TAFV+D + KLL+VS +GN FIV ESE +ANTRKGK  + V + ++ K
Sbjct: 612 ILVDMENDQDILTAFVHDPSAKLLLVSHEGNGFIVPESEAVANTRKGKQVMNVKTPDEAK 671

Query: 652 LVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTW 711
           L  +V+GDH+AVVGENRK+L+F +  IPEM+RGKGVRLQ YKDGG+ DV  F I +GL+W
Sbjct: 672 LCQRVSGDHIAVVGENRKMLVFPLSDIPEMTRGKGVRLQKYKDGGVCDVRTFAIADGLSW 731

Query: 712 IDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
            DSA R++NRS+ +L+ W+G R   G LVPKGFPRSGKF
Sbjct: 732 QDSADRTFNRSKEELVEWIGARASAGRLVPKGFPRSGKF 770


>gi|306841998|ref|ZP_07474672.1| DNA topoisomerase IV, A subunit [Brucella sp. BO2]
 gi|306287926|gb|EFM59343.1| DNA topoisomerase IV, A subunit [Brucella sp. BO2]
          Length = 770

 Score =  955 bits (2469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/759 (60%), Positives = 588/759 (77%), Gaps = 22/759 (2%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           EE+++ V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+   A+ 
Sbjct: 12  EEHIERVDLKSALEERYLAYALSTIMHRALPDVRDGLKPVHRRIMHAMRLLRLNPDQAYA 71

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+V+GK HPHGD S+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTE
Sbjct: 72  KCARIVGDVMGKFHPHGDASIYDALVRLAQDFAVRYPLVDGQGNFGNIDGDNAAAMRYTE 131

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT+VA L+L+G++E+A+DFR TYNEED EP+V P  FPNLLANG++GIAVGMAT+IP 
Sbjct: 132 ARMTEVATLLLEGINENAIDFRPTYNEEDEEPIVLPGAFPNLLANGSAGIAVGMATNIPP 191

Query: 194 HNVQEICEAALALIDNPEISIEKLLEY----------------------IIGPDFPTGGI 231
           HNV E+C +AL LI++P+  +E+L+                        + GPDFPTGGI
Sbjct: 192 HNVAELCSSALYLINHPDAPVEELVTSPEQWAEIEQESKTDPAALLKCKVRGPDFPTGGI 251

Query: 232 IVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELII 291
           +VE   +I+E+YR GRG FRVRARW  EE  RG+W IVVTEIPYQVQKSRLIEKIAEL++
Sbjct: 252 LVEEHGNILEAYRTGRGAFRVRARWHKEEGNRGTWVIVVTEIPYQVQKSRLIEKIAELLL 311

Query: 292 AKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRV 351
           AK++PLL+DIRDESAED+RIVL PKNR++DP+LLMES+F L+++E+R  LNMNVLS G+V
Sbjct: 312 AKKLPLLDDIRDESAEDIRIVLEPKNRTVDPELLMESLFKLTELESRVSLNMNVLSHGKV 371

Query: 352 PQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNED 411
           P V+ L  +L+EWL HR+EVL RRS FR+  I+RR+EIL G LIAYLN+DE+I IIR ED
Sbjct: 372 PNVLSLGAVLREWLEHRKEVLVRRSQFRLAEIERRLEILGGFLIAYLNLDEVIRIIREED 431

Query: 412 KPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQ 471
           +PK  ++  F LT+ Q ++ILN+RLRSLRKLEE++I+ E D+L AEK  ++ LL SG +Q
Sbjct: 432 EPKQELMRAFELTDVQAESILNMRLRSLRKLEEFEIRKEFDDLTAEKTDLEGLLASGTRQ 491

Query: 472 WNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIR 531
           W +I+ EI+ V+E F  +T LG+RRTTF      D   + QAMIE+EP+T+V+S +GW+R
Sbjct: 492 WKKISAEIKAVREKFGPTTRLGKRRTTFAHAPMHDLEDIHQAMIEREPVTIVVSEKGWLR 551

Query: 532 SLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQ 591
           ++K H  D S L FKEGD LK+A HA TTD++L  +T GK +T+ A  L  GRGHGE I+
Sbjct: 552 AMKGHLADFSTLSFKEGDKLKLAFHAETTDKLLFFTTGGKFFTIGANTLPGGRGHGEPIR 611

Query: 592 LLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMK 651
           +L+D+ ++QDI+TAFV+D + KLL+VS +GN FIV ESE +ANTRKGK  + V + ++ K
Sbjct: 612 ILVDMENDQDILTAFVHDPSAKLLLVSHEGNGFIVPESEAVANTRKGKQVMNVKAPDEAK 671

Query: 652 LVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTW 711
           L  +V+GDH+AVVGENRK+L+F +  IPEM+RGKGVRLQ YKDGG+ DV  F I +GL+W
Sbjct: 672 LCQRVSGDHIAVVGENRKMLVFPLSDIPEMTRGKGVRLQKYKDGGVCDVRTFAIADGLSW 731

Query: 712 IDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
            DSA R++NRS+ +L+ W+G R   G LVPKGFPRSGKF
Sbjct: 732 QDSADRTFNRSKEELVEWIGARASAGRLVPKGFPRSGKF 770


>gi|23501641|ref|NP_697768.1| DNA topoisomerase IV subunit A [Brucella suis 1330]
 gi|161618723|ref|YP_001592610.1| DNA topoisomerase IV subunit A [Brucella canis ATCC 23365]
 gi|163843026|ref|YP_001627430.1| DNA topoisomerase IV subunit A [Brucella suis ATCC 23445]
 gi|225852271|ref|YP_002732504.1| DNA topoisomerase IV subunit A [Brucella melitensis ATCC 23457]
 gi|254693501|ref|ZP_05155329.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 3 str. Tulya]
 gi|254701530|ref|ZP_05163358.1| DNA topoisomerase IV subunit A [Brucella suis bv. 5 str. 513]
 gi|254704079|ref|ZP_05165907.1| DNA topoisomerase IV subunit A [Brucella suis bv. 3 str. 686]
 gi|254713872|ref|ZP_05175683.1| DNA topoisomerase IV subunit A [Brucella ceti M644/93/1]
 gi|254717071|ref|ZP_05178882.1| DNA topoisomerase IV subunit A [Brucella ceti M13/05/1]
 gi|256044443|ref|ZP_05447347.1| DNA topoisomerase IV subunit A [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256113287|ref|ZP_05454155.1| DNA topoisomerase IV subunit A [Brucella melitensis bv. 3 str.
           Ether]
 gi|256159485|ref|ZP_05457253.1| DNA topoisomerase IV subunit A [Brucella ceti M490/95/1]
 gi|256254771|ref|ZP_05460307.1| DNA topoisomerase IV subunit A [Brucella ceti B1/94]
 gi|256264222|ref|ZP_05466754.1| DNA topoisomerase IV subunit A [Brucella melitensis bv. 2 str.
           63/9]
 gi|256369187|ref|YP_003106695.1| DNA topoisomerase IV subunit A [Brucella microti CCM 4915]
 gi|260168497|ref|ZP_05755308.1| DNA topoisomerase IV subunit A [Brucella sp. F5/99]
 gi|260563794|ref|ZP_05834280.1| DNA topoisomerase IV subunit A [Brucella melitensis bv. 1 str. 16M]
 gi|260566673|ref|ZP_05837143.1| DNA topoisomerase IV subunit A [Brucella suis bv. 4 str. 40]
 gi|261213760|ref|ZP_05928041.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 3 str. Tulya]
 gi|261218881|ref|ZP_05933162.1| DNA topoisomerase IV subunit A [Brucella ceti M13/05/1]
 gi|261221951|ref|ZP_05936232.1| DNA topoisomerase IV subunit A [Brucella ceti B1/94]
 gi|261321620|ref|ZP_05960817.1| DNA topoisomerase IV subunit A [Brucella ceti M644/93/1]
 gi|261752079|ref|ZP_05995788.1| DNA topoisomerase IV subunit A [Brucella suis bv. 5 str. 513]
 gi|261754738|ref|ZP_05998447.1| DNA topoisomerase IV subunit A [Brucella suis bv. 3 str. 686]
 gi|261757966|ref|ZP_06001675.1| DNA topoisomerase IV subunit A [Brucella sp. F5/99]
 gi|265990864|ref|ZP_06103421.1| DNA topoisomerase IV subunit A [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994700|ref|ZP_06107257.1| DNA topoisomerase IV subunit A [Brucella melitensis bv. 3 str.
           Ether]
 gi|265997914|ref|ZP_06110471.1| DNA topoisomerase IV subunit A [Brucella ceti M490/95/1]
 gi|294852118|ref|ZP_06792791.1| DNA topoisomerase IV [Brucella sp. NVSL 07-0026]
 gi|23347560|gb|AAN29683.1| DNA topoisomerase IV, A subunit [Brucella suis 1330]
 gi|161335534|gb|ABX61839.1| DNA topoisomerase IV, A subunit [Brucella canis ATCC 23365]
 gi|163673749|gb|ABY37860.1| DNA topoisomerase IV, A subunit [Brucella suis ATCC 23445]
 gi|225640636|gb|ACO00550.1| DNA topoisomerase IV, A subunit [Brucella melitensis ATCC 23457]
 gi|255999347|gb|ACU47746.1| DNA topoisomerase IV subunit A [Brucella microti CCM 4915]
 gi|260153810|gb|EEW88902.1| DNA topoisomerase IV subunit A [Brucella melitensis bv. 1 str. 16M]
 gi|260156191|gb|EEW91271.1| DNA topoisomerase IV subunit A [Brucella suis bv. 4 str. 40]
 gi|260915367|gb|EEX82228.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 3 str. Tulya]
 gi|260920535|gb|EEX87188.1| DNA topoisomerase IV subunit A [Brucella ceti B1/94]
 gi|260923970|gb|EEX90538.1| DNA topoisomerase IV subunit A [Brucella ceti M13/05/1]
 gi|261294310|gb|EEX97806.1| DNA topoisomerase IV subunit A [Brucella ceti M644/93/1]
 gi|261737950|gb|EEY25946.1| DNA topoisomerase IV subunit A [Brucella sp. F5/99]
 gi|261741832|gb|EEY29758.1| DNA topoisomerase IV subunit A [Brucella suis bv. 5 str. 513]
 gi|261744491|gb|EEY32417.1| DNA topoisomerase IV subunit A [Brucella suis bv. 3 str. 686]
 gi|262552382|gb|EEZ08372.1| DNA topoisomerase IV subunit A [Brucella ceti M490/95/1]
 gi|262765813|gb|EEZ11602.1| DNA topoisomerase IV subunit A [Brucella melitensis bv. 3 str.
           Ether]
 gi|263001648|gb|EEZ14223.1| DNA topoisomerase IV subunit A [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094467|gb|EEZ18289.1| DNA topoisomerase IV subunit A [Brucella melitensis bv. 2 str.
           63/9]
 gi|294820707|gb|EFG37706.1| DNA topoisomerase IV [Brucella sp. NVSL 07-0026]
 gi|326408776|gb|ADZ65841.1| DNA topoisomerase IV subunit A [Brucella melitensis M28]
 gi|326538494|gb|ADZ86709.1| DNA topoisomerase IV, A subunit [Brucella melitensis M5-90]
          Length = 770

 Score =  954 bits (2467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/759 (59%), Positives = 588/759 (77%), Gaps = 22/759 (2%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           EE+++ V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+   A+ 
Sbjct: 12  EEHIERVDLKSALEERYLAYALSTIMHRALPDVRDGLKPVHRRIMHAMRLLRLNPDQAYA 71

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+V+GK HPHGD S+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTE
Sbjct: 72  KCARIVGDVMGKFHPHGDASIYDALVRLAQDFAVRYPLVDGQGNFGNIDGDNAAAMRYTE 131

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT+VA L+L+G++E+A+DFR TYNEED EP+V P  FPNLLANG++GIAVGMAT+IP 
Sbjct: 132 ARMTEVATLLLEGINENAIDFRPTYNEEDEEPIVLPGAFPNLLANGSAGIAVGMATNIPP 191

Query: 194 HNVQEICEAALALIDNPEISIEKLLEY----------------------IIGPDFPTGGI 231
           HNV E+C +AL LI++P+  +E+L+                        + GPDFPTGGI
Sbjct: 192 HNVAELCSSALYLINHPDAPVEELVTSPEQWAEIEQESKTDPAALLKCKVRGPDFPTGGI 251

Query: 232 IVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELII 291
           +VE   +I+E+YR GRG FRVRARW  EE  RG+W IVVTEIPYQVQKSRLIEKIAEL++
Sbjct: 252 LVEEHGNILEAYRTGRGAFRVRARWHKEEGNRGTWVIVVTEIPYQVQKSRLIEKIAELLL 311

Query: 292 AKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRV 351
           AK++PLL+DIRDESAED+RIVL PKNR++DP+LLMES+F L+++E+R  LNMNVLS G+V
Sbjct: 312 AKKLPLLDDIRDESAEDIRIVLEPKNRTVDPELLMESLFKLTELESRVSLNMNVLSHGKV 371

Query: 352 PQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNED 411
           P V+ L  +L+EWL HR+EVL RRS FR+  I++R+EIL G LIAYLN+DE+I IIR ED
Sbjct: 372 PNVLSLGAVLREWLEHRKEVLVRRSQFRLAEIEKRLEILGGFLIAYLNLDEVIRIIREED 431

Query: 412 KPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQ 471
           +PK  ++  F LT+ Q ++ILN+RLRSLRKLEE++I+ E D+L AEK  ++ LL SG +Q
Sbjct: 432 EPKQELMRAFELTDVQAESILNMRLRSLRKLEEFEIRKEFDDLTAEKTDLEGLLASGTRQ 491

Query: 472 WNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIR 531
           W +I+ EI+ V+E F  +T LG+RRTTF      D   + QAMIE+EP+T+V+S +GW+R
Sbjct: 492 WKKISTEIKAVREKFGPTTRLGKRRTTFAHAPTHDLEDIHQAMIEREPVTIVVSEKGWLR 551

Query: 532 SLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQ 591
           ++K H  D S L FKEGD LK+A HA TTD++L  +T GK +T+ A  L  GRGHGE I+
Sbjct: 552 AMKGHLADFSTLSFKEGDKLKLAFHAETTDKLLFFTTGGKFFTIGANTLPGGRGHGEPIR 611

Query: 592 LLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMK 651
           +L+D+ ++QDI+TAFV+D + KLL+VS +GN FIV ESE +ANTRKGK  + V + ++ K
Sbjct: 612 ILVDMENDQDILTAFVHDPSAKLLLVSHEGNGFIVPESEAVANTRKGKQVMNVKAPDEAK 671

Query: 652 LVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTW 711
           L  +V+GDH+AVVGENRK+L+F +  IPEM+RGKGVRLQ YKDGG+ DV  F I +GL+W
Sbjct: 672 LCQRVSGDHIAVVGENRKMLVFPLSDIPEMTRGKGVRLQKYKDGGVCDVRTFAIADGLSW 731

Query: 712 IDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
            DSA R++NRS+ +L+ W+G R   G LVPKGFPRSGKF
Sbjct: 732 QDSADRTFNRSKEELVEWIGARASAGRLVPKGFPRSGKF 770


>gi|17987483|ref|NP_540117.1| DNA topoisomerase IV subunit A [Brucella melitensis bv. 1 str. 16M]
 gi|225627254|ref|ZP_03785291.1| DNA topoisomerase IV, A subunit [Brucella ceti str. Cudo]
 gi|17983180|gb|AAL52381.1| topoisomerase iv subunit a [Brucella melitensis bv. 1 str. 16M]
 gi|225617259|gb|EEH14304.1| DNA topoisomerase IV, A subunit [Brucella ceti str. Cudo]
          Length = 775

 Score =  954 bits (2466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/759 (59%), Positives = 588/759 (77%), Gaps = 22/759 (2%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           EE+++ V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+   A+ 
Sbjct: 17  EEHIERVDLKSALEERYLAYALSTIMHRALPDVRDGLKPVHRRIMHAMRLLRLNPDQAYA 76

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+V+GK HPHGD S+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTE
Sbjct: 77  KCARIVGDVMGKFHPHGDASIYDALVRLAQDFAVRYPLVDGQGNFGNIDGDNAAAMRYTE 136

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT+VA L+L+G++E+A+DFR TYNEED EP+V P  FPNLLANG++GIAVGMAT+IP 
Sbjct: 137 ARMTEVATLLLEGINENAIDFRPTYNEEDEEPIVLPGAFPNLLANGSAGIAVGMATNIPP 196

Query: 194 HNVQEICEAALALIDNPEISIEKLLEY----------------------IIGPDFPTGGI 231
           HNV E+C +AL LI++P+  +E+L+                        + GPDFPTGGI
Sbjct: 197 HNVAELCSSALYLINHPDAPVEELVTSPEQWAEIEQESKTDPAALLKCKVRGPDFPTGGI 256

Query: 232 IVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELII 291
           +VE   +I+E+YR GRG FRVRARW  EE  RG+W IVVTEIPYQVQKSRLIEKIAEL++
Sbjct: 257 LVEEHGNILEAYRTGRGAFRVRARWHKEEGNRGTWVIVVTEIPYQVQKSRLIEKIAELLL 316

Query: 292 AKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRV 351
           AK++PLL+DIRDESAED+RIVL PKNR++DP+LLMES+F L+++E+R  LNMNVLS G+V
Sbjct: 317 AKKLPLLDDIRDESAEDIRIVLEPKNRTVDPELLMESLFKLTELESRVSLNMNVLSHGKV 376

Query: 352 PQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNED 411
           P V+ L  +L+EWL HR+EVL RRS FR+  I++R+EIL G LIAYLN+DE+I IIR ED
Sbjct: 377 PNVLSLGAVLREWLEHRKEVLVRRSQFRLAEIEKRLEILGGFLIAYLNLDEVIRIIREED 436

Query: 412 KPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQ 471
           +PK  ++  F LT+ Q ++ILN+RLRSLRKLEE++I+ E D+L AEK  ++ LL SG +Q
Sbjct: 437 EPKQELMRAFELTDVQAESILNMRLRSLRKLEEFEIRKEFDDLTAEKTDLEGLLASGTRQ 496

Query: 472 WNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIR 531
           W +I+ EI+ V+E F  +T LG+RRTTF      D   + QAMIE+EP+T+V+S +GW+R
Sbjct: 497 WKKISTEIKAVREKFGPTTRLGKRRTTFAHAPTHDLEDIHQAMIEREPVTIVVSEKGWLR 556

Query: 532 SLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQ 591
           ++K H  D S L FKEGD LK+A HA TTD++L  +T GK +T+ A  L  GRGHGE I+
Sbjct: 557 AMKGHLADFSTLSFKEGDKLKLAFHAETTDKLLFFTTGGKFFTIGANTLPGGRGHGEPIR 616

Query: 592 LLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMK 651
           +L+D+ ++QDI+TAFV+D + KLL+VS +GN FIV ESE +ANTRKGK  + V + ++ K
Sbjct: 617 ILVDMENDQDILTAFVHDPSAKLLLVSHEGNGFIVPESEAVANTRKGKQVMNVKAPDEAK 676

Query: 652 LVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTW 711
           L  +V+GDH+AVVGENRK+L+F +  IPEM+RGKGVRLQ YKDGG+ DV  F I +GL+W
Sbjct: 677 LCQRVSGDHIAVVGENRKMLVFPLSDIPEMTRGKGVRLQKYKDGGVCDVRTFAIADGLSW 736

Query: 712 IDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
            DSA R++NRS+ +L+ W+G R   G LVPKGFPRSGKF
Sbjct: 737 QDSADRTFNRSKEELVEWIGARASAGRLVPKGFPRSGKF 775


>gi|254689018|ref|ZP_05152272.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 6 str. 870]
 gi|256257268|ref|ZP_05462804.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 9 str. C68]
 gi|260754512|ref|ZP_05866860.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 6 str. 870]
 gi|260883541|ref|ZP_05895155.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 9 str. C68]
 gi|260674620|gb|EEX61441.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 6 str. 870]
 gi|260873069|gb|EEX80138.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 9 str. C68]
          Length = 770

 Score =  953 bits (2464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/759 (59%), Positives = 588/759 (77%), Gaps = 22/759 (2%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           EE+++ V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+   A+ 
Sbjct: 12  EEHIERVDLKSALEERYLAYALSTIMHRALPDVRDGLKPVHRRIMHAMRLLRLNPDQAYA 71

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+V+GK HPHGD S+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTE
Sbjct: 72  KCARIVGDVMGKFHPHGDASIYDALVRLAQDFAVRYPLVDGQGNFGNIDGDNAAAMRYTE 131

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT+VA L+L+G++E+A+DFR TYNEED EP+V P  FPNLLANG++GIAVGMAT+IP 
Sbjct: 132 ARMTEVATLLLEGINENAIDFRPTYNEEDEEPIVLPGAFPNLLANGSAGIAVGMATNIPP 191

Query: 194 HNVQEICEAALALIDNPEISIEKLLEY----------------------IIGPDFPTGGI 231
           HNV E+C +AL LI++P+  +E+L+                        + GPDFPTGGI
Sbjct: 192 HNVAELCSSALYLINHPDAPVEELVTSPEQWAEIEQESKTDPAALLKCKVRGPDFPTGGI 251

Query: 232 IVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELII 291
           +VE   +I+E+YR GRG FRVRARW  EE  RG+W IVVTEIPYQVQKSRLIEKIAEL++
Sbjct: 252 LVEEHGNILEAYRTGRGAFRVRARWHKEEGNRGTWVIVVTEIPYQVQKSRLIEKIAELLL 311

Query: 292 AKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRV 351
           AK++PLL+DIRDESAED+RIVL PKNR++DP+LLMES+F L+++E+R  LNMNVLS G+V
Sbjct: 312 AKKLPLLDDIRDESAEDIRIVLEPKNRTVDPELLMESLFKLTELESRVSLNMNVLSHGKV 371

Query: 352 PQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNED 411
           P V+ L  +L+EWL HR+EVL RRS FR+  I++R+EIL G LIAYLN+DE+I IIR ED
Sbjct: 372 PNVLSLGAVLREWLEHRKEVLVRRSQFRLAEIEKRLEILGGFLIAYLNLDEVIRIIREED 431

Query: 412 KPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQ 471
           +PK  ++  F LT+ Q ++ILN+RLRSLRKLEE++I+ E D+L AEK  ++ LL SG +Q
Sbjct: 432 EPKQELMRVFELTDVQAESILNMRLRSLRKLEEFEIRKEFDDLTAEKTDLEGLLASGTRQ 491

Query: 472 WNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIR 531
           W +I+ EI+ V+E F  +T LG+RRTTF      D   + QAMIE+EP+T+V+S +GW+R
Sbjct: 492 WKKISTEIKAVREKFGPTTRLGKRRTTFAHAPTHDLEDIHQAMIEREPVTIVVSEKGWLR 551

Query: 532 SLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQ 591
           ++K H  D S L FKEGD LK+A HA TTD++L  +T GK +T+ A  L  GRGHGE I+
Sbjct: 552 AMKGHLADFSTLSFKEGDKLKLAFHAETTDKLLFFTTGGKFFTIGANTLPGGRGHGEPIR 611

Query: 592 LLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMK 651
           +L+D+ ++QDI+TAFV+D + KLL+VS +GN FIV ESE +ANTRKGK  + V + ++ K
Sbjct: 612 ILVDMENDQDILTAFVHDPSAKLLLVSHEGNGFIVPESEAVANTRKGKQVMNVKAPDEAK 671

Query: 652 LVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTW 711
           L  +V+GDH+AVVGENRK+L+F +  IPEM+RGKGVRLQ YKDGG+ DV  F I +GL+W
Sbjct: 672 LCQRVSGDHIAVVGENRKMLVFPLSDIPEMTRGKGVRLQKYKDGGVCDVRTFAIADGLSW 731

Query: 712 IDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
            DSA R++NRS+ +L+ W+G R   G LVPKGFPRSGKF
Sbjct: 732 QDSADRTFNRSKEELVEWIGARASAGRLVPKGFPRSGKF 770


>gi|62289707|ref|YP_221500.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 1 str. 9-941]
 gi|82699636|ref|YP_414210.1| DNA topoisomerase IV subunit A [Brucella melitensis biovar Abortus
           2308]
 gi|189023956|ref|YP_001934724.1| DNA topoisomerase IV subunit A [Brucella abortus S19]
 gi|254697153|ref|ZP_05158981.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730049|ref|ZP_05188627.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 4 str. 292]
 gi|260545538|ref|ZP_05821279.1| DNA topoisomerase IV subunit A [Brucella abortus NCTC 8038]
 gi|260757733|ref|ZP_05870081.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 4 str. 292]
 gi|260761558|ref|ZP_05873901.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 2 str.
           86/8/59]
 gi|62195839|gb|AAX74139.1| ParC, DNA topoisomerase IV, A subunit [Brucella abortus bv. 1 str.
           9-941]
 gi|82615737|emb|CAJ10733.1| DNA gyrase/topoisomerase IV, subunit A:Gram negative topoisomerase
           IV, subunit A:DNA gyrase C-terminal repeat,
           beta-propeller [Brucella melitensis biovar Abortus 2308]
 gi|189019528|gb|ACD72250.1| DNA topoisomerase IV subunit A [Brucella abortus S19]
 gi|260096945|gb|EEW80820.1| DNA topoisomerase IV subunit A [Brucella abortus NCTC 8038]
 gi|260668051|gb|EEX54991.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 4 str. 292]
 gi|260671990|gb|EEX58811.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 2 str.
           86/8/59]
          Length = 770

 Score =  953 bits (2463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/759 (59%), Positives = 588/759 (77%), Gaps = 22/759 (2%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           EE+++ V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+   A+ 
Sbjct: 12  EEHIERVDLKSALEERYLAYALSTIMHRALPDVRDGLKPVHRRIMHAMRLLRLNPDQAYA 71

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+V+GK HPHGD S+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTE
Sbjct: 72  KCARIVGDVMGKFHPHGDASIYDALVRLAQDFAVRYPLVDGQGNFGNIDGDNAAAMRYTE 131

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT+VA L+L+G++E+A+DFR TYNEED EP+V P  FPNLLANG++GIAVGMAT+IP 
Sbjct: 132 ARMTEVATLLLEGINENAIDFRPTYNEEDEEPIVLPGAFPNLLANGSAGIAVGMATNIPP 191

Query: 194 HNVQEICEAALALIDNPEISIEKLLEY----------------------IIGPDFPTGGI 231
           HNV E+C +AL LI++P+  +E+L+                        + GPDFPTGGI
Sbjct: 192 HNVAELCSSALYLINHPDAPVEELVTSPEQWAEIEQESKTDPAALLKCKVRGPDFPTGGI 251

Query: 232 IVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELII 291
           +VE   +I+E+YR GRG FRVRARW  EE  RG+W IVVTEIPYQVQKSRLIEKIAEL++
Sbjct: 252 LVEEHGNILEAYRTGRGAFRVRARWHKEEGNRGTWVIVVTEIPYQVQKSRLIEKIAELLL 311

Query: 292 AKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRV 351
           AK++PLL+DIRDESAED+RIVL PKNR++DP+LLMES+F L+++E+R  LNMNVLS G+V
Sbjct: 312 AKKLPLLDDIRDESAEDIRIVLEPKNRTVDPELLMESLFKLTELESRVSLNMNVLSHGKV 371

Query: 352 PQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNED 411
           P V+ L  +L+EWL HR+EVL RRS FR+  I++R+EIL G LIAYLN+DE+I IIR ED
Sbjct: 372 PNVLSLGAVLREWLEHRKEVLVRRSQFRLAEIEKRLEILGGFLIAYLNLDEVIRIIREED 431

Query: 412 KPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQ 471
           +PK  ++  F LT+ Q ++ILN+RLRSLRKLEE++I+ E D+L AEK  ++ LL SG +Q
Sbjct: 432 EPKQELMRVFELTDVQAESILNMRLRSLRKLEEFEIRKEFDDLTAEKTDLEGLLASGTRQ 491

Query: 472 WNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIR 531
           W +I+ EI+ V+E F  +T LG+RRTTF      D   + QAMIE+EP+T+V+S +GW+R
Sbjct: 492 WKKISTEIKAVREKFGPTTRLGKRRTTFAHAPTHDLEDIHQAMIEREPVTIVVSEKGWLR 551

Query: 532 SLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQ 591
           ++K H  D S L FKEGD LK+A HA TTD++L  +T GK +T+ A  L  GRGHGE I+
Sbjct: 552 AMKGHLADFSTLSFKEGDKLKLAFHAETTDKLLFFTTGGKFFTIGANTLPGGRGHGEPIR 611

Query: 592 LLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMK 651
           +L+D+ ++QDI+TAFV+D + KLL+VS +GN FIV ESE +ANTRKGK  + V + ++ K
Sbjct: 612 ILVDMENDQDILTAFVHDPSAKLLLVSHEGNGFIVPESEAVANTRKGKQVMNVKAPDEAK 671

Query: 652 LVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTW 711
           L  +V+GDH+AVVGENRK+L+F +  IPEM+RGKGVRLQ YKDGG+ DV  F I +GL+W
Sbjct: 672 LCQRVSGDHIAVVGENRKMLVFPLSDIPEMTRGKGVRLQKYKDGGVCDVRSFAIADGLSW 731

Query: 712 IDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
            DSA R++NRS+ +L+ W+G R   G LVPKGFPRSGKF
Sbjct: 732 QDSADRTFNRSKEELVEWIGARASAGRLVPKGFPRSGKF 770


>gi|297248114|ref|ZP_06931832.1| DNA topoisomerase IV, A subunit [Brucella abortus bv. 5 str. B3196]
 gi|297175283|gb|EFH34630.1| DNA topoisomerase IV, A subunit [Brucella abortus bv. 5 str. B3196]
          Length = 775

 Score =  953 bits (2463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/759 (59%), Positives = 588/759 (77%), Gaps = 22/759 (2%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           EE+++ V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+   A+ 
Sbjct: 17  EEHIERVDLKSALEERYLAYALSTIMHRALPDVRDGLKPVHRRIMHAMRLLRLNPDQAYA 76

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+V+GK HPHGD S+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTE
Sbjct: 77  KCARIVGDVMGKFHPHGDASIYDALVRLAQDFAVRYPLVDGQGNFGNIDGDNAAAMRYTE 136

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT+VA L+L+G++E+A+DFR TYNEED EP+V P  FPNLLANG++GIAVGMAT+IP 
Sbjct: 137 ARMTEVATLLLEGINENAIDFRPTYNEEDEEPIVLPGAFPNLLANGSAGIAVGMATNIPP 196

Query: 194 HNVQEICEAALALIDNPEISIEKLLEY----------------------IIGPDFPTGGI 231
           HNV E+C +AL LI++P+  +E+L+                        + GPDFPTGGI
Sbjct: 197 HNVAELCSSALYLINHPDAPVEELVTSPEQWAEIEQESKTDPAALLKCKVRGPDFPTGGI 256

Query: 232 IVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELII 291
           +VE   +I+E+YR GRG FRVRARW  EE  RG+W IVVTEIPYQVQKSRLIEKIAEL++
Sbjct: 257 LVEEHGNILEAYRTGRGAFRVRARWHKEEGNRGTWVIVVTEIPYQVQKSRLIEKIAELLL 316

Query: 292 AKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRV 351
           AK++PLL+DIRDESAED+RIVL PKNR++DP+LLMES+F L+++E+R  LNMNVLS G+V
Sbjct: 317 AKKLPLLDDIRDESAEDIRIVLEPKNRTVDPELLMESLFKLTELESRVSLNMNVLSHGKV 376

Query: 352 PQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNED 411
           P V+ L  +L+EWL HR+EVL RRS FR+  I++R+EIL G LIAYLN+DE+I IIR ED
Sbjct: 377 PNVLSLGAVLREWLEHRKEVLVRRSQFRLAEIEKRLEILGGFLIAYLNLDEVIRIIREED 436

Query: 412 KPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQ 471
           +PK  ++  F LT+ Q ++ILN+RLRSLRKLEE++I+ E D+L AEK  ++ LL SG +Q
Sbjct: 437 EPKQELMRVFELTDVQAESILNMRLRSLRKLEEFEIRKEFDDLTAEKTDLEGLLASGTRQ 496

Query: 472 WNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIR 531
           W +I+ EI+ V+E F  +T LG+RRTTF      D   + QAMIE+EP+T+V+S +GW+R
Sbjct: 497 WKKISTEIKAVREKFGPTTRLGKRRTTFAHAPTHDLEDIHQAMIEREPVTIVVSEKGWLR 556

Query: 532 SLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQ 591
           ++K H  D S L FKEGD LK+A HA TTD++L  +T GK +T+ A  L  GRGHGE I+
Sbjct: 557 AMKGHLADFSTLSFKEGDKLKLAFHAETTDKLLFFTTGGKFFTIGANTLPGGRGHGEPIR 616

Query: 592 LLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMK 651
           +L+D+ ++QDI+TAFV+D + KLL+VS +GN FIV ESE +ANTRKGK  + V + ++ K
Sbjct: 617 ILVDMENDQDILTAFVHDPSAKLLLVSHEGNGFIVPESEAVANTRKGKQVMNVKAPDEAK 676

Query: 652 LVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTW 711
           L  +V+GDH+AVVGENRK+L+F +  IPEM+RGKGVRLQ YKDGG+ DV  F I +GL+W
Sbjct: 677 LCQRVSGDHIAVVGENRKMLVFPLSDIPEMTRGKGVRLQKYKDGGVCDVRTFAIADGLSW 736

Query: 712 IDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
            DSA R++NRS+ +L+ W+G R   G LVPKGFPRSGKF
Sbjct: 737 QDSADRTFNRSKEELVEWIGARASAGRLVPKGFPRSGKF 775


>gi|239831581|ref|ZP_04679910.1| DNA topoisomerase IV, A subunit [Ochrobactrum intermedium LMG 3301]
 gi|239823848|gb|EEQ95416.1| DNA topoisomerase IV, A subunit [Ochrobactrum intermedium LMG 3301]
          Length = 787

 Score =  953 bits (2463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/759 (59%), Positives = 588/759 (77%), Gaps = 22/759 (2%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           EE+++ V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+   A+ 
Sbjct: 29  EEHIERVDLKSALEERYLAYALSTIMHRALPDVRDGLKPVHRRIMHAMRLLRLNPDQAYA 88

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+V+GK HPHGD S+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTE
Sbjct: 89  KCARIVGDVMGKFHPHGDASIYDALVRLAQDFAVRYPLVDGQGNFGNIDGDNAAAMRYTE 148

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT+VA L+L+G++E+A+DFR TYNEED EP+V P  FPNLLANG++GIAVGMAT+IP 
Sbjct: 149 ARMTEVATLLLEGINENAIDFRPTYNEEDEEPIVLPGAFPNLLANGSAGIAVGMATNIPP 208

Query: 194 HNVQEICEAALALIDNPEISIEKLLEY----------------------IIGPDFPTGGI 231
           HNV E+C +AL LI++PE  +E+L+                        + GPDFPTGGI
Sbjct: 209 HNVAELCSSALYLINHPEAPVEELVTSPEQWEELKREAETDPAALLKCKVRGPDFPTGGI 268

Query: 232 IVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELII 291
           +VE   +I+++YR GRG FRVRARW  EE  RG+W IV+TEIPYQVQKSRLIEKIAEL++
Sbjct: 269 LVEEHGNILDAYRTGRGAFRVRARWEKEEGNRGTWVIVITEIPYQVQKSRLIEKIAELLL 328

Query: 292 AKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRV 351
           AK++PLL+D+RDESAED+RIVL PKNR++DP+LLMES+F L+++E+R  LNMNVLS G+V
Sbjct: 329 AKKLPLLDDVRDESAEDIRIVLEPKNRTVDPELLMESLFKLTELESRVSLNMNVLSHGKV 388

Query: 352 PQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNED 411
           P V+ L  +L+EWL HR+EVL RRS FR+  I+RR+EIL GLLIAYLN+DE+I IIR ED
Sbjct: 389 PNVLSLGAVLREWLDHRKEVLVRRSQFRLAEIERRLEILGGLLIAYLNLDEVIRIIREED 448

Query: 412 KPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQ 471
           +PK  ++  F LT+ Q ++ILN+RLRSLRKLEE++I+ E D+L  EK  ++ LL SG +Q
Sbjct: 449 EPKQDLMRTFELTDVQAESILNMRLRSLRKLEEFEIRKEFDDLTVEKTDLEGLLASGTRQ 508

Query: 472 WNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIR 531
           W +I+ EI+ V+E F   T+LG RRTTF +    D   + QAMIE+EP+T+V+S +GW+R
Sbjct: 509 WKKISAEIKSVREKFGPKTELGARRTTFADAPTHDLEDIHQAMIEREPVTIVVSEKGWLR 568

Query: 532 SLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQ 591
           ++K H  D S L FKEGD LK+A HA TTD++L  +T GK +T+ A  L  GRGHGE I+
Sbjct: 569 AMKGHLADFSTLAFKEGDKLKLAFHAETTDKLLFFTTGGKFFTIGANTLPGGRGHGEPIR 628

Query: 592 LLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMK 651
           +L+D+ ++QDI+TAFV+D   KLL+VS +GN FIV ESE +ANTRKGK  + V + ++ K
Sbjct: 629 ILVDMENDQDILTAFVHDPAAKLLLVSHEGNGFIVPESEAVANTRKGKQVMNVKAPDEAK 688

Query: 652 LVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTW 711
           L  +V+GDH+AVVGENRK+++F +  IPEM+RGKGVRLQ YKDGG+SDV  F I EGL+W
Sbjct: 689 LCQRVSGDHIAVVGENRKMVVFPLSDIPEMTRGKGVRLQKYKDGGVSDVRTFAIAEGLSW 748

Query: 712 IDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
            DSA R++NRS+ +L+ W+G R   G LVPKGFPRSGKF
Sbjct: 749 QDSAERTFNRSKEELVEWIGARASAGRLVPKGFPRSGKF 787


>gi|237815195|ref|ZP_04594193.1| DNA topoisomerase IV, A subunit [Brucella abortus str. 2308 A]
 gi|237790032|gb|EEP64242.1| DNA topoisomerase IV, A subunit [Brucella abortus str. 2308 A]
          Length = 775

 Score =  952 bits (2462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/759 (59%), Positives = 588/759 (77%), Gaps = 22/759 (2%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           EE+++ V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+   A+ 
Sbjct: 17  EEHIERVDLKSALEERYLAYALSTIMHRALPDVRDGLKPVHRRIMHAMRLLRLNPDQAYA 76

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+V+GK HPHGD S+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTE
Sbjct: 77  KCARIVGDVMGKFHPHGDASIYDALVRLAQDFAVRYPLVDGQGNFGNIDGDNAAAMRYTE 136

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT+VA L+L+G++E+A+DFR TYNEED EP+V P  FPNLLANG++GIAVGMAT+IP 
Sbjct: 137 ARMTEVATLLLEGINENAIDFRPTYNEEDEEPIVLPGAFPNLLANGSAGIAVGMATNIPP 196

Query: 194 HNVQEICEAALALIDNPEISIEKLLEY----------------------IIGPDFPTGGI 231
           HNV E+C +AL LI++P+  +E+L+                        + GPDFPTGGI
Sbjct: 197 HNVAELCSSALYLINHPDAPVEELVTSPEQWAEIEQESKTDPAALLKCKVRGPDFPTGGI 256

Query: 232 IVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELII 291
           +VE   +I+E+YR GRG FRVRARW  EE  RG+W IVVTEIPYQVQKSRLIEKIAEL++
Sbjct: 257 LVEEHGNILEAYRTGRGAFRVRARWHKEEGNRGTWVIVVTEIPYQVQKSRLIEKIAELLL 316

Query: 292 AKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRV 351
           AK++PLL+DIRDESAED+RIVL PKNR++DP+LLMES+F L+++E+R  LNMNVLS G+V
Sbjct: 317 AKKLPLLDDIRDESAEDIRIVLEPKNRTVDPELLMESLFKLTELESRVSLNMNVLSHGKV 376

Query: 352 PQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNED 411
           P V+ L  +L+EWL HR+EVL RRS FR+  I++R+EIL G LIAYLN+DE+I IIR ED
Sbjct: 377 PNVLSLGAVLREWLEHRKEVLVRRSQFRLAEIEKRLEILGGFLIAYLNLDEVIRIIREED 436

Query: 412 KPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQ 471
           +PK  ++  F LT+ Q ++ILN+RLRSLRKLEE++I+ E D+L AEK  ++ LL SG +Q
Sbjct: 437 EPKQELMRVFELTDVQAESILNMRLRSLRKLEEFEIRKEFDDLTAEKTDLEGLLASGTRQ 496

Query: 472 WNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIR 531
           W +I+ EI+ V+E F  +T LG+RRTTF      D   + QAMIE+EP+T+V+S +GW+R
Sbjct: 497 WKKISTEIKAVREKFGPTTRLGKRRTTFAHAPTHDLEDIHQAMIEREPVTIVVSEKGWLR 556

Query: 532 SLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQ 591
           ++K H  D S L FKEGD LK+A HA TTD++L  +T GK +T+ A  L  GRGHGE I+
Sbjct: 557 AMKGHLADFSTLSFKEGDKLKLAFHAETTDKLLFFTTGGKFFTIGANTLPGGRGHGEPIR 616

Query: 592 LLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMK 651
           +L+D+ ++QDI+TAFV+D + KLL+VS +GN FIV ESE +ANTRKGK  + V + ++ K
Sbjct: 617 ILVDMENDQDILTAFVHDPSAKLLLVSHEGNGFIVPESEAVANTRKGKQVMNVKAPDEAK 676

Query: 652 LVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTW 711
           L  +V+GDH+AVVGENRK+L+F +  IPEM+RGKGVRLQ YKDGG+ DV  F I +GL+W
Sbjct: 677 LCQRVSGDHIAVVGENRKMLVFPLSDIPEMTRGKGVRLQKYKDGGVCDVRSFAIADGLSW 736

Query: 712 IDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
            DSA R++NRS+ +L+ W+G R   G LVPKGFPRSGKF
Sbjct: 737 QDSADRTFNRSKEELVEWIGARASAGRLVPKGFPRSGKF 775


>gi|254707020|ref|ZP_05168848.1| DNA topoisomerase IV subunit A [Brucella pinnipedialis M163/99/10]
 gi|254709871|ref|ZP_05171682.1| DNA topoisomerase IV subunit A [Brucella pinnipedialis B2/94]
 gi|256031363|ref|ZP_05444977.1| DNA topoisomerase IV subunit A [Brucella pinnipedialis M292/94/1]
 gi|261314487|ref|ZP_05953684.1| DNA topoisomerase IV subunit A [Brucella pinnipedialis M163/99/10]
 gi|261317413|ref|ZP_05956610.1| DNA topoisomerase IV subunit A [Brucella pinnipedialis B2/94]
 gi|265988450|ref|ZP_06101007.1| DNA topoisomerase IV subunit A [Brucella pinnipedialis M292/94/1]
 gi|261296636|gb|EEY00133.1| DNA topoisomerase IV subunit A [Brucella pinnipedialis B2/94]
 gi|261303513|gb|EEY07010.1| DNA topoisomerase IV subunit A [Brucella pinnipedialis M163/99/10]
 gi|264660647|gb|EEZ30908.1| DNA topoisomerase IV subunit A [Brucella pinnipedialis M292/94/1]
          Length = 770

 Score =  951 bits (2459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/759 (59%), Positives = 587/759 (77%), Gaps = 22/759 (2%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           EE+++ V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+   A+ 
Sbjct: 12  EEHIERVDLKSALEERYLAYALSTIMHRALPDVRDGLKPVHRRIMHAMRLLRLNPDQAYA 71

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+V+GK HPHGD S+YD+LVRLA  F  RYPL+ GQGNFGNIDGD+AAA RYTE
Sbjct: 72  KCARIVGDVMGKFHPHGDASIYDALVRLALDFAVRYPLVDGQGNFGNIDGDNAAAMRYTE 131

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT+VA L+L+G++E+A+DFR TYNEED EP+V P  FPNLLANG++GIAVGMAT+IP 
Sbjct: 132 ARMTEVATLLLEGINENAIDFRPTYNEEDEEPIVLPGAFPNLLANGSAGIAVGMATNIPP 191

Query: 194 HNVQEICEAALALIDNPEISIEKLLEY----------------------IIGPDFPTGGI 231
           HNV E+C +AL LI++P+  +E+L+                        + GPDFPTGGI
Sbjct: 192 HNVAELCSSALYLINHPDAPVEELVTSPEQWAEIEQESKTDPAALLKCKVRGPDFPTGGI 251

Query: 232 IVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELII 291
           +VE   +I+E+YR GRG FRVRARW  EE  RG+W IVVTEIPYQVQKSRLIEKIAEL++
Sbjct: 252 LVEEHGNILEAYRTGRGAFRVRARWHKEEGNRGTWVIVVTEIPYQVQKSRLIEKIAELLL 311

Query: 292 AKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRV 351
           AK++PLL+DIRDESAED+RIVL PKNR++DP+LLMES+F L+++E+R  LNMNVLS G+V
Sbjct: 312 AKKLPLLDDIRDESAEDIRIVLEPKNRTVDPELLMESLFKLTELESRVSLNMNVLSHGKV 371

Query: 352 PQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNED 411
           P V+ L  +L+EWL HR+EVL RRS FR+  I++R+EIL G LIAYLN+DE+I IIR ED
Sbjct: 372 PNVLSLGAVLREWLEHRKEVLVRRSQFRLAEIEKRLEILGGFLIAYLNLDEVIRIIREED 431

Query: 412 KPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQ 471
           +PK  ++  F LT+ Q ++ILN+RLRSLRKLEE++I+ E D+L AEK  ++ LL SG +Q
Sbjct: 432 EPKQELMRAFELTDVQAESILNMRLRSLRKLEEFEIRKEFDDLTAEKTDLEGLLASGTRQ 491

Query: 472 WNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIR 531
           W +I+ EI+ V+E F  +T LG+RRTTF      D   + QAMIE+EP+T+V+S +GW+R
Sbjct: 492 WKKISTEIKAVREKFGPTTRLGKRRTTFAHAPTHDLEDIHQAMIEREPVTIVVSEKGWLR 551

Query: 532 SLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQ 591
           ++K H  D S L FKEGD LK+A HA TTD++L  +T GK +T+ A  L  GRGHGE I+
Sbjct: 552 AMKGHLADFSTLSFKEGDKLKLAFHAETTDKLLFFTTGGKFFTIGANTLPGGRGHGEPIR 611

Query: 592 LLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMK 651
           +L+D+ ++QDI+TAFV+D + KLL+VS +GN FIV ESE +ANTRKGK  + V + ++ K
Sbjct: 612 ILVDMENDQDILTAFVHDPSAKLLLVSHEGNGFIVPESEAVANTRKGKQVMNVKAPDEAK 671

Query: 652 LVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTW 711
           L  +V+GDH+AVVGENRK+L+F +  IPEM+RGKGVRLQ YKDGG+ DV  F I +GL+W
Sbjct: 672 LCQRVSGDHIAVVGENRKMLVFPLSDIPEMTRGKGVRLQKYKDGGVCDVRTFAIADGLSW 731

Query: 712 IDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
            DSA R++NRS+ +L+ W+G R   G LVPKGFPRSGKF
Sbjct: 732 QDSADRTFNRSKEELVEWIGARASAGRLVPKGFPRSGKF 770


>gi|256060873|ref|ZP_05451033.1| DNA topoisomerase IV subunit A [Brucella neotomae 5K33]
 gi|261324871|ref|ZP_05964068.1| DNA topoisomerase IV subunit A [Brucella neotomae 5K33]
 gi|261300851|gb|EEY04348.1| DNA topoisomerase IV subunit A [Brucella neotomae 5K33]
          Length = 770

 Score =  951 bits (2458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/759 (59%), Positives = 587/759 (77%), Gaps = 22/759 (2%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           EE+++ V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+   A+ 
Sbjct: 12  EEHIERVDLKSALEERYLAYALSTIMHRALPDVRDGLKPVHRRIMHAMRLLRLNPDQAYA 71

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+V+GK HPHGD S+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTE
Sbjct: 72  KCARIVGDVMGKFHPHGDASIYDALVRLAQDFAVRYPLVDGQGNFGNIDGDNAAAMRYTE 131

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT+VA L+L+G++E+A+DFR TYNEED EP+V P  FPNLLANG++GIAVGMAT+IP 
Sbjct: 132 ARMTEVATLLLEGINENAIDFRPTYNEEDEEPIVLPGAFPNLLANGSAGIAVGMATNIPP 191

Query: 194 HNVQEICEAALALIDNPEISIEKLLEY----------------------IIGPDFPTGGI 231
           HNV E+C +AL LI++P+  +E+L+                        + GPDFPTGGI
Sbjct: 192 HNVAELCSSALYLINHPDAPVEELVTSPEQWAEIEQESKTDPAALLKCKVRGPDFPTGGI 251

Query: 232 IVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELII 291
           +VE   +I+E+YR GRG FRVRARW  EE  RG+W IVVTEIPYQVQKSRLIEKIAEL++
Sbjct: 252 LVEEHGNILEAYRTGRGAFRVRARWHKEEGNRGTWVIVVTEIPYQVQKSRLIEKIAELLL 311

Query: 292 AKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRV 351
           AK++PLL+DIRDESAED+RIVL PKNR++DP+LLMES+F L+++E+R  LNMNVLS G+V
Sbjct: 312 AKKLPLLDDIRDESAEDIRIVLEPKNRTVDPELLMESLFKLTELESRVSLNMNVLSHGKV 371

Query: 352 PQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNED 411
           P V+ L  +L+EWL HR+EVL RRS FR+  I++R+EIL G LIAYLN+DE+I IIR ED
Sbjct: 372 PNVLSLGAVLREWLEHRKEVLVRRSQFRLAEIEKRLEILGGFLIAYLNLDEVIRIIREED 431

Query: 412 KPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQ 471
           +PK  ++  F LT+ Q ++ILN+RLRSLRKLEE++I+ E D+L AEK  ++ LL SG +Q
Sbjct: 432 EPKQELMRAFELTDVQAESILNMRLRSLRKLEEFEIRKEFDDLTAEKTDLEGLLASGTRQ 491

Query: 472 WNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIR 531
           W +I+ EI+ V+E F  +T LG+RRTTF      D   + QAMIE+EP+T+V+S +GW+R
Sbjct: 492 WKKISTEIKAVREKFGPTTRLGKRRTTFAHAPTHDLEDIHQAMIEREPVTIVVSEKGWLR 551

Query: 532 SLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQ 591
           ++K H  D S L FKEGD LK+A HA TTD++L  +T GK +T+ A  L  GRGHGE I+
Sbjct: 552 AMKGHLADFSTLSFKEGDKLKLAFHAETTDKLLFFTTGGKFFTIGANTLPGGRGHGEPIR 611

Query: 592 LLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMK 651
           +L+D+ ++QDI+TAFV+D + KLL+VS +GN FIV ESE +ANTRKGK  + V + ++ K
Sbjct: 612 ILVDMENDQDILTAFVHDPSAKLLLVSHEGNGFIVPESEAVANTRKGKQVMNVKAPDEAK 671

Query: 652 LVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTW 711
           L  +V+GDH+AVVGENRK+L+F +  IPEM+RGKGVRLQ YK GG+ DV  F I +GL+W
Sbjct: 672 LCQRVSGDHIAVVGENRKMLVFPLSDIPEMTRGKGVRLQKYKGGGVCDVRTFAIADGLSW 731

Query: 712 IDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
            DSA R++NRS+ +L+ W+G R   G LVPKGFPRSGKF
Sbjct: 732 QDSADRTFNRSKEELVEWIGARASAGRLVPKGFPRSGKF 770


>gi|328543510|ref|YP_004303619.1| DNA topoisomerase IV subunit A [polymorphum gilvum SL003B-26A1]
 gi|326413254|gb|ADZ70317.1| DNA topoisomerase IV subunit A [Polymorphum gilvum SL003B-26A1]
          Length = 745

 Score =  951 bits (2458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/735 (60%), Positives = 569/735 (77%)

Query: 16  NVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKS 75
            ++ V+LR ALEERYLAYALSTI  RA+PD+RDG KPVHRR+++AM  + LD GA FKK 
Sbjct: 6   GIEGVNLREALEERYLAYALSTIMHRALPDVRDGLKPVHRRLLYAMRLLKLDPGAGFKKC 65

Query: 76  ARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEAR 135
           AR+VG+VIGK HPHGDQ+VY++LVRLAQ F QRYPLI GQGNFGNIDGDSAAA RYTEAR
Sbjct: 66  ARVVGDVIGKYHPHGDQAVYEALVRLAQDFAQRYPLIDGQGNFGNIDGDSAAAMRYTEAR 125

Query: 136 MTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHN 195
           +T +A  +L G+DEDAVDFR+TY+ ED EP+V P  FPNLLANG+SGIAVGMATSIP HN
Sbjct: 126 LTDIARRLLDGLDEDAVDFRETYDGEDREPIVLPGGFPNLLANGSSGIAVGMATSIPPHN 185

Query: 196 VQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRAR 255
             E+CEAA  LI NP      LL++I GPDFPTGG++V+    ++E+Y  GRG FRVRAR
Sbjct: 186 AFELCEAAQHLIRNPNADTRALLQFIKGPDFPTGGLLVDDPVGLLETYETGRGSFRVRAR 245

Query: 256 WCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFP 315
           W +E++GRG W +VVTEIPYQVQKSRLIEKIAEL++A+++PLL+DIRDESAEDVRIVL P
Sbjct: 246 WAIEDLGRGQWVVVVTEIPYQVQKSRLIEKIAELLMARKLPLLDDIRDESAEDVRIVLVP 305

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           ++R++D  LLMES+F L+D+E+RFPLNMNVLS G+VP VM +  +L+EWL HR+ VL RR
Sbjct: 306 RSRNVDAALLMESLFKLTDLESRFPLNMNVLSHGKVPMVMGVRQVLREWLDHRKAVLIRR 365

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
           S  R+  I+ R+E+L G L+AYLN+DE+I IIR ED+PK  ++  F LT+ Q +AILN+R
Sbjct: 366 SQHRLDQIEHRLEVLDGYLVAYLNLDEVIRIIREEDEPKAELMRTFGLTDVQAEAILNMR 425

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LRSLRKLEE +I+ E D L AE++++ +LL S  +QW +I  +I EV + +   T LGRR
Sbjct: 426 LRSLRKLEEMEIRKEHDKLSAERDELKALLGSEARQWTRIGKDIAEVGKAYGPETPLGRR 485

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           RT F E    D   LQQAMIEKEPITVVIS++GWIR+LK H  DLS+L FK+GD LK+A 
Sbjct: 486 RTGFSEAPGHDVEDLQQAMIEKEPITVVISDKGWIRALKGHQQDLSSLAFKQGDKLKLAF 545

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
           HA TTD+IL+ ST GK +TL A  L  GRGHGE I+L++D+   QD+V+AFV+    KLL
Sbjct: 546 HAETTDKILVFSTGGKFFTLGADRLPGGRGHGEPIRLMVDMEEGQDVVSAFVHKPGRKLL 605

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSI 675
           V S +   F+V E++++ANTRKGK  L +++  +  L +   GDHVAV+G+NRKLL+F +
Sbjct: 606 VASDEARGFVVPETDVVANTRKGKQVLNLTAPNEAVLCIAAEGDHVAVIGQNRKLLVFPL 665

Query: 676 DQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGG 735
            Q+PEM RG+GVRLQ Y+DG ++D + F   +GLTWIDS+GRS+NRS +DL  W G RG 
Sbjct: 666 AQVPEMGRGRGVRLQRYRDGHLADAVVFDGAQGLTWIDSSGRSFNRSLDDLADWRGDRGQ 725

Query: 736 VGSLVPKGFPRSGKF 750
            G L P GFPRS +F
Sbjct: 726 AGRLPPTGFPRSNRF 740


>gi|148559566|ref|YP_001258735.1| DNA topoisomerase IV subunit A [Brucella ovis ATCC 25840]
 gi|148370823|gb|ABQ60802.1| DNA topoisomerase IV, A subunit [Brucella ovis ATCC 25840]
          Length = 775

 Score =  949 bits (2454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/759 (59%), Positives = 587/759 (77%), Gaps = 22/759 (2%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           EE+++ V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+   A+ 
Sbjct: 17  EEHIERVDLKSALEERYLAYALSTIMHRALPDVRDGLKPVHRRIMHAMRLLRLNPDQAYA 76

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+V+GK HPHGD S+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTE
Sbjct: 77  KCARIVGDVMGKFHPHGDASIYDALVRLAQDFAVRYPLVDGQGNFGNIDGDNAAAMRYTE 136

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT+VA L+L+G++E+A+DFR TYNEED EP+V P  FPNLLANG++GIAVGMAT+IP 
Sbjct: 137 ARMTEVATLLLEGINENAIDFRPTYNEEDEEPIVLPGAFPNLLANGSAGIAVGMATNIPP 196

Query: 194 HNVQEICEAALALIDNPEISIEKLLEY----------------------IIGPDFPTGGI 231
           HNV E+C +AL LI++P+  +E+L+                        + GPDFPTGGI
Sbjct: 197 HNVAELCSSALYLINHPDAPVEELVTSPEQWAEIEQESKTDPAALLKCKVRGPDFPTGGI 256

Query: 232 IVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELII 291
           +VE   +I+E+YR GRG FRVRARW  EE  RG+W IVVTEIPYQVQKSRLIEKIAEL++
Sbjct: 257 LVEEHGNILEAYRTGRGAFRVRARWHKEEGNRGTWVIVVTEIPYQVQKSRLIEKIAELLL 316

Query: 292 AKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRV 351
           AK++PLL+DIRDESAED+RIVL PKNR++DP+LLMES+F L+++E+R  LNMNVLS G+V
Sbjct: 317 AKKLPLLDDIRDESAEDIRIVLEPKNRTVDPELLMESLFKLTELESRVSLNMNVLSHGKV 376

Query: 352 PQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNED 411
           P V+ L  +L+EWL HR+EVL RRS FR+  I++ +EIL G LIAYLN+DE+I IIR ED
Sbjct: 377 PNVLSLGAVLREWLEHRKEVLVRRSQFRLAEIEKCLEILGGFLIAYLNLDEVIRIIREED 436

Query: 412 KPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQ 471
           +PK  ++  F LT+ Q ++ILN+RLRSLRKLEE++I+ E D+L AEK  ++ LL SG +Q
Sbjct: 437 EPKQELMRAFELTDVQAESILNMRLRSLRKLEEFEIRKEFDDLTAEKTDLEGLLASGTRQ 496

Query: 472 WNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIR 531
           W +I+ EI+ V+E F  +T LG+RRTTF      D   + QAMIE+EP+T+V+S +GW+R
Sbjct: 497 WKKISTEIKAVREKFGPTTRLGKRRTTFTHAPTHDLEDIHQAMIEREPVTIVVSEKGWLR 556

Query: 532 SLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQ 591
           ++K H  D S L FKEGD LK+A HA TTD++L  +T GK +T+ A  L  GRGHGE I+
Sbjct: 557 AMKGHLADFSTLSFKEGDKLKLAFHAETTDKLLFFTTGGKFFTIGANTLPGGRGHGEPIR 616

Query: 592 LLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMK 651
           +L+D+ ++QDI+TAFV+D + KLL+VS +GN FIV ESE +ANTRKGK  + V + ++ K
Sbjct: 617 ILVDMENDQDILTAFVHDPSAKLLLVSHEGNGFIVPESEAVANTRKGKQVMNVKAPDEAK 676

Query: 652 LVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTW 711
           L  +V+GDH+AVVGENRK+L+F +  IPEM+RGKGVRLQ YKDGG+ DV  F I +GL+W
Sbjct: 677 LCQRVSGDHIAVVGENRKMLVFPLSDIPEMTRGKGVRLQKYKDGGVCDVRTFAIADGLSW 736

Query: 712 IDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
            DSA R++NRS+ +L+ W+G R   G LVPKGFPRSGKF
Sbjct: 737 QDSADRTFNRSKEELVEWIGARASAGRLVPKGFPRSGKF 775


>gi|153009866|ref|YP_001371081.1| DNA topoisomerase IV subunit A [Ochrobactrum anthropi ATCC 49188]
 gi|151561754|gb|ABS15252.1| DNA topoisomerase IV, A subunit [Ochrobactrum anthropi ATCC 49188]
          Length = 770

 Score =  949 bits (2453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/759 (59%), Positives = 587/759 (77%), Gaps = 22/759 (2%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           EE+++ V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+   A+ 
Sbjct: 12  EEHIERVDLKSALEERYLAYALSTIMHRALPDVRDGLKPVHRRIMHAMRLLRLNPDQAYA 71

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+V+GK HPHGD S+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTE
Sbjct: 72  KCARIVGDVMGKFHPHGDASIYDALVRLAQDFAVRYPLVDGQGNFGNIDGDNAAAMRYTE 131

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT+VA L+L+G++E+A+DFR TYNEED EP+V P  FPNLLANG++GIAVGMAT+IP 
Sbjct: 132 ARMTEVATLLLEGINENAIDFRPTYNEEDEEPIVLPGAFPNLLANGSAGIAVGMATNIPP 191

Query: 194 HNVQEICEAALALIDNPEISIEKLLEY----------------------IIGPDFPTGGI 231
           HNV E+C +AL +I++P+  +E+L+                        + GPDFPTGGI
Sbjct: 192 HNVAELCSSALYIINHPDAPVEELVTSPEQWEELKREAETDPAALLKCKVRGPDFPTGGI 251

Query: 232 IVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELII 291
           +VE   +I+E+YR GRG FRVRARW  EE  RG+W IVVTEIPYQVQKSRLIEKIAEL++
Sbjct: 252 LVEEHGNILEAYRTGRGAFRVRARWEKEEGNRGTWVIVVTEIPYQVQKSRLIEKIAELLL 311

Query: 292 AKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRV 351
           AK++PLL+DIRDESAED+RIVL PKNR++DP+LLMES+F L+++E+R  LNMNVLS G+V
Sbjct: 312 AKKLPLLDDIRDESAEDIRIVLEPKNRTVDPELLMESLFKLTELESRVSLNMNVLSHGKV 371

Query: 352 PQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNED 411
           P V+ L  +L+EWL HR+EVL RRS FR+  I+RR+EIL G LIAYLN+DE+I IIR ED
Sbjct: 372 PNVLSLGSVLREWLDHRKEVLVRRSQFRLAEIERRLEILGGFLIAYLNLDEVIRIIREED 431

Query: 412 KPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQ 471
           +PK  ++  F LT+ Q ++ILN+RLRSLRKLEE++I+ E D+L  EK  ++ LL SG +Q
Sbjct: 432 EPKQDLMRTFELTDVQAESILNMRLRSLRKLEEFEIRKEFDDLTVEKTDLEGLLASGTRQ 491

Query: 472 WNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIR 531
           W +I+ EI+ V+E F   T+LG RRTTF +    D   + QAMIE+EP+T+V+S +GW+R
Sbjct: 492 WKKISAEIKSVREKFGPKTELGARRTTFADAPTHDLEDIHQAMIEREPVTIVVSEKGWLR 551

Query: 532 SLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQ 591
           ++K H  D S L FKEGD LK+A HA TTD++L  +T GK +T+ A  L  GRGHGE I+
Sbjct: 552 AMKGHLADFSTLAFKEGDKLKLAFHAETTDKLLFFTTGGKFFTIGANTLPGGRGHGEPIR 611

Query: 592 LLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMK 651
           +L+D+ ++QDI+TAFV+D   KLL+VS +GN FIV ESE +ANTRKGK  + V + ++ K
Sbjct: 612 ILVDMENDQDILTAFVHDPAAKLLLVSHEGNGFIVPESEAVANTRKGKQVMNVKAPDEAK 671

Query: 652 LVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTW 711
           L  +V+GDH+AVVGENRK+++F +  IPEM+RGKGVRLQ YKDGG+SDV  F I +GL+W
Sbjct: 672 LCQRVSGDHIAVVGENRKMVVFPLSDIPEMTRGKGVRLQKYKDGGVSDVRTFAIADGLSW 731

Query: 712 IDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
            DSA R++NRS+ +L+ W+G R   G LVPKGFPRSG+F
Sbjct: 732 QDSAERTFNRSKEELVEWIGARASAGRLVPKGFPRSGRF 770


>gi|307946581|ref|ZP_07661916.1| DNA topoisomerase IV, A subunit [Roseibium sp. TrichSKD4]
 gi|307770245|gb|EFO29471.1| DNA topoisomerase IV, A subunit [Roseibium sp. TrichSKD4]
          Length = 752

 Score =  943 bits (2437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/736 (59%), Positives = 571/736 (77%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + V+ + LR ALEERYLAYALSTI  RA+PD+RDG KPVHRR+++AM  + LD G+ FKK
Sbjct: 12  DGVQGIDLRTALEERYLAYALSTIMHRALPDVRDGLKPVHRRLLYAMRLLKLDPGSGFKK 71

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEA 134
            AR+VG+VIGK HPHGDQ+VYD+LVRLAQ F QRYPL+ GQGNFGN+DGD+AAA RYTEA
Sbjct: 72  CARVVGDVIGKYHPHGDQAVYDALVRLAQTFAQRYPLVDGQGNFGNVDGDNAAAMRYTEA 131

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           R+T+ A+ +L G+DE+A+DFR+TY+ ED EP+V P  FPNLLANG+SGIAVGMATSIP H
Sbjct: 132 RLTETAKRLLDGLDENAIDFRETYDGEDKEPIVLPGGFPNLLANGSSGIAVGMATSIPPH 191

Query: 195 NVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
           N  E+CEA   LI NP+  ++ LL++I GPDFPTGG++V    SI E+Y  GRG FRVRA
Sbjct: 192 NAHELCEACQHLIKNPDAEVDDLLQFIKGPDFPTGGLLVSDAASIREAYATGRGSFRVRA 251

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLF 314
           +W VE++GRG WC+V+TEIPYQVQKSRLIEKIAEL+ A+++PLL+D+RDES ED+R+VL 
Sbjct: 252 KWEVEDLGRGQWCVVITEIPYQVQKSRLIEKIAELLTARKLPLLDDVRDESTEDIRVVLV 311

Query: 315 PKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFR 374
           P++R++D  LLMES+F L+D+E RF LNMNVLS G+VP VM +  +L+EWL HR+EVL R
Sbjct: 312 PRSRNVDATLLMESMFKLTDLENRFSLNMNVLSGGKVPMVMGVKQVLREWLDHRKEVLIR 371

Query: 375 RSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNL 434
           RS +R+  I+ R+E+L+G LIAYLN+DE+I IIR ED  K  ++  FSLT+ Q +AILN+
Sbjct: 372 RSEYRLGQINHRLEVLEGYLIAYLNLDEVIRIIREEDDAKAELIRTFSLTDVQAEAILNM 431

Query: 435 RLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGR 494
           RLRSLRKLEE +I+ E D L  EK+++  LL S  +QW +I+ EI E+ + +   T+LG+
Sbjct: 432 RLRSLRKLEELEIRKEHDKLTKEKDELTKLLGSDARQWTRISKEIAEISKAYGPETELGK 491

Query: 495 RRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIA 554
           RRT   E    D   +QQAMIEKEPITV+IS +GWIR+LK H  DLS L FK+GD+LK++
Sbjct: 492 RRTEQAEAPDHDLGDIQQAMIEKEPITVIISEKGWIRALKGHQSDLSTLSFKQGDALKLS 551

Query: 555 LHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKL 614
            HA TTD+IL+ ST GK +TL A NL  GRGHGE I+L+++++  QD+V AFV+ +  KL
Sbjct: 552 FHAETTDKILVFSTGGKFFTLSAANLPGGRGHGEPIRLMVEMDEAQDVVCAFVHKAGRKL 611

Query: 615 LVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
           L+ S++   F+V E +++ANTRKGK  L +++  +  + V+  GDHVAV+G+NRKLL+F 
Sbjct: 612 LISSNEARGFVVGEDDVVANTRKGKQVLNLTAPAEATICVEADGDHVAVIGQNRKLLVFP 671

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
           + QI +M+RG+GVRLQ Y+DG I+DV  FK  +GLTW+DS+GRS+NRS  DL  W G RG
Sbjct: 672 MAQIAQMTRGRGVRLQRYRDGDIADVRVFKGEDGLTWVDSSGRSFNRSLEDLTDWRGDRG 731

Query: 735 GVGSLVPKGFPRSGKF 750
             G L P GFPRS KF
Sbjct: 732 QAGRLPPTGFPRSNKF 747


>gi|118587954|ref|ZP_01545364.1| DNA topoisomerase IV subunit A [Stappia aggregata IAM 12614]
 gi|118439576|gb|EAV46207.1| DNA topoisomerase IV subunit A [Stappia aggregata IAM 12614]
          Length = 750

 Score =  941 bits (2431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/737 (59%), Positives = 572/737 (77%)

Query: 17  VKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSA 76
           +++++L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRR+++AM  + LD G+ FKK A
Sbjct: 12  IESINLKNALEERYLAYALSTIMHRALPDVRDGLKPVHRRLLYAMRLLKLDPGSGFKKCA 71

Query: 77  RIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARM 136
           R+VG+VIGK HPHGDQ+VYD+LVRLAQ F QRYPLI GQGNFGN+DGD+AAA RYTEARM
Sbjct: 72  RVVGDVIGKYHPHGDQAVYDALVRLAQDFAQRYPLIDGQGNFGNVDGDNAAAMRYTEARM 131

Query: 137 TQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNV 196
           T  A+ +L G+DE+AVDFR+TY+ ED EP+V P  FPNLL NG+SGIAVGMATSIP HN 
Sbjct: 132 TDTAKRLLDGLDENAVDFRETYDGEDKEPIVLPGGFPNLLGNGSSGIAVGMATSIPPHNA 191

Query: 197 QEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW 256
            E+CEA   LI NP     +LLEYI GPDFPTGG++V  + SI E+Y  GRG FRVRARW
Sbjct: 192 FELCEACQHLIKNPNAETGELLEYIKGPDFPTGGLLVSDQGSIREAYETGRGSFRVRARW 251

Query: 257 CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPK 316
            VE++GRG W IVVTEIPYQVQKSRLIEKIAEL+ A+++PLL+D+RDESAED+RIVL P+
Sbjct: 252 EVEDLGRGQWAIVVTEIPYQVQKSRLIEKIAELLTARKLPLLDDVRDESAEDIRIVLVPR 311

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           +R++D ++LMES+F L+D+E RF LNMNVLSMG+VP VM L  +L+EWL HR+EVL RRS
Sbjct: 312 SRNVDANILMESLFKLTDLENRFSLNMNVLSMGKVPMVMGLKQVLREWLDHRKEVLIRRS 371

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
            +R+  I+ R+E+L+G L+AYLN+DE+I IIR ED+PK  ++  F L++ Q +AILN+RL
Sbjct: 372 EYRLGQINHRLEVLEGYLVAYLNLDEVIRIIREEDEPKAELMQTFELSDVQAEAILNMRL 431

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           RSLRKLEE +I+ E D L AEK+ +  LL S  +QW +I+ EI ++ +++   T++G+RR
Sbjct: 432 RSLRKLEEMEIRKEHDKLSAEKDDLTKLLGSDARQWTKISKEIADISKVYGPETEIGKRR 491

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
           T   E    D   +QQAMIEKEPITV+IS +GWIR++K H  DLS + FK+GD LK++LH
Sbjct: 492 TDKSEAPETDLIDIQQAMIEKEPITVIISEKGWIRAMKGHQTDLSGVVFKQGDKLKLSLH 551

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
           A TTD+ILL ST GK +TL A  L  GRGHGE I+L+++++  QD+V AFV+     LL+
Sbjct: 552 AETTDKILLFSTGGKFFTLGADRLPGGRGHGEPIRLMVEMDEAQDVVNAFVHKPGRNLLL 611

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSID 676
            +++   F+V E +++ANTRKGK  L +S+  +  + V+ +GDHVA++GENRKLL+F + 
Sbjct: 612 ATTEARGFVVSEDDVVANTRKGKQVLNLSAPAEASICVEASGDHVAIIGENRKLLVFPLV 671

Query: 677 QIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGV 736
           QIP+M RG+GVRLQ Y+DG ISD+  FK  +GLTW DS+GRS+ RS ++L  W G+RG  
Sbjct: 672 QIPQMGRGRGVRLQRYRDGNISDIRVFKGEDGLTWTDSSGRSFTRSLDELADWRGERGQA 731

Query: 737 GSLVPKGFPRSGKFLSS 753
           G L P GFPRS KF  S
Sbjct: 732 GRLPPTGFPRSNKFGPS 748


>gi|254500997|ref|ZP_05113148.1| DNA topoisomerase IV, A subunit [Labrenzia alexandrii DFL-11]
 gi|222437068|gb|EEE43747.1| DNA topoisomerase IV, A subunit [Labrenzia alexandrii DFL-11]
          Length = 750

 Score =  931 bits (2407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/734 (59%), Positives = 567/734 (77%)

Query: 17  VKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSA 76
           ++ ++L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRR+++AM  + LD G  FKK A
Sbjct: 12  IEGINLKDALEERYLAYALSTIMHRALPDVRDGLKPVHRRLLYAMRLLKLDPGQGFKKCA 71

Query: 77  RIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARM 136
           R+VG+VIGK HPHGDQ+VYD+LVRLAQ F QRYPLI GQGNFGN+DGD+AAA RYTEARM
Sbjct: 72  RVVGDVIGKYHPHGDQAVYDALVRLAQDFAQRYPLIDGQGNFGNVDGDNAAAMRYTEARM 131

Query: 137 TQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNV 196
           T  A+ +L G+DEDAVD+R+TY+ ED EP+V P  FPNLL NG+SGIAVGMATSIP HN 
Sbjct: 132 TDTAKRLLDGLDEDAVDWRETYDGEDKEPIVLPGGFPNLLGNGSSGIAVGMATSIPPHNA 191

Query: 197 QEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW 256
            E+C A   LI NP+  +++LLE+I GPDFPTGG++V  + SI E+Y  GRG FRVRARW
Sbjct: 192 FELCNACQHLIKNPDAEVDELLEHIKGPDFPTGGLLVSDQGSIREAYATGRGSFRVRARW 251

Query: 257 CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPK 316
            VEE+GRG W IVVTEIPYQVQKSRLIEKIAEL+IA+++PLL+D+RDESAED+R+VL P+
Sbjct: 252 EVEELGRGQWAIVVTEIPYQVQKSRLIEKIAELLIARKLPLLDDVRDESAEDIRVVLVPR 311

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           ++++D ++LMES+F L+D+E RF LNMNVLSMG+VP VM +  +L+EWL HR+ VL RRS
Sbjct: 312 SKNVDANILMESLFKLTDLENRFSLNMNVLSMGKVPMVMGVKQVLREWLDHRKVVLVRRS 371

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
             R+  I+ R+E+L G LIAYLN+DE+I IIR ED  K  ++  F LT+ Q +AILN+RL
Sbjct: 372 EHRLGQINHRLEVLAGYLIAYLNLDEVIRIIREEDDAKASLIRTFELTDVQAEAILNMRL 431

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           RSLRKLEE++I+ E D L  EK+++  LL S  +QW +I+ EI E+ +++   T++G+RR
Sbjct: 432 RSLRKLEEFEIRKEHDKLTDEKDQLTKLLGSDARQWTKISKEIGEIAKVYGPETEIGKRR 491

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
           T   E   AD   +QQAMIEKEPITV+IS +GWIR+LK H  DLS+L FK+GD LK++ H
Sbjct: 492 TDKAEAPEADLVDIQQAMIEKEPITVIISEKGWIRALKGHQADLSSLSFKQGDKLKLSFH 551

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
           A TTD+IL+ ST GK +TL A  L  GRGHGE I+L+++++  QD+V+AFV+     LL+
Sbjct: 552 AETTDKILVFSTGGKFFTLGADRLPGGRGHGEPIRLMVEMDEAQDVVSAFVHKPGRNLLL 611

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSID 676
            +++   F+V E +++ANTRKGK  L +++  +  L V  TGDHVA++GENRKLL+F + 
Sbjct: 612 SNNEARGFVVSEDDVVANTRKGKQVLNLTAPAEAALCVDATGDHVAIIGENRKLLVFPLA 671

Query: 677 QIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGV 736
           QI +M RG+GVRLQ Y+DG +SD+  FK  +GLTW DS+GRS+ RS  +L  WLG RG  
Sbjct: 672 QIAQMGRGRGVRLQRYRDGNVSDIRVFKGEDGLTWTDSSGRSFTRSLEELSEWLGDRGQA 731

Query: 737 GSLVPKGFPRSGKF 750
           G L P GFPRS KF
Sbjct: 732 GRLPPTGFPRSNKF 745


>gi|90419529|ref|ZP_01227439.1| DNA topoisomerase IV, A subunit [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336466|gb|EAS50207.1| DNA topoisomerase IV, A subunit [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 750

 Score =  931 bits (2407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/736 (60%), Positives = 571/736 (77%), Gaps = 1/736 (0%)

Query: 16  NVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKS 75
           +++ + L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + LD G  +KK 
Sbjct: 13  DIEPIDLKAALEERYLAYALSTIMGRALPDVRDGLKPVHRRIVHAMRILRLDPGQGYKKC 72

Query: 76  ARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEAR 135
           ARIVG+V+GK HPHGD S+YD+LVRL+Q F  RYPLI GQGNFGN+DGDS AA RYTEAR
Sbjct: 73  ARIVGDVMGKFHPHGDASIYDALVRLSQDFAIRYPLIDGQGNFGNVDGDSPAAMRYTEAR 132

Query: 136 MTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHN 195
           MT VA L+L+G+DEDAVDF+ TYNEE+ EP+V P  FPNLLANG+SGIAVGMATSIP HN
Sbjct: 133 MTDVATLLLRGIDEDAVDFKKTYNEEEEEPIVLPGAFPNLLANGSSGIAVGMATSIPPHN 192

Query: 196 VQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRAR 255
             E+C+AAL LI+NP+ + + LL ++ GPD PTGG+IV+++  I E+Y  GRG FRVRAR
Sbjct: 193 AAELCDAALKLIENPDATTDALLRFVQGPDLPTGGVIVDNQAQIREAYDTGRGSFRVRAR 252

Query: 256 WCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFP 315
           W  E+ GRG + +VVTEIPYQVQKSRLIEKIAEL++A+++PLL DIRDESAEDVRIV+ P
Sbjct: 253 WETEDQGRGGYVVVVTEIPYQVQKSRLIEKIAELLLARKLPLLGDIRDESAEDVRIVIEP 312

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           K+R++DP+LLMES+F L+D+E+R PLNMNVLS G+VP+VM L  +L EWLAH+R+VL RR
Sbjct: 313 KSRTVDPELLMESLFRLTDLESRIPLNMNVLSGGKVPRVMSLKDVLAEWLAHQRDVLVRR 372

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
           S FR+  I+RR+EIL G LIA+LN+DE+I IIR ED+PK  ++  F LT+ Q +AILN+R
Sbjct: 373 SRFRLAQIERRLEILSGYLIAFLNLDEVIRIIREEDEPKTELMRTFELTDTQAEAILNMR 432

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LRSLRKLEE+++K E D L  EK + ++LL S ++QW  IA E+REV+E +SK T +GRR
Sbjct: 433 LRSLRKLEEFELKREFDTLTGEKAEKEALLASDERQWAGIAAEVREVRETYSKKTKIGRR 492

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           RT F +        +  A+IEKEPITVV+S +G++R +K H  D S+L F+EGD L++A 
Sbjct: 493 RTMFADAPNRALDDITVALIEKEPITVVLSKKGFLRGMKGHLADFSSLAFREGDGLQLAF 552

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
           HA TTD++L LST G+A+T  A  L  GRG GE I+L  +L  +QDI  AFV D   + L
Sbjct: 553 HAMTTDKLLFLSTGGRAFTHGADKLPGGRGQGEPIRLAFELEDDQDIALAFVADPERRRL 612

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKV-TGDHVAVVGENRKLLIFS 674
           +VSS GN F+  E++++ANTRKGK  + V+ + K+ L   V  GDHVA+VGENRKLL+F 
Sbjct: 613 LVSSDGNGFVASEADMLANTRKGKQLMNVAGKTKLALAAPVGAGDHVAIVGENRKLLVFP 672

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
           + Q+P+M+RGKGVRLQ YKDGG+SD   F + +GLTW DSAGRS+ RSE +LL W G R 
Sbjct: 673 LVQVPQMTRGKGVRLQRYKDGGLSDARVFAMADGLTWTDSAGRSFTRSETELLEWRGDRA 732

Query: 735 GVGSLVPKGFPRSGKF 750
             G LVPKGFP++ +F
Sbjct: 733 QAGRLVPKGFPKTNRF 748


>gi|114704845|ref|ZP_01437753.1| DNA topoisomerase IV subunit A [Fulvimarina pelagi HTCC2506]
 gi|114539630|gb|EAU42750.1| DNA topoisomerase IV subunit A [Fulvimarina pelagi HTCC2506]
          Length = 750

 Score =  910 bits (2353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/735 (58%), Positives = 563/735 (76%), Gaps = 1/735 (0%)

Query: 17  VKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSA 76
           ++ V LR ALEERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + LD G A+KK A
Sbjct: 14  IQPVDLREALEERYLAYALSTIMGRALPDVRDGLKPVHRRIVHAMRVLRLDPGQAYKKCA 73

Query: 77  RIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARM 136
           RIVG+V+G+ HPHGD ++YD+LVRLAQ F  RYPL+ GQGNFGN+DGDSAAA RYTEARM
Sbjct: 74  RIVGDVMGRFHPHGDAAIYDALVRLAQDFSVRYPLVDGQGNFGNVDGDSAAAMRYTEARM 133

Query: 137 TQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNV 196
           T+VA L+L+G+DE+AVDFR TYNEED EPVV P  FPNLLANG+SGIAVGMAT+IP HN 
Sbjct: 134 TEVATLLLRGIDENAVDFRPTYNEEDEEPVVLPGAFPNLLANGSSGIAVGMATNIPPHNA 193

Query: 197 QEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW 256
            E+C+AAL +I+NP+ ++++LL  I GPDFPTGG+IV++R +I ++Y  GRG FRVRARW
Sbjct: 194 AELCDAALKIIENPDATVDQLLRSIEGPDFPTGGVIVDNRATIRQAYETGRGSFRVRARW 253

Query: 257 CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPK 316
             E+  RG W +VV EIPYQVQKSRLIEKIAEL+ A+++PLL DIRDESAED+RIVL PK
Sbjct: 254 EREDATRGQWFVVVHEIPYQVQKSRLIEKIAELLQARKLPLLADIRDESAEDIRIVLEPK 313

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           ++++DP++LMES+F L+D+E+R PLNMNVLS G+VP+V+ L  +L EWLAH+REVL RR+
Sbjct: 314 SKTVDPEILMESLFRLTDLESRIPLNMNVLSGGKVPKVLSLKEVLAEWLAHQREVLERRA 373

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
             R+  I+RR+EIL G LI +LNID++I IIR ED+PK  ++  F+L++ Q +A+LN+RL
Sbjct: 374 RHRLAQIERRLEILAGYLIVFLNIDDVIRIIREEDEPKQELMRFFTLSDVQAEAVLNMRL 433

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           RSLRKLEE++++ E D L  EK + ++LL S ++QW+ +A E+R V+E FSK T LG+RR
Sbjct: 434 RSLRKLEEFELRREFDQLTVEKAEKEALLGSTEKQWSAVAEEVRAVRETFSKKTKLGKRR 493

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
           T F +    D   +  A+IEKE +T+V+S +G++R +K H  D S L F+EGD L IA H
Sbjct: 494 TRFADAPDHDIGDITTALIEKESVTIVLSKKGFLRGMKGHLADFSNLTFREGDGLNIAFH 553

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
           A TTD++L +S  G+ +T+ A  L  GRG G+ I+L  DL    DI  AF  +   + L+
Sbjct: 554 AMTTDKLLFVSKHGRVFTMQADKLPGGRGQGDPIRLAFDLEDKDDIAAAFTAEPERRRLM 613

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKV-TGDHVAVVGENRKLLIFSI 675
           VSS+G  F+  E ++I+ TRKGK  + V     ++L  ++  GD VA+VGENRKLL+F +
Sbjct: 614 VSSEGTGFVATEGDMISGTRKGKQLMNVGKGSVVELAQEIGEGDTVAIVGENRKLLVFPL 673

Query: 676 DQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGG 735
            Q+P+M+RGKGVRLQ YKDGG+SD   FK+ EGLTW DSAGR++ RS+ +L+ W G R  
Sbjct: 674 SQVPQMARGKGVRLQRYKDGGVSDAKVFKLSEGLTWSDSAGRAFLRSDEELMEWKGDRAQ 733

Query: 736 VGSLVPKGFPRSGKF 750
            G LVPKGFP++ KF
Sbjct: 734 AGRLVPKGFPKTNKF 748


>gi|304391955|ref|ZP_07373897.1| DNA topoisomerase IV, A subunit [Ahrensia sp. R2A130]
 gi|303296184|gb|EFL90542.1| DNA topoisomerase IV, A subunit [Ahrensia sp. R2A130]
          Length = 765

 Score =  907 bits (2345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/739 (58%), Positives = 565/739 (76%), Gaps = 5/739 (0%)

Query: 17  VKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSA 76
           ++ + L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+  A F K A
Sbjct: 25  IEPIDLKTALEERYLAYALSTIMGRALPDVRDGMKPVHRRILHAMRLLRLNPEAGFAKCA 84

Query: 77  RIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARM 136
           RIVG+V+GK HPHGD S+YD+LVRL+Q F  RYPL+ GQGNFGN+DGD+ AA RYTEARM
Sbjct: 85  RIVGDVMGKFHPHGDASIYDALVRLSQSFAVRYPLVDGQGNFGNVDGDNPAAMRYTEARM 144

Query: 137 TQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNV 196
           T  A  +L+G+ EDAVDFR TYNEED EP+V P+ FPNLLANG++GIAVGMAT+IP HNV
Sbjct: 145 TPAAMSLLEGITEDAVDFRATYNEEDEEPIVLPAAFPNLLANGSAGIAVGMATNIPPHNV 204

Query: 197 QEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW 256
           +E+C+AAL LI  P    +KL+E++ GPDFPTGGIIVES  S++E+Y+ G+GGFR+RARW
Sbjct: 205 EELCDAALHLIKFPNAGFDKLMEFVPGPDFPTGGIIVESPASMLETYKTGKGGFRLRARW 264

Query: 257 CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPK 316
             E++GRG W IVVTEIPYQV KS+LIEK AEL++AK++PLL+DI DESAED+R+VL PK
Sbjct: 265 EKEDLGRGQWQIVVTEIPYQVGKSKLIEKTAELLLAKKLPLLDDINDESAEDIRVVLTPK 324

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           +RS+DP LLME +F L+D+ETRFPLNMNVL  G+VP+VM +  +L+ WL HR+ VL RR+
Sbjct: 325 SRSIDPALLMEQLFRLTDLETRFPLNMNVLDGGKVPKVMSIRDVLRAWLEHRKVVLVRRN 384

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
             R+  I++R+E+L G +IAYLNIDE+I IIR ED PK  +++RF LT+ Q +A+LNLRL
Sbjct: 385 RNRLAQIEKRLEVLGGYIIAYLNIDEVIRIIRTEDHPKQALIARFELTDAQAEAVLNLRL 444

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           R+L KLEE +++ E  +L  EK  I+ LL S + QW  IA E+ + K+ FSK+TDLG RR
Sbjct: 445 RALHKLEEMELRKEFSDLKEEKASIEGLLASDELQWKTIAWEVGQTKKKFSKATDLGARR 504

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
           TTF      D   +  AMIEKEP+T+V+S +GWIR+LK H+ D +AL FKEGD L  A H
Sbjct: 505 TTFETAMEVDLDAVAAAMIEKEPVTIVVSQKGWIRALKGHAPDFAALTFKEGDKLLTAFH 564

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
           A TTD++L+ +T GK YTL A  L  GRGHGE +++++D++++ DI++ F++    K ++
Sbjct: 565 AETTDKLLMFTTAGKFYTLAADKLPGGRGHGEPVRIMVDMDNDADILSLFIHKPGRKRML 624

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKV-----TGDHVAVVGENRKLL 671
           VSS GN F+V E+++IANTRKGK  L V+   + KL          GDHVAVVGENRKLL
Sbjct: 625 VSSLGNGFVVAETDLIANTRKGKQSLNVAMPVEAKLCPATDHEGEAGDHVAVVGENRKLL 684

Query: 672 IFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLG 731
           IF +DQ+PEM RGKGVRLQ YKDGG+ D   FK+ +GL+W DSAGR++ R+ ++L  ++ 
Sbjct: 685 IFPLDQVPEMGRGKGVRLQRYKDGGVKDARLFKLADGLSWTDSAGRTHTRTADELKEYIA 744

Query: 732 KRGGVGSLVPKGFPRSGKF 750
            R   G +VPKGFP+SG F
Sbjct: 745 DRAQAGRMVPKGFPKSGTF 763


>gi|254469959|ref|ZP_05083364.1| DNA topoisomerase IV, A subunit [Pseudovibrio sp. JE062]
 gi|211961794|gb|EEA96989.1| DNA topoisomerase IV, A subunit [Pseudovibrio sp. JE062]
          Length = 750

 Score =  894 bits (2309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/740 (57%), Positives = 555/740 (75%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           ++  + ++L+ ALEERYL+YAL+TI  RA+PD+RDG KPVHRRI++ M  + LD    FK
Sbjct: 8   QDGPETINLKDALEERYLSYALTTIMHRALPDVRDGLKPVHRRILYGMRLLKLDPNQGFK 67

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K AR+VG+V+GK HPHGD ++YD+LVRLAQ F  RYP++ GQGNFGNIDGDSAAA RYTE
Sbjct: 68  KCARVVGDVMGKYHPHGDAAIYDALVRLAQDFSVRYPMVDGQGNFGNIDGDSAAAMRYTE 127

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT VA  IL G++E+AVDFR+TY+  DSEPVV P  FPNLLANG++GIAVGMATSIP 
Sbjct: 128 ARMTDVATRILDGLNENAVDFRETYDGLDSEPVVLPGSFPNLLANGSTGIAVGMATSIPP 187

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN  E+C A   LI  P+  +E+LLE+I GPDFPTGG IV  + SI+E+Y+ GRG FR R
Sbjct: 188 HNAHELCNACQLLISKPDAEVEELLEHIKGPDFPTGGTIVNDKGSILEAYKTGRGSFRTR 247

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           A+W  EE  RG++ IVVTEIPY VQKSRLIEKIAEL++A+++PLL+DIRDESAEDVR+VL
Sbjct: 248 AKWHKEEGQRGTYNIVVTEIPYLVQKSRLIEKIAELLMARKLPLLDDIRDESAEDVRVVL 307

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            P+N+++DP+LLM S+F L+D+E RF LNMNVLS G VP+VM L  +L+EWL H++EVL 
Sbjct: 308 VPRNKNVDPELLMASLFKLTDLENRFSLNMNVLSKGVVPKVMSLKEVLQEWLEHQKEVLV 367

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS+ R+  I+ R+E+L+G L+AYLNIDE+I IIR ED  K  ++  F LTE Q +AILN
Sbjct: 368 RRSNHRLDQINHRLEVLEGYLVAYLNIDEVIRIIREEDDAKASLIKAFDLTEVQAEAILN 427

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
           +RLRSLRKLEE++IK E D L  EK  +++LL S K+QWN+++ ++ E+ + +   T++G
Sbjct: 428 MRLRSLRKLEEFEIKKEHDKLSKEKAGLEALLASDKKQWNRVSKQVGEIGKAYGPETEIG 487

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
            RRT F      D   + QAMIEKEPITVVIS +GWIR+LK H  D++ L FK+GD L +
Sbjct: 488 ARRTDFGTADDRDLEEINQAMIEKEPITVVISEKGWIRTLKGHVQDVTNLAFKQGDQLHL 547

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
           + HA TT +IL+ ++ GK YTL A  L  GRGHGE I+L++D++  Q+I++AFV+D   K
Sbjct: 548 SFHAETTSKILIFTSGGKFYTLGADKLPGGRGHGEPIRLMLDMDETQEIISAFVHDPERK 607

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
           LL+ +     F+V+E ++IANTRKGK  L V++  K  L V   GD+VAV+G NRKLL F
Sbjct: 608 LLMSTDGAYGFVVQEKDVIANTRKGKQVLNVTAPAKAVLCVPAIGDYVAVIGHNRKLLTF 667

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
            + QI  M+RG+GVRLQ Y+DGGISD+  F   EGLTW D++GR + R+  ++  W G R
Sbjct: 668 PLAQIAVMTRGRGVRLQRYRDGGISDIKTFDSEEGLTWTDASGRIFKRTLEEMQDWRGDR 727

Query: 734 GGVGSLVPKGFPRSGKFLSS 753
           G  G L P GFPR+ KF  S
Sbjct: 728 GQAGRLPPNGFPRTNKFDGS 747


>gi|154253317|ref|YP_001414141.1| DNA topoisomerase IV subunit A [Parvibaculum lavamentivorans DS-1]
 gi|154157267|gb|ABS64484.1| DNA topoisomerase IV, A subunit [Parvibaculum lavamentivorans DS-1]
          Length = 748

 Score =  892 bits (2306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/731 (58%), Positives = 551/731 (75%), Gaps = 3/731 (0%)

Query: 20  VSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIV 79
           ++LR ALEERYLAYALSTI  RA+PD+RDG KPVHRR++ AM ++ LD G+ FKKSAR+V
Sbjct: 14  INLREALEERYLAYALSTIMHRALPDVRDGLKPVHRRVLFAMRQLKLDPGSGFKKSARVV 73

Query: 80  GEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQV 139
           G+VIG+ HPHGDQSVYD+LVRLAQ F  RYPL+ GQGNFGN+DGD+AAA RYTEAR+T+V
Sbjct: 74  GDVIGRYHPHGDQSVYDALVRLAQSFSVRYPLVDGQGNFGNVDGDNAAAMRYTEARLTEV 133

Query: 140 AELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEI 199
           A  +L G+DED VDFRDTY+ EDSEP V P  FP LLANG +GIAVGMATSIP HN  E+
Sbjct: 134 AAQLLNGIDEDTVDFRDTYDGEDSEPTVLPGAFPQLLANGAAGIAVGMATSIPPHNAAEL 193

Query: 200 CEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVE 259
           C+AAL LI +P    EKL+E++ GPDFPTGGIIVE R +++E+Y  GRGGFRVRARW  E
Sbjct: 194 CDAALYLIKHPNAKTEKLVEFVKGPDFPTGGIIVEPRAAMLEAYETGRGGFRVRARWEQE 253

Query: 260 EVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRS 319
           E+ RG + IVVTEIPYQVQKS+L+EKIAEL+ A+++PLLED+RDESAE++R+VL PK R+
Sbjct: 254 ELPRGGYQIVVTEIPYQVQKSKLVEKIAELLQARKLPLLEDVRDESAEEIRLVLVPKART 313

Query: 320 LDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFR 379
           +DP  LMES+F  +++E RFPLNMNVLS G+VP VM L G+L+ WL HR+ VL RRS+FR
Sbjct: 314 VDPAHLMESLFRSTELENRFPLNMNVLSAGQVPGVMSLRGVLRAWLEHRKVVLVRRSNFR 373

Query: 380 MQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSL 439
           +  I++R+E+L+G L AYLN+DE+I IIR ED+PKP ++ +F LT+NQ +AILN+RLRSL
Sbjct: 374 LDKIEKRLEVLEGYLKAYLNLDEVIRIIRQEDEPKPALIKKFKLTDNQAEAILNMRLRSL 433

Query: 440 RKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTF 499
           RKLEE +I+ E   L AE++ + SL+ S  +QW ++A EI+EVK +F   T LG RRT F
Sbjct: 434 RKLEEMEIRGEHKELSAEQKALKSLVKSEDKQWARVADEIKEVKALFGPKTALGARRTKF 493

Query: 500 CEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHT 559
            +    +   + +AMIEKEP+TVV S +GWIR++K H    + + FKEGD+ +  LHA T
Sbjct: 494 SDAPAIEYVPM-EAMIEKEPVTVVCSKKGWIRTMKGHVGPDTEIKFKEGDAGRFLLHAET 552

Query: 560 TDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSS 619
           TD++LL +TDG+ YTL    L  GRG+GE ++L+IDL+ + ++V  FV+    KL+V S 
Sbjct: 553 TDKVLLFATDGRFYTLDVTKLPGGRGNGEPVRLMIDLDESHEVVELFVHQPGRKLIVASH 612

Query: 620 KGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIP 679
           +GN FIV E E++A  R GK  L V+ +++      V G HVAV+G+NRKLLIF + ++ 
Sbjct: 613 EGNGFIVPEDEVVAMRRAGKQVLNVTGKDEAIACAPVQGTHVAVIGDNRKLLIFPVKEVN 672

Query: 680 EMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSL 739
           EM+RGKGVRLQ Y DGG++DV  F + EGLT  D +GR  N    DL  W+G R   G L
Sbjct: 673 EMTRGKGVRLQRYADGGLADVKTFNLKEGLTVYDKSGRQRNFP--DLKDWVGARAQAGRL 730

Query: 740 VPKGFPRSGKF 750
            PKGF    KF
Sbjct: 731 PPKGFTSERKF 741


>gi|90424143|ref|YP_532513.1| DNA topoisomerase IV subunit A [Rhodopseudomonas palustris BisB18]
 gi|90106157|gb|ABD88194.1| DNA topoisomerase IV subunit A [Rhodopseudomonas palustris BisB18]
          Length = 751

 Score =  891 bits (2302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/731 (56%), Positives = 546/731 (74%)

Query: 20  VSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIV 79
           V LR ALEERYLAYALSTI  RA+PD RDG KPVHRRI++ M  + LD G  FKKSA+IV
Sbjct: 16  VQLREALEERYLAYALSTIMHRALPDARDGLKPVHRRILYGMRLLRLDPGTPFKKSAKIV 75

Query: 80  GEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQV 139
           G+V+G  HPHGDQS+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAAYRYTEARMT V
Sbjct: 76  GDVMGSFHPHGDQSIYDALVRLAQDFSSRYPLVDGQGNFGNIDGDNAAAYRYTEARMTDV 135

Query: 140 AELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEI 199
           A L+L G+DED V FR  Y+ +  EP+V P  FPNLLANG  GIAVGMAT+IP HN  E+
Sbjct: 136 ARLLLDGIDEDGVAFRANYDGQSKEPIVLPGGFPNLLANGAQGIAVGMATAIPPHNAAEL 195

Query: 200 CEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVE 259
           C+AAL LI+ P+   + LL+++ GPDFPTGG+I++SRESI E+Y  GRG FR RA+W  E
Sbjct: 196 CDAALHLIEKPDAKSKTLLKWVKGPDFPTGGVIIDSRESIAEAYTTGRGSFRTRAKWHQE 255

Query: 260 EVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRS 319
           +  RG+W + +TEIP+ VQKSRLIEKIAEL+  K++PL+ D+RDESAED+R+V+ PK+R+
Sbjct: 256 DGARGTWVVAITEIPWLVQKSRLIEKIAELLNEKKLPLVGDVRDESAEDIRVVIEPKSRA 315

Query: 320 LDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFR 379
           +DP+LLMES+F L+++E++ PLN+NVL  GR+P+V+ L   L+EWL H R+VL RR S+R
Sbjct: 316 VDPELLMESLFRLTELESKIPLNLNVLVKGRIPKVLGLAECLREWLDHLRDVLLRRCSYR 375

Query: 380 MQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSL 439
              I+ R+E+L G LIAYLNID++I IIR ED+PKPV++  F+LT+ Q +AILN+RLRSL
Sbjct: 376 KGQIEHRLEVLGGYLIAYLNIDKVIKIIRTEDEPKPVLMKAFNLTDIQAEAILNMRLRSL 435

Query: 440 RKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTF 499
           RKLEE++I++E  NL AE + I+++L S  +QW ++A ++R+V+E+F   T LG+RRT F
Sbjct: 436 RKLEEFEIRTEDKNLRAELKGINAILKSETEQWAKVAEQVRKVREMFGPKTALGKRRTMF 495

Query: 500 CEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHT 559
            +    D A +++A +E+EP+TVVIS++GW+R+LK H  DLS L FK  D L  A  A T
Sbjct: 496 ADAPEHDLAAIEEAFVEREPVTVVISDKGWVRTLKGHVADLSGLTFKTDDKLGQAFFAET 555

Query: 560 TDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSS 619
           T ++LL +T+G+ Y L    L  GRGHGE I++ IDL+ +  IV  FV+    K LV S 
Sbjct: 556 TSKLLLFATNGRFYALDVAKLPGGRGHGEPIRMFIDLDQDAAIVALFVHTGGRKFLVASH 615

Query: 620 KGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIP 679
            G  FIV E + + NTRKGK  L V    + + V  V+GD VAV+GENRKLLIF++DQ+P
Sbjct: 616 DGQGFIVNEDDCVGNTRKGKQILNVEMPNEARAVCTVSGDSVAVIGENRKLLIFALDQVP 675

Query: 680 EMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSL 739
           EM+RG+GVRLQ YKDGG+SD+  F   +G +W DSAGR ++ S  +L  W G R   G +
Sbjct: 676 EMARGRGVRLQKYKDGGLSDIATFTAKDGFSWRDSAGREFSASIKELAEWRGNRADAGRM 735

Query: 740 VPKGFPRSGKF 750
            PKGFP+S KF
Sbjct: 736 PPKGFPKSNKF 746


>gi|115525023|ref|YP_781934.1| DNA topoisomerase IV subunit A [Rhodopseudomonas palustris BisA53]
 gi|115518970|gb|ABJ06954.1| DNA topoisomerase IV subunit A [Rhodopseudomonas palustris BisA53]
          Length = 753

 Score =  888 bits (2295), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/736 (55%), Positives = 553/736 (75%), Gaps = 2/736 (0%)

Query: 17  VKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSA 76
           +  V LR ALEERYLAYALSTI  RA+PD RDG KPVHRRI++ M  + LD G  FKKSA
Sbjct: 13  IHEVQLRDALEERYLAYALSTIMHRALPDARDGLKPVHRRILYGMRLLRLDPGTPFKKSA 72

Query: 77  RIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARM 136
           +IVG+V+G  HPHGDQS+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAAYRYTEARM
Sbjct: 73  KIVGDVMGSFHPHGDQSIYDALVRLAQDFSSRYPLVDGQGNFGNIDGDNAAAYRYTEARM 132

Query: 137 TQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNV 196
           T VA L+L+G+DED V FR  Y+ +  EP+V P  FPNLLANG  GIAVGMAT+IP HN 
Sbjct: 133 TDVARLLLEGIDEDGVAFRANYDGQSKEPIVLPGGFPNLLANGAQGIAVGMATAIPPHNA 192

Query: 197 QEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW 256
            E+C+AAL LID P+   + LL+++ GPDFPTGG+I++SRESI E+Y  GRG FR RA+W
Sbjct: 193 AELCDAALHLIDKPDAKSKALLKWVKGPDFPTGGVIIDSRESIAEAYSTGRGAFRTRAKW 252

Query: 257 CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPK 316
             EE  RG+W +V+TEIP+ VQKSRLIEKIAEL+  K++PL+ D+RDESAED+R+V+ PK
Sbjct: 253 SQEEGARGTWVVVITEIPWLVQKSRLIEKIAELLNEKKLPLVGDVRDESAEDIRLVIEPK 312

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           +R++DP+LLMES+F L+++E+R PLN+NVL  GR+P+V+ L   L+EWL H R+VL RRS
Sbjct: 313 SRTVDPELLMESLFRLTELESRIPLNLNVLVKGRIPKVLGLAECLREWLDHLRDVLLRRS 372

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
           ++R   I+ R+E+L G LIAYLNID++I IIR ED+PKPV++  F LT+ Q +AILN+RL
Sbjct: 373 NYRKAQIEHRLEVLGGYLIAYLNIDKVIKIIRTEDEPKPVLMRTFKLTDIQAEAILNMRL 432

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           RSLRKLEE++I++E  NL AE + I+++L S K+QW ++  ++R+V+++F   T LG+RR
Sbjct: 433 RSLRKLEEFEIRTEDKNLRAELKGINAILASEKEQWAKVGEQVRKVRDLFGPKTALGKRR 492

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
           T+F +    D A +++A +E+EP+T+V+S++GW+R+LK H  DLS+L FK+ D L     
Sbjct: 493 TSFADAPEHDLAAIEEAFVEREPVTIVVSDKGWVRTLKGHVADLSSLAFKQDDKLGTTFF 552

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
           A TT +++L +T+G+ Y+L    L  GRGHGE I++ IDL+ +  IV+ FV     + LV
Sbjct: 553 AETTSKLMLFATNGRFYSLEVAKLPGGRGHGEPIRMFIDLDQDAAIVSLFVSTGDRRFLV 612

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVS--SEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
            S  G  F+V E++ ++NTRKGK  L V   +E +   VV    D VAV+GENRK+L+F 
Sbjct: 613 ASHDGQGFVVGEADCVSNTRKGKQVLNVEMPNEARALTVVGEGADTVAVIGENRKMLLFP 672

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
           +DQ+PEM++G+GVRLQ YKDGG+SD++ F    GLTW DSAGR ++ +  +L  W G R 
Sbjct: 673 LDQVPEMAKGRGVRLQKYKDGGLSDIVAFNAKAGLTWRDSAGREFSATIKELAEWRGNRA 732

Query: 735 GVGSLVPKGFPRSGKF 750
             G L PKGFP+S KF
Sbjct: 733 DAGRLPPKGFPKSNKF 748


>gi|91977126|ref|YP_569785.1| DNA topoisomerase IV subunit A [Rhodopseudomonas palustris BisB5]
 gi|91683582|gb|ABE39884.1| DNA topoisomerase IV subunit A [Rhodopseudomonas palustris BisB5]
          Length = 753

 Score =  888 bits (2294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/736 (56%), Positives = 548/736 (74%), Gaps = 2/736 (0%)

Query: 17  VKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSA 76
           +  V LR ALEERYLAYALSTI  RA+PD RDG KPVHRRI++ M  + LD G  FKKSA
Sbjct: 13  IHDVQLREALEERYLAYALSTIMHRALPDARDGLKPVHRRILYGMRLLRLDPGTPFKKSA 72

Query: 77  RIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARM 136
           +IVG+V+G  HPHGDQS+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+ AAYRYTEARM
Sbjct: 73  KIVGDVMGSFHPHGDQSIYDALVRLAQDFSSRYPLVDGQGNFGNIDGDNPAAYRYTEARM 132

Query: 137 TQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNV 196
           T VA L+L G+DED V FR  Y+ +  EP+V P  FPNLLANG  GIAVGMAT+IP HN 
Sbjct: 133 TDVARLLLDGIDEDGVAFRPNYDGQSKEPMVLPGGFPNLLANGAQGIAVGMATAIPPHNA 192

Query: 197 QEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW 256
            E+C+AAL LI+ P+   + LL ++ GPDFPTGGI+++S+ESI E+Y  GRG FR RA+W
Sbjct: 193 AELCDAALHLIEKPDAKSKALLRFVKGPDFPTGGIVIDSKESIAEAYTTGRGAFRTRAKW 252

Query: 257 CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPK 316
             EE  RG+W +VVTEIP+ VQKSRLIEKIAEL+  K++PL+ DIRDESAEDVR+V+ PK
Sbjct: 253 AQEEGARGTWVVVVTEIPWLVQKSRLIEKIAELLNEKKLPLVGDIRDESAEDVRVVIEPK 312

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           +R++DP+L+MES+F L+++E+R PLN+NVL  GR+P+V+ L   L+EWL H R+VL RRS
Sbjct: 313 SRTVDPELMMESLFRLTELESRIPLNLNVLVKGRIPKVLGLAECLREWLDHLRDVLLRRS 372

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
           ++R   I+ R+E+L G LIAYLNID++I IIRNED+PKPV++  FSLT+ Q +AILN+RL
Sbjct: 373 NYRKAQIEHRLEVLGGYLIAYLNIDKVIKIIRNEDEPKPVLMKTFSLTDIQAEAILNMRL 432

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           RSLRKLEE++I++E  NL AE + I+++L S  +QW ++  ++R+V+E+F   T LG+RR
Sbjct: 433 RSLRKLEEFEIRTEDKNLRAELKGINAILKSETEQWAKVGEQVRKVREMFGPKTPLGKRR 492

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
           T F +    D A +++A +E+EP+TVVIS++GW+R+LK H  DLS L+FK+ D L  +  
Sbjct: 493 TQFADAPEHDLAAIEEAFVEREPVTVVISDKGWVRTLKGHVEDLSGLNFKQDDRLGQSFF 552

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
           A TT ++LLL+T+G+ Y+L    L  GRGHGE I++ ID+  +  IV  FVY    K L+
Sbjct: 553 AETTSKLLLLATNGRFYSLDVAKLPGGRGHGEPIRMFIDMEQDAAIVAVFVYKGGRKFLI 612

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVS--SEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
            S  G  FIV E + +  TRKGK  + V   +E +   VV    D VAV+GENRK+LIF 
Sbjct: 613 ASHDGQGFIVGEDDCVGTTRKGKQIINVDMPNEARALTVVGEGSDSVAVIGENRKMLIFP 672

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
           +DQ+PEM+RG+GVRLQ YKDGG+SD+  F   +GL+W DSAGR ++ +  DL  W G R 
Sbjct: 673 MDQVPEMTRGRGVRLQKYKDGGLSDIATFVSKQGLSWRDSAGREFSATMKDLAEWRGNRA 732

Query: 735 GVGSLVPKGFPRSGKF 750
             G L PKGFP+S KF
Sbjct: 733 DAGRLPPKGFPKSNKF 748


>gi|312114153|ref|YP_004011749.1| DNA topoisomerase IV, subunit alpha [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219282|gb|ADP70650.1| DNA topoisomerase IV, A subunit [Rhodomicrobium vannielii ATCC
           17100]
          Length = 750

 Score =  887 bits (2293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/745 (57%), Positives = 562/745 (75%), Gaps = 3/745 (0%)

Query: 6   ISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMG 65
           +++   L    ++ + L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRR++ AM ++ 
Sbjct: 1   MADETILAPPPIEPIRLKDALEERYLAYALSTIMHRALPDVRDGLKPVHRRLLFAMRQLK 60

Query: 66  LDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDS 125
           LD    FKK AR+VG+VIGK HPHGDQSVYD+LVRLAQ F QRYPL+ GQGNFGNIDGD+
Sbjct: 61  LDPAGGFKKCARVVGDVIGKYHPHGDQSVYDALVRLAQSFSQRYPLVDGQGNFGNIDGDN 120

Query: 126 AAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAV 185
           AAA RYTEARMT +A  +L G+DED VDFR+TY+ E+ EPVV P+ FPNLLANG+SGIAV
Sbjct: 121 AAAMRYTEARMTAIAAALLDGIDEDTVDFRETYDGEEEEPVVLPAAFPNLLANGSSGIAV 180

Query: 186 GMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRL 245
           GMATSIP HN  E+C+AAL LI +P+ S+E LL Y+ GPDFPTGG++V+    +VE+YR 
Sbjct: 181 GMATSIPPHNADEVCDAALYLIKHPKASVETLLTYLPGPDFPTGGVLVDDTAGLVEAYRT 240

Query: 246 GRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDES 305
           GRG FR+RARW  E+ GRG + I+VTEIPY VQKSRLIEK+A+L+ AK++PLL DI DES
Sbjct: 241 GRGSFRLRARWHTEDTGRGGYQIIVTEIPYGVQKSRLIEKMADLLQAKKLPLLGDIDDES 300

Query: 306 AEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWL 365
           AED+RIV+ PK+R++D  LLME +F L+++E R PLNM VLS G+VPQV+ L  +L+EWL
Sbjct: 301 AEDIRIVIEPKSRNVDAALLMEQLFRLTELEARIPLNMTVLSKGQVPQVLGLAQVLQEWL 360

Query: 366 AHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTE 425
            HRR VL RRS  R++ ID R+E+L GLLIAYLN+DE+I IIRNED+PKP +++RF+LT+
Sbjct: 361 DHRRVVLRRRSEHRLREIDHRLEVLGGLLIAYLNLDEVIRIIRNEDEPKPALIARFALTD 420

Query: 426 NQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEI 485
            Q +AILN+RLRSLRKLEE +I++E D L  E+E +  LL S + QW++I+ EI+ +K+ 
Sbjct: 421 VQAEAILNMRLRSLRKLEEIEIRAENDRLTTEREGLVELLGSDEMQWDRISAEIKGIKKQ 480

Query: 486 FSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHF 545
           F K+T LG+R+T    +   D A +++A+I+KEP+TVV+S +GWIR+LK H  DL+ L F
Sbjct: 481 FGKATPLGKRKTVTAALPDIDVA-VEEALIDKEPVTVVLSEKGWIRALKGHDGDLAKLTF 539

Query: 546 KEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTA 605
           K  D LK+A+ A TTD+I+L +T+GK YTL A  L  GRG GE ++L+IDL+   +++  
Sbjct: 540 KTDDVLKVAIKAQTTDKIVLFATNGKFYTLEASELPGGRGQGEPVRLMIDLDEADELLET 599

Query: 606 FVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVG 665
           FV+    KL+V SS GN F+V E E++A TRKGK  L +   E+  L     GD VAVVG
Sbjct: 600 FVHKPGRKLVVASSVGNGFVVTEDEVVAQTRKGKQVLNLGDGERALLCRPAEGDAVAVVG 659

Query: 666 ENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSEND 725
           ENR+LL+F + ++ E++RG+GVRLQ YKDGG++DV  F    GL   D++GR   R+  +
Sbjct: 660 ENRRLLVFPLAELNELTRGRGVRLQKYKDGGLADVQVFTAATGLKLSDTSGRV--RTVTE 717

Query: 726 LLGWLGKRGGVGSLVPKGFPRSGKF 750
           L  + G R   GS VPKG+P+SG+F
Sbjct: 718 LDEFKGARAAAGSAVPKGWPKSGRF 742


>gi|86749737|ref|YP_486233.1| DNA topoisomerase IV subunit A [Rhodopseudomonas palustris HaA2]
 gi|86572765|gb|ABD07322.1| DNA topoisomerase IV subunit A [Rhodopseudomonas palustris HaA2]
          Length = 753

 Score =  887 bits (2291), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/736 (56%), Positives = 548/736 (74%), Gaps = 2/736 (0%)

Query: 17  VKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSA 76
           +  V LR ALEERYLAYALSTI  RA+PD RDG KPVHRRI++ M  + LD G  FKKSA
Sbjct: 13  IHEVQLREALEERYLAYALSTIMHRALPDARDGLKPVHRRILYGMRLLRLDPGTPFKKSA 72

Query: 77  RIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARM 136
           +IVG+V+G  HPHGDQS+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+ AAYRYTEARM
Sbjct: 73  KIVGDVMGSFHPHGDQSIYDALVRLAQDFSSRYPLVDGQGNFGNIDGDNPAAYRYTEARM 132

Query: 137 TQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNV 196
           T VA L+L G+DED V FR  Y+ +  EPVV P  FPNLLANG  GIAVGMAT+IP HN 
Sbjct: 133 TDVARLLLDGIDEDGVAFRPNYDGQAKEPVVLPGGFPNLLANGAQGIAVGMATAIPPHNA 192

Query: 197 QEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW 256
            E+C+AAL LID P+   + LL ++ GPDFPTGGI+++S+ESI E+Y  GRG FR RA+W
Sbjct: 193 AELCDAALHLIDKPDAKTKALLRFVKGPDFPTGGIVIDSKESIAEAYTTGRGAFRTRAKW 252

Query: 257 CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPK 316
             EE  RG+W +VVTEIP+ VQKSRLIEKIAEL+  K++PL+ DIRDESAEDVR+V+ PK
Sbjct: 253 MQEEGARGTWVVVVTEIPWLVQKSRLIEKIAELLNEKKLPLVGDIRDESAEDVRVVIEPK 312

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           +R++DP L+MES+F L+++E+R PLN+NVL  GR+P+V+ L   L+EWL H R+VL RRS
Sbjct: 313 SRAVDPALMMESLFRLTELESRIPLNLNVLVKGRIPKVLGLAECLREWLDHLRDVLLRRS 372

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
           ++R   I+ R+E+L G LIAYLNID++I IIR ED+PKPV++  F+LT+ Q +AILN+RL
Sbjct: 373 NYRKAQIEHRLEVLGGYLIAYLNIDKVIKIIRTEDEPKPVLMKAFNLTDVQAEAILNMRL 432

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           RSLRKLEE++I++E  NL AE + I+++L S  +QW ++  ++R+V+E+F   T LG+RR
Sbjct: 433 RSLRKLEEFEIRTEDKNLRAELKGINAILKSETEQWAKVGEQVRKVREMFGPKTPLGKRR 492

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
           T F +    D A +++A +E+EP+TVVIS++GW+R+LK H  DLS L+FK+ D L  A  
Sbjct: 493 TQFADAPEHDLAAIEEAFVEREPVTVVISDKGWVRTLKGHVADLSGLNFKQDDKLDRAFF 552

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
           A TT ++LLL+T+G+ Y+L    L  GRGHGE I++ ID+  +  IV  FV+    K L+
Sbjct: 553 AETTSKLLLLATNGRFYSLEVAKLPGGRGHGEPIRMFIDMEQDAAIVAMFVHKGGRKFLI 612

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVS--SEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
            S  G  F+V E + +  TRKGK  + V   +E +   VV    D+VAV+G+NRK+LIF 
Sbjct: 613 ASHDGQGFVVGEDDCVGTTRKGKQIINVEMPNEARALTVVGDGSDNVAVIGDNRKMLIFP 672

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
           +DQ+PEM+RG+GVRLQ YKDGG+SD++ F   EGL+W DSAGR ++ +  +L  W G R 
Sbjct: 673 LDQVPEMARGRGVRLQKYKDGGLSDIVTFVAKEGLSWRDSAGREFSATMKELAEWRGNRA 732

Query: 735 GVGSLVPKGFPRSGKF 750
             G + PKGFP+S KF
Sbjct: 733 DAGRMPPKGFPKSNKF 748


>gi|182678910|ref|YP_001833056.1| DNA topoisomerase IV subunit A [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182634793|gb|ACB95567.1| DNA topoisomerase IV, A subunit [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 752

 Score =  886 bits (2290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/731 (56%), Positives = 556/731 (76%)

Query: 20  VSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIV 79
           V+LR ALEERYLAYALSTI  RA+PD RDG KPVHRRI++ M  + LD G AFKK A+IV
Sbjct: 20  VNLREALEERYLAYALSTITGRALPDARDGLKPVHRRILYGMQILRLDPGTAFKKCAKIV 79

Query: 80  GEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQV 139
           G+V+G  HPHGDQ++YD+LVRLAQ F  RYPL+ GQGNFGNIDGDSAAAYRYTEARMT++
Sbjct: 80  GDVMGSFHPHGDQAIYDALVRLAQDFSSRYPLVDGQGNFGNIDGDSAAAYRYTEARMTEI 139

Query: 140 AELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEI 199
           A L+L+G+DEDA+DFR+ Y+ +  EP+V P+  PNLLANG  GIAVGMATSIP HN+ E+
Sbjct: 140 ARLLLEGIDEDAIDFRENYSGDQKEPIVLPAALPNLLANGAQGIAVGMATSIPPHNLSEL 199

Query: 200 CEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVE 259
           C+AAL LI + + + ++LL ++ GPDFPTGGI+V+S ESI E+YR GRG FR+RARW  E
Sbjct: 200 CDAALYLISHRDATSDQLLTFVRGPDFPTGGILVDSPESIAETYRTGRGAFRLRARWERE 259

Query: 260 EVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRS 319
           E  RG++ IVVTEIPY VQKSRLIEK+AEL+  K++PL+ DIRDESAEDVRIV+ PK+R+
Sbjct: 260 EGTRGTYVIVVTEIPYMVQKSRLIEKLAELLNDKKLPLVGDIRDESAEDVRIVIEPKSRA 319

Query: 320 LDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFR 379
           ++P+LLMES+F L+++ETRFP+NMNVL  G VP+V+ LD  L++WL HRREVL RRS  R
Sbjct: 320 VEPELLMESLFKLTELETRFPVNMNVLVDGVVPRVVSLDEALRQWLDHRREVLLRRSRHR 379

Query: 380 MQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSL 439
           +  I+RR+E+L G+LI +LN+DE+I IIR ED+PK V+ + F+L++ Q + IL+ RLRSL
Sbjct: 380 LAEIERRLEVLAGMLIVFLNLDEVIRIIREEDEPKEVLKATFTLSDIQANYILDTRLRSL 439

Query: 440 RKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTF 499
           R+LEE +++ E +NL  EK +I+ LL S  +QW +I+ +IR++K+ + ++T LGRRRTTF
Sbjct: 440 RRLEEMELRREYENLEKEKSEIEGLLASESKQWKEISSQIRDLKKRYGEATPLGRRRTTF 499

Query: 500 CEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHT 559
             V       +  A+IE+EP+T+V+S +GWIR+LK H  DLS L FK  D L     A T
Sbjct: 500 GNVPDVGAVDVATALIEREPVTIVVSEKGWIRALKGHVADLSTLTFKGDDQLAFQFFAET 559

Query: 560 TDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSS 619
           T +ILL ++DGK +TL A  L  GRGHGE ++L++DL   +++ +   Y++  KLL+ +S
Sbjct: 560 TSKILLFASDGKVFTLEASKLPGGRGHGEPLRLMVDLGEGEEVTSIIPYETGAKLLLTAS 619

Query: 620 KGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIP 679
            G  FIV + ++I  TRKGK  L   +  K+  +V   GDH+A++GENRKLLIF + QI 
Sbjct: 620 DGRGFIVGQDDLIGTTRKGKQVLNCDAPAKLSHIVPAAGDHLAIIGENRKLLIFPLVQIA 679

Query: 680 EMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSL 739
           EM+RGKGVRLQ YKDGG+SD     I  GL+W D+AGRS++ ++ DL  W+G+RG  G L
Sbjct: 680 EMTRGKGVRLQKYKDGGVSDAKVIFIDAGLSWQDAAGRSFHLAKADLADWIGQRGEAGRL 739

Query: 740 VPKGFPRSGKF 750
            P+GFP++ +F
Sbjct: 740 PPRGFPKNNRF 750


>gi|192291356|ref|YP_001991961.1| DNA topoisomerase IV subunit A [Rhodopseudomonas palustris TIE-1]
 gi|192285105|gb|ACF01486.1| DNA topoisomerase IV, A subunit [Rhodopseudomonas palustris TIE-1]
          Length = 753

 Score =  883 bits (2281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/736 (56%), Positives = 545/736 (74%), Gaps = 2/736 (0%)

Query: 17  VKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSA 76
           +  V LR ALEERYLAYALSTI  RA+PD RDG KPVHRRI++ M  + LD G  FKKSA
Sbjct: 13  IHEVQLREALEERYLAYALSTIMHRALPDARDGLKPVHRRILYGMRLLRLDPGTPFKKSA 72

Query: 77  RIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARM 136
           +IVG+V+G  HPHGDQS+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+ AAYRYTEARM
Sbjct: 73  KIVGDVMGSFHPHGDQSIYDALVRLAQDFSSRYPLVDGQGNFGNIDGDNPAAYRYTEARM 132

Query: 137 TQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNV 196
           T VA L+L G+DED V FR  Y+ +  EPVV P  FPNLLANG  GIAVGMAT+IP HN 
Sbjct: 133 TDVARLLLDGIDEDGVAFRANYDGQSKEPVVLPGGFPNLLANGAQGIAVGMATAIPPHNA 192

Query: 197 QEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW 256
            E+C+AAL LI+ P+   + LL ++ GPDFPTGGII++S+ESI E+Y  GRG FR RA+W
Sbjct: 193 AELCDAALHLIEKPDAKSKALLRFVKGPDFPTGGIIIDSKESIAEAYTTGRGAFRTRAKW 252

Query: 257 CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPK 316
             EE  RG+W +VVT+IP+ VQKSRLIEKIAEL+  K++PL+ DIRDESAEDVRIV+ PK
Sbjct: 253 EQEEGARGTWTVVVTQIPWLVQKSRLIEKIAELLNEKKLPLVGDIRDESAEDVRIVIEPK 312

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           +RS+DP L+MES+F L+++E+R PLN+NVL  GR+P+V+ L   L+EWL H R+VL RRS
Sbjct: 313 SRSVDPTLMMESLFRLTELESRIPLNLNVLVKGRIPKVLGLAECLREWLDHLRDVLLRRS 372

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
            +R   I+ R+E+L G LIAYLNID++I IIR ED+PKPV++  F+LTE Q +AILN+RL
Sbjct: 373 EYRKGQIEHRLEVLGGYLIAYLNIDKVIKIIRTEDEPKPVLMKAFNLTEIQAEAILNMRL 432

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           RSLRKLEE++I++E  NL AE + I+++L S  +QW ++  ++R+V+E+F   T LG+RR
Sbjct: 433 RSLRKLEEFEIRTEDKNLRAELKGINAVLKSETEQWAKVGEQVRKVREMFGPKTPLGKRR 492

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
           T F +    D A +++A +E+EP+TVVIS++GW+R+LK H  DLS L+FK+ D L  +  
Sbjct: 493 TQFADAPEHDLAAIEEAFVEREPVTVVISDKGWVRTLKGHVEDLSGLNFKQDDKLGQSFF 552

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
           A TT ++LLL+T+G+ Y L    L  GRGHGE I++ ID+  +  IVT FV+    K L+
Sbjct: 553 AETTSKLLLLATNGRFYALDVAKLPGGRGHGEPIRMFIDMEQDAAIVTVFVHTGGRKFLI 612

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVS--SEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
            S  G  F+V E E + +TRKGK  L V   +E +   VV    D VAV+G+NRK++IF 
Sbjct: 613 ASHDGQGFLVNEDECVGSTRKGKQILNVDVPNEARALTVVSEGDDSVAVIGDNRKMVIFP 672

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
           +DQ+PEM+RG+GVRLQ YKDGG+SD+  F   +GL W DSAGR ++ +  +L  W G R 
Sbjct: 673 LDQVPEMTRGRGVRLQKYKDGGLSDIATFSSKQGLGWRDSAGREFSATMKELAEWRGNRA 732

Query: 735 GVGSLVPKGFPRSGKF 750
             G L PKGFP+S KF
Sbjct: 733 DAGRLPPKGFPKSNKF 748


>gi|39935769|ref|NP_948045.1| DNA topoisomerase IV subunit A [Rhodopseudomonas palustris CGA009]
 gi|39649622|emb|CAE28144.1| DNA topoisomerase IV subunitA [Rhodopseudomonas palustris CGA009]
          Length = 753

 Score =  883 bits (2281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/736 (56%), Positives = 545/736 (74%), Gaps = 2/736 (0%)

Query: 17  VKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSA 76
           +  V LR ALEERYLAYALSTI  RA+PD RDG KPVHRRI++ M  + LD G  FKKSA
Sbjct: 13  IHEVQLREALEERYLAYALSTIMHRALPDARDGLKPVHRRILYGMRLLRLDPGTPFKKSA 72

Query: 77  RIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARM 136
           +IVG+V+G  HPHGDQS+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+ AAYRYTEARM
Sbjct: 73  KIVGDVMGSFHPHGDQSIYDALVRLAQDFSSRYPLVDGQGNFGNIDGDNPAAYRYTEARM 132

Query: 137 TQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNV 196
           T VA L+L G+DED V FR  Y+ +  EPVV P  FPNLLANG  GIAVGMAT+IP HN 
Sbjct: 133 TDVARLLLDGIDEDGVAFRANYDGQSKEPVVLPGGFPNLLANGAQGIAVGMATAIPPHNA 192

Query: 197 QEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW 256
            E+C+AAL LI+ P+   + LL ++ GPDFPTGGII++S+ESI E+Y  GRG FR RA+W
Sbjct: 193 AELCDAALHLIEKPDAKSKALLRFVKGPDFPTGGIIIDSKESIAEAYTTGRGAFRTRAKW 252

Query: 257 CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPK 316
             EE  RG+W +VVT+IP+ VQKSRLIEKIAEL+  K++PL+ DIRDESAEDVRIV+ PK
Sbjct: 253 EQEEGARGTWTVVVTQIPWLVQKSRLIEKIAELLNEKKLPLVGDIRDESAEDVRIVIEPK 312

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           +RS+DP L+MES+F L+++E+R PLN+NVL  GR+P+V+ L   L+EWL H R+VL RRS
Sbjct: 313 SRSVDPTLMMESLFRLTELESRIPLNLNVLVKGRIPKVLGLAECLREWLDHLRDVLLRRS 372

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
            +R   I+ R+E+L G LIAYLNID++I IIR ED+PKPV++  F+LTE Q +AILN+RL
Sbjct: 373 EYRKGQIEHRLEVLGGYLIAYLNIDKVIKIIRTEDEPKPVLMKAFNLTEIQAEAILNMRL 432

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           RSLRKLEE++I++E  NL AE + I+++L S  +QW ++  ++R+V+E+F   T LG+RR
Sbjct: 433 RSLRKLEEFEIRTEDKNLRAELKGINAVLKSETEQWAKVGEQVRKVREMFGPKTPLGKRR 492

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
           T F +    D A +++A +E+EP+TVVIS++GW+R+LK H  DLS L+FK+ D L  +  
Sbjct: 493 TQFADAPEHDLAAIEEAFVEREPVTVVISDKGWVRTLKGHVEDLSGLNFKQDDKLGQSFF 552

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
           A TT ++LLL+T+G+ Y L    L  GRGHGE I++ ID+  +  IVT FV+    K L+
Sbjct: 553 AETTSKLLLLATNGRFYALDVAKLPGGRGHGEPIRMFIDMEQDAAIVTVFVHTGGRKFLI 612

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVS--SEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
            S  G  F+V E E + +TRKGK  L V   +E +   VV    D +AV+G+NRK++IF 
Sbjct: 613 ASHDGQGFVVNEDECVGSTRKGKQILNVDVPNEARALTVVSEGDDSIAVIGDNRKMVIFP 672

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
           +DQ+PEM+RG+GVRLQ YKDGG+SD+  F   +GL W DSAGR ++ +  +L  W G R 
Sbjct: 673 LDQVPEMTRGRGVRLQKYKDGGLSDIATFSSKQGLGWRDSAGREFSATMKELAEWRGNRA 732

Query: 735 GVGSLVPKGFPRSGKF 750
             G L PKGFP+S KF
Sbjct: 733 DAGRLPPKGFPKSNKF 748


>gi|298291625|ref|YP_003693564.1| DNA topoisomerase IV, subunit alpha [Starkeya novella DSM 506]
 gi|296928136|gb|ADH88945.1| DNA topoisomerase IV, A subunit [Starkeya novella DSM 506]
          Length = 744

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/735 (57%), Positives = 549/735 (74%), Gaps = 3/735 (0%)

Query: 16  NVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKS 75
            ++ + L+ ALEERYLAYALSTI  RA+PD RDG KPVHRRI++ M  + LD G  F+KS
Sbjct: 12  TIEPIGLKAALEERYLAYALSTIMHRALPDARDGLKPVHRRILYGMRLLRLDPGGGFRKS 71

Query: 76  ARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEAR 135
           A+IVG+V+G  HPHG+ ++YD++VRLAQ F QRYPL+ GQGNFGNIDGD+AAA RYTEAR
Sbjct: 72  AKIVGDVMGSFHPHGNMAIYDAMVRLAQDFSQRYPLVDGQGNFGNIDGDNAAAERYTEAR 131

Query: 136 MTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHN 195
           +T+VA LIL G+DEDAVDFR  Y+    EPVV P  FPNLLANG++GIAVGMATSIP HN
Sbjct: 132 LTEVARLILDGIDEDAVDFRPNYDGTTEEPVVMPGAFPNLLANGSTGIAVGMATSIPPHN 191

Query: 196 VQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRAR 255
             E+ +A+L LIDNP+ + + LL+++ GPDFPTGG+++ES  SI ++Y  GRGGFR+RAR
Sbjct: 192 AAELIDASLHLIDNPQATTDDLLQFVKGPDFPTGGVVIESPASIADAYATGRGGFRLRAR 251

Query: 256 WCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFP 315
           W  EE GRG++ +VVTEIPY V KSRL+EKIA+L+  K++PLL D+RDESAEDVR+VL P
Sbjct: 252 WHKEETGRGTYVVVVTEIPYGVPKSRLVEKIADLLNEKKLPLLADVRDESAEDVRLVLEP 311

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           + R++D +L+MES+F L+++ETRFPLNMNVL  G+VP+V+ L   L+EW+ HRREVL RR
Sbjct: 312 RARNVDAELMMESLFRLTELETRFPLNMNVLVGGQVPKVVSLAEALREWVDHRREVLLRR 371

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
           S  R++ I+ R+E+L G LIAYLN+DE+I IIR ED+PK  ++  F LT+ Q +AILN+R
Sbjct: 372 SRHRLKEIEHRLEVLGGYLIAYLNLDEVIRIIREEDEPKVELMRTFELTDVQAEAILNMR 431

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LRSLRKLEE++I+ E D L  EK+ I+ LL S  +QW  +A E+ E ++IF   T LGRR
Sbjct: 432 LRSLRKLEEFEIRKEHDALSKEKDGIEKLLGSEARQWKTVAWELGETRKIFGPDTPLGRR 491

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           RT F E +  D   + +A++E+EPITVV+S +GWIR+LK H  DLSAL FK  D L+I+ 
Sbjct: 492 RTGFGEAAAHDADAVSEALVEREPITVVVSEKGWIRALKGHVADLSALAFKGDDELRISF 551

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
              TT ++L+ +T+G+ YTL A  L  GRGHGE ++L I+L    DIV    Y    KLL
Sbjct: 552 FTETTAKLLVFATNGRFYTLDASKLPGGRGHGEPLRLSIELEQEADIVDVLPYQGGRKLL 611

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSI 675
           V + +G  F+V E E +ANTRKGK  L V  ++ +K V+   GD VAV+GENRKLL+F +
Sbjct: 612 VAAKEGRGFLVAEDECVANTRKGKQVLGVDGQDAVK-VIPAIGDSVAVIGENRKLLVFPL 670

Query: 676 DQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGG 735
            QIPEM+RG+GVRLQ YKDG +SDV  F   +GLTW D++GR++  +  DL  W G+R  
Sbjct: 671 SQIPEMTRGRGVRLQRYKDGQMSDVKVFSAADGLTWTDTSGRTW--TVTDLTEWRGERAA 728

Query: 736 VGSLVPKGFPRSGKF 750
            G L PKGFPR+ +F
Sbjct: 729 AGRLPPKGFPRNNRF 743


>gi|300023036|ref|YP_003755647.1| DNA topoisomerase IV, subunit alpha [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299524857|gb|ADJ23326.1| DNA topoisomerase IV, A subunit [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 749

 Score =  880 bits (2275), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/734 (57%), Positives = 552/734 (75%), Gaps = 1/734 (0%)

Query: 17  VKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSA 76
           ++ V  R ALEERYLAYALSTI  RA+PD+RDG KPVHRRI++AM E+ L+    + K A
Sbjct: 13  IEPVEFRTALEERYLAYALSTIMNRALPDVRDGLKPVHRRILYAMRELRLNPEGGYIKCA 72

Query: 77  RIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARM 136
           +IVGEV+G  HPHG+Q++YD+L RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEARM
Sbjct: 73  KIVGEVMGDYHPHGNQAIYDALARLAQDFAVRYPLVDGQGNFGNIDGDNPAAERYTEARM 132

Query: 137 TQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNV 196
           T+ A LIL+G+DED V+FR  Y+    EPVV P+ FPNLLANG SGIAVGMAT+IP HNV
Sbjct: 133 TETAALILEGIDEDTVEFRPNYDGRVEEPVVLPAAFPNLLANGASGIAVGMATNIPPHNV 192

Query: 197 QEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW 256
            E+C A L LI +P  +IEKL+E + GPDFPTGG+IVE R++I+E+Y+ GRGGFRVRARW
Sbjct: 193 DELCAALLHLIKHPNATIEKLVEMVPGPDFPTGGVIVEPRDAILEAYKTGRGGFRVRARW 252

Query: 257 CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPK 316
             E+  RG + IVVTEIPY VQK++L+EKIAEL+  K++P L D+RDESAE++R+VL PK
Sbjct: 253 SKEDTARGGYQIVVTEIPYGVQKAKLVEKIAELMSDKKLPFLGDVRDESAEEIRLVLEPK 312

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
            R +DP LLMES+F  S++E R  LNMNVLS G+VP V+ L  +L +WL HR EVL RRS
Sbjct: 313 TRVVDPVLLMESMFRASELEVRVGLNMNVLSAGQVPNVLDLRDVLWQWLEHRIEVLVRRS 372

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
           + R++ I+ R+E+L G LIAYLNIDE+I IIR ED PK  ++++F L++ Q +AILNLRL
Sbjct: 373 THRLKKIEHRLEVLDGYLIAYLNIDEVIRIIRREDDPKAKLIAKFKLSDVQAEAILNLRL 432

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           RSL +LEE +I+SE D L  E+ ++  LL S + QW  ++ E++  +E +SK T +GRRR
Sbjct: 433 RSLSRLEEVEIRSEHDKLSKERRELKQLLKSEELQWEHVSNEVKTTREAYSKKTAIGRRR 492

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
           +TF +    +   L  A++EKEP+TV++S +GW+R+LK H  DLS L FK+GD+LK A+ 
Sbjct: 493 STFADAPEVE-VDLATALVEKEPVTVILSEKGWVRTLKGHQDDLSKLDFKQGDALKRAIK 551

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
           A TTD+++LL+T+GK +TL A  L  GRGHGE ++L+IDL  N DIV  FV+D + KLLV
Sbjct: 552 ALTTDKLVLLTTNGKFFTLEANALPGGRGHGEPVRLMIDLEENHDIVEVFVHDPSRKLLV 611

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSID 676
            S+ G  FIV E E+IA+TRKGK  L VS  ++ ++ V   GD+VA VG+NRKLL+F ID
Sbjct: 612 ASTAGYGFIVPEEEVIASTRKGKQVLNVSEPDEARVCVPAEGDYVATVGDNRKLLVFKID 671

Query: 677 QIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGV 736
           ++ EM+RGKGV LQ +KDG +SDV  FK  +GLTW+DSAGR +  +  ++  W+G+R   
Sbjct: 672 EVNEMTRGKGVILQRFKDGSLSDVRVFKKSDGLTWVDSAGREFTLAWGEMRDWVGERAQA 731

Query: 737 GSLVPKGFPRSGKF 750
           G +VP+GFPRS  F
Sbjct: 732 GRVVPRGFPRSNSF 745


>gi|316934136|ref|YP_004109118.1| DNA topoisomerase IV subunit A [Rhodopseudomonas palustris DX-1]
 gi|315601850|gb|ADU44385.1| DNA topoisomerase IV, A subunit [Rhodopseudomonas palustris DX-1]
          Length = 753

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/736 (57%), Positives = 542/736 (73%), Gaps = 2/736 (0%)

Query: 17  VKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSA 76
           +  V LR ALEERYLAYALSTI  RA+PD RDG KPVHRRI++ M  + LD G  FKKSA
Sbjct: 13  IHEVQLREALEERYLAYALSTIMHRALPDARDGLKPVHRRILYGMRLLRLDPGTPFKKSA 72

Query: 77  RIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARM 136
           +IVG+V+G  HPHGDQS+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+ AAYRYTEARM
Sbjct: 73  KIVGDVMGSFHPHGDQSIYDALVRLAQDFSSRYPLVDGQGNFGNIDGDNPAAYRYTEARM 132

Query: 137 TQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNV 196
           T VA L+L G+DED V FR  Y+ +  EPVV P  FPNLLANG  GIAVGMAT+IP HN 
Sbjct: 133 TDVARLLLDGIDEDGVAFRPNYDGQAKEPVVLPGGFPNLLANGAQGIAVGMATAIPPHNA 192

Query: 197 QEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW 256
            E+C+AAL LI+ P+     LL ++ GPDFPTGGII++S+ESI E+Y  GRG FR RA+W
Sbjct: 193 AELCDAALHLIEKPDAKSRALLRFVKGPDFPTGGIIIDSKESIAEAYTTGRGAFRTRAKW 252

Query: 257 CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPK 316
             EE  RG+W +VVTEIP+ VQKSRLIEKIAEL+  K++PL+ DIRDESAEDVRIV+ PK
Sbjct: 253 AQEEGARGTWSVVVTEIPWLVQKSRLIEKIAELLNEKKLPLVGDIRDESAEDVRIVIEPK 312

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           +RS+DP L+MES+F L+++E+R  LN+NVL  GR+P+V+ L   L+EWL H R+VL RRS
Sbjct: 313 SRSVDPALMMESLFRLTELESRISLNLNVLIKGRIPKVVGLAEALREWLDHLRDVLLRRS 372

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
           + R   I+ R+E+L G LIAYLNIDE+I IIR ED+PKPV++  F+LTE Q +AILN+RL
Sbjct: 373 NHRKTQIEHRLEVLGGYLIAYLNIDEVIRIIRTEDEPKPVLMKTFNLTEIQAEAILNMRL 432

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           RSLRKLEE++IK E  +L AE + I+++L S  +QW ++  ++R+V+E+F   T LG+RR
Sbjct: 433 RSLRKLEEFEIKKEDKDLRAELKGINAVLKSETEQWAKVGEQVRKVREMFGPKTPLGKRR 492

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
           T F +    D A +++A +E+EP+TVVIS++GW+R+LK H  DLS L+FK+ D L  +  
Sbjct: 493 TQFADAPEHDLAAIEEAFVEREPVTVVISDKGWVRTLKGHVEDLSGLNFKQDDKLGQSFF 552

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
           A TT ++LLL+T+G+ Y L    L  GRGHGE I++ ID+  +  IVT FV+    K L+
Sbjct: 553 AETTSKLLLLATNGRFYALDVAKLPGGRGHGEPIRMFIDMEQDAAIVTVFVHTGGRKFLI 612

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVS--SEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
            S  G  F+V E E + +TRKGK  L V   +E +   VV    D VAV+G+NRK++IF 
Sbjct: 613 ASHDGQGFVVNEDECVGSTRKGKQILNVDIPNEARALTVVSEGDDSVAVIGDNRKMVIFP 672

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
           +DQ+PEM+RG+GVRLQ YKDGG+SDV  F   +GL W DSAGR ++ +  +L  W G R 
Sbjct: 673 LDQVPEMTRGRGVRLQKYKDGGLSDVATFSSKQGLGWRDSAGREFSATMKELAEWRGNRA 732

Query: 735 GVGSLVPKGFPRSGKF 750
             G L PKGFP+S KF
Sbjct: 733 DAGRLPPKGFPKSNKF 748


>gi|27380168|ref|NP_771697.1| DNA topoisomerase IV subunit A [Bradyrhizobium japonicum USDA 110]
 gi|27353322|dbj|BAC50322.1| topoisomerase II [Bradyrhizobium japonicum USDA 110]
          Length = 751

 Score =  879 bits (2270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/734 (56%), Positives = 541/734 (73%)

Query: 17  VKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSA 76
           +  V LR ALEERYLAYALSTI  RA+PD RDG KPVHRRI++ M  + LD G AFKKSA
Sbjct: 13  IHEVPLREALEERYLAYALSTIMHRALPDARDGLKPVHRRILYGMRLLRLDPGTAFKKSA 72

Query: 77  RIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARM 136
           +IVG+V+G  HPHGDQ++YD++VRLAQ F  RYPL+ GQGNFGNIDGD+ AAYRYTEARM
Sbjct: 73  KIVGDVMGSFHPHGDQAIYDAMVRLAQDFSSRYPLVDGQGNFGNIDGDNPAAYRYTEARM 132

Query: 137 TQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNV 196
           T VA L+L+G+DED V+FR  Y+ +  EP+V P  FPNLLANG  GIAVGMATSIP HN 
Sbjct: 133 TDVARLLLEGIDEDGVEFRPNYDGQSKEPIVLPGGFPNLLANGAQGIAVGMATSIPPHNA 192

Query: 197 QEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW 256
            E+C+AAL LI+ P+   + LL+++ GPDFPTGGI V+S+++I E+Y  GRG FRVRARW
Sbjct: 193 AELCDAALHLIEKPDAKSKALLKWVKGPDFPTGGICVDSKQAIAEAYTTGRGSFRVRARW 252

Query: 257 CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPK 316
             EE  RG+W +VVTEIP+ VQKSRLIEKIAEL   K++PL+ D+RDESAEDVRIV+ PK
Sbjct: 253 EQEEGARGTWVVVVTEIPFLVQKSRLIEKIAELQDQKKLPLVGDVRDESAEDVRIVIEPK 312

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           ++++DP L+MES+F L+++E + PLN+NVL  GR+P+V+ L   L+EWL H R+VL RRS
Sbjct: 313 SKNVDPALMMESLFRLTELENKIPLNLNVLIKGRIPKVVGLAECLREWLDHLRDVLIRRS 372

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
           ++R   I+ R+E+L G LIAYLNID++I IIR ED+PKP ++  F LTE Q +AILN+RL
Sbjct: 373 NYRKAQIEHRLEVLGGFLIAYLNIDKVIKIIRTEDEPKPALMKAFKLTEVQAEAILNMRL 432

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           RSLRKLEE +I++E  NL  E + I+++L S  +QW ++  ++ +V+++F   T LG+RR
Sbjct: 433 RSLRKLEEMEIRTEDKNLRNELKGINAVLASEAEQWKKVGEQVGKVRDMFGPKTPLGKRR 492

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
           TTF +    D A +++A +E+EP+TVV+S++GWIR++K H  DLS L FK+ D L  A  
Sbjct: 493 TTFADAPEHDLAAIEEAFVEREPVTVVVSDKGWIRTMKGHVEDLSGLAFKQDDRLGFAFF 552

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
           A TT ++LL +T+GK Y+L    L  GRGHGE I+L IDL      V  FV     K LV
Sbjct: 553 AETTSKLLLFATNGKFYSLDVAKLPGGRGHGEPIRLFIDLEQEAAPVALFVNKGGRKFLV 612

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSID 676
            S +G  F+V E + +  T+KGK  L V    + + V +V GD VAV+GENRK+L+F +D
Sbjct: 613 ASHEGQGFVVNEDDCVGTTKKGKQVLNVDMPNEARTVTEVVGDTVAVIGENRKMLVFPLD 672

Query: 677 QIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGV 736
           QIPEM+RG+GVRLQ YKDGG+SDV+ F    GLTW DSAGR ++ +  +L  W G R   
Sbjct: 673 QIPEMARGRGVRLQKYKDGGLSDVVVFDAKAGLTWKDSAGREFSATMKELAEWQGTRADA 732

Query: 737 GSLVPKGFPRSGKF 750
           G L PKGFP+S KF
Sbjct: 733 GRLPPKGFPKSNKF 746


>gi|154247807|ref|YP_001418765.1| DNA topoisomerase IV subunit A [Xanthobacter autotrophicus Py2]
 gi|154161892|gb|ABS69108.1| DNA topoisomerase IV, A subunit [Xanthobacter autotrophicus Py2]
          Length = 745

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/735 (56%), Positives = 544/735 (74%), Gaps = 2/735 (0%)

Query: 16  NVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKS 75
           +++ V+L+ ALEERYLAYALSTI  RA+PD RDG KPVHRRI+HAM ++ LD G  FKKS
Sbjct: 12  HIEKVTLKEALEERYLAYALSTIMHRALPDARDGLKPVHRRILHAMRQLRLDPGQGFKKS 71

Query: 76  ARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEAR 135
           AR+VG+VIGK HPHGDQSVYD+LVRLAQ F QRYPL+ GQGNFGN+DGD+AAA RYTEAR
Sbjct: 72  ARVVGDVIGKFHPHGDQSVYDALVRLAQDFAQRYPLVDGQGNFGNVDGDNAAAMRYTEAR 131

Query: 136 MTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHN 195
           +T+ A L+L G+DEDAVDFR TY+  + EP V P+ FPNLLANG+ GIAVGMATSIP HN
Sbjct: 132 LTETARLLLDGIDEDAVDFRPTYDGSEEEPAVLPAAFPNLLANGSQGIAVGMATSIPPHN 191

Query: 196 VQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRAR 255
             E+ +AAL LID+PE     LL+++ GPDFPTGG++VE    + E+Y  GRG FRVRAR
Sbjct: 192 AAELLDAALHLIDHPEAPAFDLLQFVPGPDFPTGGVLVEDPVGVAEAYATGRGSFRVRAR 251

Query: 256 WCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFP 315
           W  EE GRG++ +VVTEIPY V KSRL+EKIAEL+  K++PLL D+RDESAED+R+VL P
Sbjct: 252 WEKEETGRGTYVVVVTEIPYGVAKSRLVEKIAELLTDKKLPLLADVRDESAEDIRLVLEP 311

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           + R++D ++LMES+F L+++E R PLNMNVL  G+VP+V+ L   L+EWL HRR+VL RR
Sbjct: 312 RARTVDAEVLMESLFKLTELEARIPLNMNVLVRGQVPKVLSLSEALREWLDHRRDVLLRR 371

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
           S +R++ I  R+E+L G LIAYLN+DE+I IIR ED+PK  ++  F LT+ Q +AILN+R
Sbjct: 372 SRYRLEQIAHRLEVLGGYLIAYLNLDEVIRIIREEDEPKQELMRTFELTDVQTEAILNMR 431

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LRSLR+LEE +I+ E D L  E++ ++ L+ S   QW  IA EIRE ++ +   T +GRR
Sbjct: 432 LRSLRRLEEMEIRKEHDALSKEQDGLNKLVASEAAQWKSIAKEIRETRKTYGPETAIGRR 491

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           RTTF       +    +A++E+EP+T+V+S +GWIR+LK H  DLS L FK  DSL  A 
Sbjct: 492 RTTFAAPPTFHEDAFTEALVEREPVTIVVSAKGWIRALKGHVQDLSNLQFKGDDSLGHAF 551

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
            A TT ++++ +++G+ YTL A  L  GRGHGE ++L+IDL    +IV+ F Y    KLL
Sbjct: 552 FAETTSKVMVFASNGRFYTLEAAKLPGGRGHGEPVRLMIDLEQEAEIVSVFAYQPGRKLL 611

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSI 675
           + S +G  F+V E + +ANTRKGK  L     +    V  V GD VAV+G+NRKLL+F +
Sbjct: 612 LASKEGRGFVVGEDDCLANTRKGKQVLVTDPPDAALAVRFVEGDWVAVIGDNRKLLLFPL 671

Query: 676 DQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGG 735
           +Q+PEM+RG+GVR Q Y++GG+SD+  F +  GLTW D++GR++  +E  LL W G+R  
Sbjct: 672 NQVPEMTRGRGVRFQRYREGGLSDLKAFSMASGLTWEDTSGRTWTVTE--LLEWQGERAS 729

Query: 736 VGSLVPKGFPRSGKF 750
            G L PKGFPRS KF
Sbjct: 730 AGRLPPKGFPRSNKF 744


>gi|217978281|ref|YP_002362428.1| DNA topoisomerase IV subunit A [Methylocella silvestris BL2]
 gi|217503657|gb|ACK51066.1| DNA topoisomerase IV, A subunit [Methylocella silvestris BL2]
          Length = 750

 Score =  877 bits (2267), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/735 (56%), Positives = 540/735 (73%)

Query: 16  NVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKS 75
             + V+LR ALEERYLAYALSTI  RA+PD RDG KPVHRRI++ M  + LD G AFKK 
Sbjct: 15  GTEPVNLREALEERYLAYALSTIMGRALPDARDGLKPVHRRILYGMQILRLDPGTAFKKC 74

Query: 76  ARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEAR 135
           A+IVG+V+G  HPHGDQ++YD+LVRLAQ F  RYPL+ GQGNFGNIDGD AAAYRYTEAR
Sbjct: 75  AKIVGDVMGSFHPHGDQAIYDALVRLAQDFSSRYPLVDGQGNFGNIDGDGAAAYRYTEAR 134

Query: 136 MTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHN 195
           MT VA L+L+G+DED+VDFRD Y+ +  EPVV PS  PNLLANG  GIAVGMATSIP HN
Sbjct: 135 MTDVARLLLEGIDEDSVDFRDNYSGDQQEPVVLPSALPNLLANGAQGIAVGMATSIPPHN 194

Query: 196 VQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRAR 255
           + E+C+AAL L+ + + S ++LL +  GPDFPTGG++VES++SI E+YR GRG  R+RAR
Sbjct: 195 LAELCDAALYLLSHSDASTDQLLSFAPGPDFPTGGVLVESKQSIAETYRTGRGSLRLRAR 254

Query: 256 WCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFP 315
           W  EE  RG+W IVVTEIPY VQKSRLIEKIAEL+  K++PL+ DIRDESAEDVR+V+ P
Sbjct: 255 WSKEEAARGAWTIVVTEIPYMVQKSRLIEKIAELLNDKKLPLVADIRDESAEDVRVVIEP 314

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           K+R++DP LLME +F L+++ETRFP+N+NVL  G  P+V+     L++WL HRREVL RR
Sbjct: 315 KSRTVDPALLMEHLFRLTELETRFPVNLNVLVDGVAPRVVSFKEALQQWLDHRREVLVRR 374

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
           +  R+  I RR+E+L G+LI +LN+DE+I IIR ED+PK  +   FSL++ QV+ +L+ R
Sbjct: 375 ARHRLAEIVRRLELLAGMLIVFLNLDEVIRIIREEDEPKERLQLAFSLSDMQVNYVLDTR 434

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LRSLR+LEE QI+ E + L  EK ++++LL    +QW +IA EIR++K+ +   T LGRR
Sbjct: 435 LRSLRRLEEMQIQREHEALEKEKLELEALLADEARQWKKIAAEIRDLKKKYGPETKLGRR 494

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           RT+F E     +     AM+E+EP+TVV+S +GWIR+LK    DLS L FK  DSL I+ 
Sbjct: 495 RTSFAEAPDVGEIDFASAMVEREPVTVVVSEKGWIRALKGQVADLSGLQFKGDDSLHISF 554

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
            A TT +IL+LS DGK +TL AG L  GR  GE ++LL D+   + +   F Y    K+L
Sbjct: 555 FAETTSKILVLSGDGKIFTLDAGKLPGGRSQGEPLRLLADIGEGESVAAVFPYAPGQKML 614

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSI 675
           V +  G  F+V + E+I  TRKGK  L V      K++V   GDHVA++GENRKLL+F +
Sbjct: 615 VATDDGRGFVVSQDEMIGGTRKGKLLLNVEKPGIAKIIVPADGDHVAIIGENRKLLVFPL 674

Query: 676 DQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGG 735
           DQ+PEM+RGKGVRLQ Y+DGG++D   F I EGL+W DSAGR +  ++ +L  W+G R  
Sbjct: 675 DQVPEMARGKGVRLQKYRDGGVADAKVFSIVEGLSWKDSAGRVFVVAKPELAEWIGNRAE 734

Query: 736 VGSLVPKGFPRSGKF 750
            G L P+GFP++ +F
Sbjct: 735 AGRLPPRGFPKNNRF 749


>gi|299135097|ref|ZP_07028288.1| DNA topoisomerase IV, A subunit [Afipia sp. 1NLS2]
 gi|298590074|gb|EFI50278.1| DNA topoisomerase IV, A subunit [Afipia sp. 1NLS2]
          Length = 751

 Score =  877 bits (2267), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/736 (56%), Positives = 547/736 (74%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           ++++ V+LR ALEERYLAYALSTI  RA+PD RDG KPVHRRI++ M  + LD  + FKK
Sbjct: 11  QDIQEVALREALEERYLAYALSTIMHRALPDARDGLKPVHRRILYGMRLLRLDPSSPFKK 70

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEA 134
           SA+IVG+V+G  HPHGDQ++YD+LVRLAQ F  RYPL+ GQGNFGN+DGD+ AA RYTE+
Sbjct: 71  SAKIVGDVMGGFHPHGDQAIYDALVRLAQDFSSRYPLVDGQGNFGNVDGDNPAAMRYTES 130

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           R+T VA L+L+G+DEDAV+FR TY+  D EPVV P  FPNLLANG  GIAVGMATSIP H
Sbjct: 131 RLTDVARLLLEGLDEDAVEFRPTYDGSDKEPVVLPGGFPNLLANGAQGIAVGMATSIPPH 190

Query: 195 NVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
           N  E+C+AAL LID P      LL Y+ GPDFPTGGI+V+S++SI E+Y  GRGGFRVRA
Sbjct: 191 NAAELCDAALHLIDKPATKTRGLLRYVKGPDFPTGGIVVDSQDSIAEAYATGRGGFRVRA 250

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLF 314
           +W  E+  RG+W IVVTEIP+ VQKSRLIE+IAEL+  K++ L+ DIRDESAED+RIV+ 
Sbjct: 251 KWHQEDGARGTWNIVVTEIPWLVQKSRLIERIAELLNEKKLHLVGDIRDESAEDIRIVIE 310

Query: 315 PKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFR 374
           PK++++DP++LME++F  +D+E+R PLN+NVL  GR+P+V+ L   L+EWL H R+VL R
Sbjct: 311 PKSKNVDPEVLMETLFKQTDLESRIPLNLNVLVKGRIPKVLGLAECLREWLDHLRDVLVR 370

Query: 375 RSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNL 434
           RS+ R   I+ R+E+L G LIAYLN+D++I IIR ED+PKPV++  F LT+ Q D+ILN+
Sbjct: 371 RSNHRKSQIEHRLEVLGGYLIAYLNLDKVIKIIRTEDEPKPVLIKTFKLTDIQADSILNM 430

Query: 435 RLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGR 494
           RLR+LRKLEE +I+ E   L AE + + ++L S  +QW ++  ++++V+E+F   T LG+
Sbjct: 431 RLRNLRKLEEMEIRGEDKKLRAELKDLKAVLASQDEQWKKVGEQVKKVRELFGPKTALGK 490

Query: 495 RRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIA 554
           RRT F +    D A +++A+IE+EPITVV+S++GW+R+LK H  DLS L FK  D L I+
Sbjct: 491 RRTQFADAPEHDLAAIEEALIEREPITVVVSDKGWVRTLKGHVEDLSNLTFKTDDRLGIS 550

Query: 555 LHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKL 614
             A TT ++LLL T G+ YTL A  L  GRGHG+ I+  IDL  + +IV+ FV     K 
Sbjct: 551 FFAETTSKLLLLGTHGRFYTLDAQKLPGGRGHGDPIRSFIDLEGDANIVSLFVNTGGRKF 610

Query: 615 LVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
           L+ S  G  F+V E + + NTRKGK  L V++  +   +  V GD VAV+GENRK+LIF 
Sbjct: 611 LIASHDGQGFVVNEDDCVGNTRKGKQVLNVTAPNEAAAICTVAGDTVAVIGENRKMLIFP 670

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
           +DQ+PEM+RG+GVRLQ YKDGG+SD+  F   EGLTW DSAGR ++ +  +L  W G R 
Sbjct: 671 LDQVPEMARGRGVRLQRYKDGGLSDITTFTAKEGLTWKDSAGREFSATWKELSDWRGNRA 730

Query: 735 GVGSLVPKGFPRSGKF 750
             G L PKGFP+S KF
Sbjct: 731 DAGRLPPKGFPKSNKF 746


>gi|92117770|ref|YP_577499.1| DNA topoisomerase IV subunit A [Nitrobacter hamburgensis X14]
 gi|91800664|gb|ABE63039.1| DNA topoisomerase IV subunit A [Nitrobacter hamburgensis X14]
          Length = 749

 Score =  871 bits (2251), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/731 (56%), Positives = 539/731 (73%), Gaps = 1/731 (0%)

Query: 20  VSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIV 79
           V LR ALEERYLAYALSTI  RA+PD RDG KPVHRRI++ M  + LD G+AFKKSA+IV
Sbjct: 16  VQLRDALEERYLAYALSTIMHRALPDARDGLKPVHRRILYGMRLLRLDPGSAFKKSAKIV 75

Query: 80  GEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQV 139
           G+V+G  HPHGDQ++YD++VRLAQ F  RYPL+ GQGNFGNIDGD+ AAYRYTEARMT V
Sbjct: 76  GDVMGSFHPHGDQAIYDAMVRLAQDFASRYPLVDGQGNFGNIDGDNPAAYRYTEARMTDV 135

Query: 140 AELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEI 199
           A L+L+G+DEDAV+FR  Y+ +  EPVV P  FPNLLANG  GIAVGMAT+IP HN  E+
Sbjct: 136 ARLLLEGIDEDAVEFRPNYDGQTREPVVLPGGFPNLLANGAQGIAVGMATAIPPHNAAEL 195

Query: 200 CEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVE 259
           C+AAL LID P+ + + LL ++ GPDFPTGGII++S+ESI E+Y  GRG FR RA+W  E
Sbjct: 196 CDAALHLIDKPDATSKSLLRWVKGPDFPTGGIIIDSKESITEAYMTGRGAFRTRAKWNQE 255

Query: 260 EVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRS 319
           E  RG+W IVVTEIP+ VQKSRLIEKIAEL+  K++PL+ DIRDESAED+R+V+ PK+R+
Sbjct: 256 EGARGTWVIVVTEIPWLVQKSRLIEKIAELLNEKKLPLVGDIRDESAEDIRVVIEPKSRN 315

Query: 320 LDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFR 379
           +DP+L+MES+F L+++E+R  LN+NVL  G++P+V+ L   L+EWL H R+VL RRS++R
Sbjct: 316 VDPELVMESLFKLTELESRISLNLNVLIKGKIPKVVGLAECLREWLDHLRDVLLRRSAYR 375

Query: 380 MQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSL 439
              I+ R+E+L G LIAYLNID++I IIR ED+PKP ++  F LTE Q +AILN+RLRSL
Sbjct: 376 KAQIEHRLEVLGGYLIAYLNIDKVIKIIRTEDEPKPALMKAFKLTEVQAEAILNMRLRSL 435

Query: 440 RKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTF 499
           RKLEE +I++E  NL AE + I+++L S  +QW ++A ++R V+++F   T LG+RRT F
Sbjct: 436 RKLEEMEIRTEDKNLRAELKGINAVLGSEARQWEKVAEQVRTVRDMFGPKTPLGKRRTVF 495

Query: 500 CEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHT 559
            +    D A L+++++E+EP+TVV+S++GW+R+LK H  DLS+L FK  D L  A  A T
Sbjct: 496 ADAPEHDLAALEESLVEREPVTVVLSDKGWVRTLKGHVEDLSSLSFKTNDKLGFAFFAET 555

Query: 560 TDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSS 619
           T ++LL +T+GK Y+L    L  GRGHGE I+L ID+  +  IV+ FV     K L+ S 
Sbjct: 556 TSKLLLFATNGKFYSLDVAKLPGGRGHGEPIRLFIDMEQDAAIVSLFVNTGGRKFLIASH 615

Query: 620 KGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIP 679
           +G  FIV E + +  TRKGK  L V    + K +V V GD VAV+G N K++IF +DQ+P
Sbjct: 616 EGQGFIVNEDDCVGTTRKGKQVLNVEMPNEAKAIVTVAGDQVAVIGTNHKMVIFPLDQVP 675

Query: 680 EMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSL 739
           EM+RG+GVRLQ YKD G+SDV  F    GLTW DSAGR       DL  W G R   G L
Sbjct: 676 EMARGRGVRLQKYKDAGLSDVAVFDSKAGLTWKDSAGREQGLRWKDLSDWRGNRADAGRL 735

Query: 740 VPKGFPRSGKF 750
              G P+S +F
Sbjct: 736 A-HGLPKSNRF 745


>gi|209884981|ref|YP_002288838.1| DNA topoisomerase IV, A subunit [Oligotropha carboxidovorans OM5]
 gi|209873177|gb|ACI92973.1| DNA topoisomerase IV, A subunit [Oligotropha carboxidovorans OM5]
          Length = 751

 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/736 (56%), Positives = 545/736 (74%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           ++V+ V+LR ALEERYLAYALSTI  RA+PD RDG KPVHRRI++ M  + LD  + FKK
Sbjct: 11  QDVQEVALREALEERYLAYALSTIMHRALPDARDGLKPVHRRILYGMRLLRLDPSSPFKK 70

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEA 134
           SA+IVG+V+G  HPHGDQ++YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTE+
Sbjct: 71  SAKIVGDVMGGFHPHGDQAIYDALVRLAQDFSSRYPLVDGQGNFGNIDGDNPAAMRYTES 130

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           R+T VA L+L+G+DEDAV+FR +Y+  D EP V P  FPNLLANG  GIAVGMAT+IP H
Sbjct: 131 RLTDVARLLLEGLDEDAVEFRPSYDGSDKEPTVLPGGFPNLLANGAQGIAVGMATAIPPH 190

Query: 195 NVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
           N  E+C+AAL LI  P    + LL Y+ GPDFPTGGI+V+ +ESI E+Y  GRG FRVRA
Sbjct: 191 NAAELCDAALHLIAKPATKTQGLLRYVKGPDFPTGGIVVDGQESIAEAYNTGRGAFRVRA 250

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLF 314
           +W  E+  RG+W IVVTEIP+ VQKSRLIE+IAEL+  K++ L+ DIRDESAED+RIV+ 
Sbjct: 251 KWHQEDGARGTWHIVVTEIPWLVQKSRLIERIAELLNEKKLHLVGDIRDESAEDIRIVIE 310

Query: 315 PKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFR 374
           PK++++DP++LME++F  +D+E+R PLN+NVL  GRVP+V+ L   L+EWL H R+VL R
Sbjct: 311 PKSKNVDPEVLMETLFKQTDLESRIPLNLNVLVKGRVPKVLGLAECLREWLDHLRDVLVR 370

Query: 375 RSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNL 434
           RS+ R   I+ R+E+L G LIAYLN+D++I IIR ED+PKPV++  F LT+ Q D+ILN+
Sbjct: 371 RSNHRKNQIEHRLEVLGGYLIAYLNLDKVIKIIRTEDEPKPVLIRTFKLTDLQADSILNM 430

Query: 435 RLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGR 494
           RLR+LRKLEE +I+ E  NL  E + I ++L S ++QW +++ ++++V+++F   T LG+
Sbjct: 431 RLRNLRKLEEMEIRGEDKNLRTELKGIKAVLASEEEQWKKVSEQVKKVRDLFGPKTPLGK 490

Query: 495 RRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIA 554
           RRT F      D ATL++A +E+EPITVV+S++GW+R+LK H  DLS L FK  D L I+
Sbjct: 491 RRTQFANAPEHDLATLEEAFVEREPITVVVSDKGWVRTLKGHVEDLSNLTFKTDDRLGIS 550

Query: 555 LHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKL 614
             A TT ++LLL T G+ YTL A  L  GRGHG+ I+  IDL  + +IV+ FV     K 
Sbjct: 551 FFAETTSKLLLLGTHGRFYTLDAQKLPGGRGHGDPIRSFIDLEGDANIVSLFVNTGGRKF 610

Query: 615 LVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
           L+ S  G  F+V E + + NTRKGK  + V+   ++  +  V GD VAV+GENRK+LIF 
Sbjct: 611 LIASHDGQGFVVNEDDCVGNTRKGKQVMNVTMPNEVAAIATVEGDTVAVIGENRKMLIFP 670

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
           ++Q+PEM+RG+GVRLQ YKDGG+SDV  F   EGLTW DSAGR ++ S  +L  W G R 
Sbjct: 671 LEQVPEMARGRGVRLQRYKDGGLSDVTTFTAKEGLTWRDSAGREFSASWKELSDWRGNRA 730

Query: 735 GVGSLVPKGFPRSGKF 750
             G L PKGFP+S KF
Sbjct: 731 DAGRLPPKGFPKSNKF 746


>gi|323137539|ref|ZP_08072616.1| DNA topoisomerase IV, A subunit [Methylocystis sp. ATCC 49242]
 gi|322397165|gb|EFX99689.1| DNA topoisomerase IV, A subunit [Methylocystis sp. ATCC 49242]
          Length = 754

 Score =  870 bits (2248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/731 (56%), Positives = 541/731 (74%)

Query: 20  VSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIV 79
           V LR ALEERYL YALSTI +RA+PD RDG KPVHRRI++ M  + LD GA FKK A+IV
Sbjct: 23  VDLREALEERYLRYALSTITDRALPDARDGLKPVHRRILYGMHVLRLDPGAPFKKCAKIV 82

Query: 80  GEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQV 139
           G+V+G  HPHGDQ++YD+LVRLAQ F  RYPL+ GQGNFGNIDGDSAAAYRYTEARMT V
Sbjct: 83  GDVMGSFHPHGDQAIYDALVRLAQDFSSRYPLVDGQGNFGNIDGDSAAAYRYTEARMTSV 142

Query: 140 AELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEI 199
           A  +L+G+DEDA+DF+  Y+ E+ EP+V PS  PN+LANG  GIAVGMATSIP HN+ E+
Sbjct: 143 ARGLLEGIDEDAIDFKPNYSGEEKEPIVLPSALPNMLANGAQGIAVGMATSIPPHNLAEL 202

Query: 200 CEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVE 259
           C+AAL LI +   + E+LL ++ GPDFPTGGIIV+ RE IVE+YR GRG FRVRARW  E
Sbjct: 203 CDAALYLISHRNATSEQLLTFVQGPDFPTGGIIVDRREEIVEAYRTGRGSFRVRARWTKE 262

Query: 260 EVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRS 319
           E+ RG W  VVTEIPY VQKSRLIEK+AELI  +++PL+ D+RDESAEDVRIVL P++R+
Sbjct: 263 ELPRGGWVAVVTEIPYGVQKSRLIEKLAELISERKLPLVADVRDESAEDVRIVLEPRSRN 322

Query: 320 LDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFR 379
           +D  L+ME++F LS++ETRF +NMNVL  G  P+V+ LD  L++WL HRREVL RRS  R
Sbjct: 323 IDAALMMETLFKLSELETRFGMNMNVLVDGVTPRVVSLDEALRQWLDHRREVLQRRSRHR 382

Query: 380 MQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSL 439
           + AI RR+E L+G++I +LN+DE+I IIR ED  K  +   F LT+ QVD IL+ RLRSL
Sbjct: 383 LAAILRRIEQLEGMIIVFLNLDEVIRIIREEDDAKGELKKAFKLTDLQVDYILDTRLRSL 442

Query: 440 RKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTF 499
           RKLEE +++ EL  L  E+  I++LL    +QW  IA ++RE+K+I+   T++G+RRTTF
Sbjct: 443 RKLEEMELRRELKELTDERADIEALLADDGRQWKTIAAQVRELKKIYGPQTEIGKRRTTF 502

Query: 500 CEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHT 559
            +   A    L +AMIE+EPITVV+S +GWIR+LK H  DLS L FK  D L  +  A T
Sbjct: 503 EDAPAAVDLDLAEAMIEREPITVVVSKKGWIRALKGHVQDLSTLQFKGDDELDTSFFAQT 562

Query: 560 TDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSS 619
           T +IL+L+T+GKAYTL A  L  GRGHGE I+L  D++ +  +     ++    LL+V+ 
Sbjct: 563 TSKILVLATNGKAYTLDASKLPGGRGHGEPIRLFADIDEDASVARVLPHEPQASLLLVAD 622

Query: 620 KGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIP 679
            G  F+V + +++++T+KG+  L V    ++K+V +  GDHVA++GENRKLL+F +++ P
Sbjct: 623 DGRGFVVAQDDLLSSTKKGRAVLNVEPPARLKVVTEAAGDHVAIIGENRKLLVFPLEEAP 682

Query: 680 EMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSL 739
            M+RGKGVR+Q YKDGG++D   F + +GLTW DS+GR +   + +L  W+G R   G L
Sbjct: 683 RMARGKGVRMQRYKDGGVADAKVFSLADGLTWTDSSGRVFTVEKLELKEWIGHRAEAGRL 742

Query: 740 VPKGFPRSGKF 750
            P+GFPR+ +F
Sbjct: 743 PPRGFPRNNRF 753


>gi|75676105|ref|YP_318526.1| DNA topoisomerase IV subunit A [Nitrobacter winogradskyi Nb-255]
 gi|74420975|gb|ABA05174.1| DNA topoisomerase IV subunit A [Nitrobacter winogradskyi Nb-255]
          Length = 749

 Score =  868 bits (2242), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/734 (56%), Positives = 538/734 (73%), Gaps = 1/734 (0%)

Query: 17  VKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSA 76
           +  V LR ALEERYLAYALSTI  RA+PD RDG KPVHRRI++ M  + LD G+AFKKSA
Sbjct: 13  IAEVQLREALEERYLAYALSTIMHRALPDARDGLKPVHRRILYGMRLLRLDPGSAFKKSA 72

Query: 77  RIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARM 136
           +IVG+V+G  HPHGDQ++YD++VRLAQ F  RYPL+ GQGNFGNIDGD+ AAYRYTEARM
Sbjct: 73  KIVGDVMGSFHPHGDQAIYDAMVRLAQDFASRYPLVDGQGNFGNIDGDNPAAYRYTEARM 132

Query: 137 TQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNV 196
           T VA L+L G+DEDAV+FR  Y+ +  EPVV P  FPNLLANG  GIAVGMAT+IP HN 
Sbjct: 133 TDVARLLLDGIDEDAVEFRPNYDGQSREPVVLPGGFPNLLANGAQGIAVGMATAIPPHNA 192

Query: 197 QEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW 256
            E+C+AAL LID P+     LL+++ GPDFPTGGII++S+ESI E+Y  GRG FR RA+W
Sbjct: 193 AELCDAALHLIDKPDAKSTSLLKWVKGPDFPTGGIIIDSKESIAEAYATGRGAFRTRAKW 252

Query: 257 CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPK 316
             EE  RG+W IVVTEIP+ VQKSRLIEKIAEL+  K++PL+ DIRDESAED+R+V+ PK
Sbjct: 253 HREEGARGTWVIVVTEIPWLVQKSRLIEKIAELLNEKKLPLVGDIRDESAEDIRVVIEPK 312

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           +R++DP+L+MES+F L+++E+R  LN+NVL  G++P+V+ L   L+EWL H R+VL RRS
Sbjct: 313 SRNVDPELVMESLFRLTELESRISLNLNVLIKGKIPKVVGLAECLREWLDHLRDVLLRRS 372

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
           + R   I+ R+E+L G LIAYLNIDE+I IIR ED+PKP ++  F LTE Q +AILN+RL
Sbjct: 373 AHRKAQIEHRLEVLGGYLIAYLNIDEVIRIIRTEDEPKPALIKAFKLTEVQAEAILNMRL 432

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           RSLRKLEE +I++E  +L AE + I+++L S  +QW ++  ++R V+++F   T LG+RR
Sbjct: 433 RSLRKLEEMEIRTEDKDLRAELKGINAVLGSEARQWEKVGEQVRNVRDMFGPRTPLGKRR 492

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
           T F +    D A L+++++E+EP+TVV+S++GW+R+LK H  DLS L FK  D L  A  
Sbjct: 493 TVFADAPEHDLAALEESLVEREPVTVVVSDKGWVRTLKGHVEDLSNLSFKTDDKLGFAFF 552

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
           A TT ++LL +T+GK Y+L    L  GRGHGE I+L IDL  +  IV+ FV+    K L+
Sbjct: 553 AETTSKLLLFATNGKFYSLDVAKLPGGRGHGEPIRLFIDLEQDAAIVSLFVHTGGRKFLI 612

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSID 676
            S +G  F+V E + ++ TRKGK  L V    + K +  V GD VAV+G N K+++F +D
Sbjct: 613 ASHEGQGFVVNEDDCVSTTRKGKQVLNVEMPNEAKAITTVAGDQVAVIGTNHKMVVFPLD 672

Query: 677 QIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGV 736
           Q+PEM+RG+GVRLQ YKD G+SDV  F    GLTW DSAGR  + S  DL  W G R   
Sbjct: 673 QVPEMARGRGVRLQKYKDAGLSDVAVFNSKIGLTWKDSAGREQSLSWKDLSDWRGNRADA 732

Query: 737 GSLVPKGFPRSGKF 750
           G L   G P+S KF
Sbjct: 733 GRLA-HGLPKSNKF 745


>gi|85716280|ref|ZP_01047254.1| DNA topoisomerase IV subunit A [Nitrobacter sp. Nb-311A]
 gi|85696952|gb|EAQ34836.1| DNA topoisomerase IV subunit A [Nitrobacter sp. Nb-311A]
          Length = 749

 Score =  865 bits (2236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/734 (55%), Positives = 536/734 (73%), Gaps = 1/734 (0%)

Query: 17  VKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSA 76
           +  V LR ALEERYLAYALSTI  RA+PD RDG KPVHRRI++ M  + LD G+AFKKSA
Sbjct: 13  IHEVQLREALEERYLAYALSTIMHRALPDARDGLKPVHRRILYGMRLLRLDPGSAFKKSA 72

Query: 77  RIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARM 136
           +IVG+V+G  HPHGDQ++YD++VRLAQ F  RYPL+ GQGNFGNIDGD+ AAYRYTEARM
Sbjct: 73  KIVGDVMGSFHPHGDQAIYDAMVRLAQDFASRYPLVDGQGNFGNIDGDNPAAYRYTEARM 132

Query: 137 TQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNV 196
           T VA L+L G+DEDAV+FR  Y+ +  EPVV P  FPNLLANG  GIAVGMAT+IP HN 
Sbjct: 133 TDVARLLLDGIDEDAVEFRPNYDGQSREPVVLPGGFPNLLANGAQGIAVGMATAIPPHNA 192

Query: 197 QEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW 256
            E+C+AAL LID P+   + LL+++ GPDFPTGGII++S+ESI ++Y  GRG FR RA+W
Sbjct: 193 AELCDAALHLIDKPDAKPKALLKWVKGPDFPTGGIIIDSKESIADAYTTGRGAFRTRAKW 252

Query: 257 CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPK 316
             E+  RG+W IVVT+IP+ VQKSRLIEKIAEL+  K++PL+ DIRDESAED+R+V+ PK
Sbjct: 253 HREDGARGTWVIVVTQIPWLVQKSRLIEKIAELLNDKKLPLVGDIRDESAEDIRVVIEPK 312

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           +R++DP+L+MES+F L+++E+R  LN+NVL  GR+P+V+ L   L+EWL H R+VL RRS
Sbjct: 313 SRNVDPELVMESLFKLTELESRISLNLNVLIKGRIPKVVGLAECLREWLDHLRDVLLRRS 372

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
           + R   I+ R+E+L G LIAYLNID++I IIR ED+PKP ++  F LTE Q DAILN+RL
Sbjct: 373 AHRKAQIEHRLEVLGGYLIAYLNIDKVIKIIRTEDEPKPALIKAFKLTEVQADAILNMRL 432

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           RSLRKLEE +I++E  NL AE + I+++L S  +QW ++  ++R V+++F   T LG+RR
Sbjct: 433 RSLRKLEEMEIRTEDKNLRAELKGINAVLGSEARQWEKVGEQVRNVRDMFGPKTPLGKRR 492

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
           T F +    D A L+++++E+EP+TVV+S++GW+R+LK H  DLS L FK  D L  A  
Sbjct: 493 TVFADAPEHDLAALEESLVEREPVTVVVSDKGWVRTLKGHVEDLSNLSFKTDDKLGFAFL 552

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
           A TT ++LL +T+GK Y+L    L  GRGHGE I+L IDL  +  IV+ FV     K L+
Sbjct: 553 AETTSKLLLFATNGKFYSLDVAKLPGGRGHGEPIRLFIDLEQDAAIVSLFVNTGGRKFLI 612

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSID 676
            S +G  F+V E + +  TRKGK  L V    + K +  V GD VAV+G N K++IF +D
Sbjct: 613 ASHEGQGFVVNEDDCVGTTRKGKQVLSVEMPNEAKAITTVAGDQVAVIGTNHKMVIFPLD 672

Query: 677 QIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGV 736
           Q+PEM+RG+GVRLQ Y+D G+SDV  F    GLTW DSAGR    S  DL  W G R   
Sbjct: 673 QVPEMARGRGVRLQKYRDAGLSDVAVFDSKTGLTWRDSAGREQGLSWKDLSDWRGNRADA 732

Query: 737 GSLVPKGFPRSGKF 750
           G L   G P+S KF
Sbjct: 733 GRLA-HGLPKSNKF 745


>gi|148256016|ref|YP_001240601.1| DNA topoisomerase IV subunit A [Bradyrhizobium sp. BTAi1]
 gi|146408189|gb|ABQ36695.1| DNA topoisomerase IV subunit A [Bradyrhizobium sp. BTAi1]
          Length = 750

 Score =  863 bits (2230), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/734 (55%), Positives = 540/734 (73%), Gaps = 1/734 (0%)

Query: 17  VKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSA 76
           +  V+LR ALEERYLAYALSTI  RA+PD RDG KPVHRRI++ M  + LD G AFKKSA
Sbjct: 13  IHEVALREALEERYLAYALSTIMHRALPDARDGLKPVHRRILYGMRLLRLDPGTAFKKSA 72

Query: 77  RIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARM 136
           +IVG+V+G  HPHGDQ++YD++VRLAQ F  RYPL+ GQGNFGNIDGD+AAAYRYTEARM
Sbjct: 73  KIVGDVMGSFHPHGDQAIYDAMVRLAQDFSSRYPLVDGQGNFGNIDGDNAAAYRYTEARM 132

Query: 137 TQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNV 196
           T VA L+L+G+DED V+FR  Y+ +  EPVV P  FPNLLANG  GIAVGMATSIP HN 
Sbjct: 133 TDVARLLLEGIDEDGVEFRPNYDGQSKEPVVLPGGFPNLLANGAQGIAVGMATSIPPHNA 192

Query: 197 QEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW 256
            E+C+AAL LI+ P+     LL ++ GPDFPTGG +++S+ESI+E+Y  GRG FRVRA+W
Sbjct: 193 AELCDAALHLIEKPDAKSRALLRWVKGPDFPTGGTVIDSKESIIEAYTTGRGSFRVRAKW 252

Query: 257 CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPK 316
             EE  RG+W +V+TEIPY VQKSRL+EKIAEL+  K++PL+ D+RDESAEDVR+V+ PK
Sbjct: 253 KQEEGNRGTWIVVITEIPYLVQKSRLVEKIAELLNEKKLPLVGDVRDESAEDVRLVIEPK 312

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           ++++DP L+MES+F L+D+E++ PLN+NVL  G++P+V+ L   L+EWL H R+VL RRS
Sbjct: 313 SKNVDPALMMESLFRLTDLESKIPLNLNVLIKGKIPKVVGLAECLREWLDHLRDVLLRRS 372

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
           ++R + I+ R+EIL G LIAYLNIDE+I IIR ED+PKPV++  F LTE Q +AILN+RL
Sbjct: 373 NYRKKQIENRLEILGGYLIAYLNIDEVIRIIRTEDEPKPVLMKTFKLTEVQAEAILNMRL 432

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           RSLRKLEE +I++E  NL  E + I+ LL S + QW ++  +++ V+++F   T LGRRR
Sbjct: 433 RSLRKLEEMEIRTEDKNLRGELKGINELLASEQVQWAKVGEQVKTVRDLFGPKTPLGRRR 492

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
           T F +    D A +++A IE+EP+TVV+S +GW+R+LK H  DLS L FK  D L  A  
Sbjct: 493 TNFADAPEHDLAAIEEAFIEREPVTVVVSEKGWVRTLKGHVADLSNLQFKTDDQLGQAFF 552

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
           A  T ++LL +++GK Y+L  G L  GRGHGE I++ IDL+ +  IV+ FV     K L+
Sbjct: 553 AENTSKVLLFASNGKFYSLDVGKLPGGRGHGEPIRMFIDLDQDASIVSMFVSKGERKFLI 612

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSID 676
            +S G  F+V+E + ++NTRKGK  L V++  + + +  V GD VAV+G N K+++F +D
Sbjct: 613 AASDGQGFVVKEEDCVSNTRKGKQVLNVTAPAEARAITTVQGDQVAVIGTNHKMVVFGLD 672

Query: 677 QIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGV 736
           Q+PEM+RG+GVRLQ Y    +SDV  F+  +GL W DSAGR    S  +L  + G R   
Sbjct: 673 QVPEMARGRGVRLQKYTSAQLSDVTTFEQKQGLAWKDSAGRDQGLSWKELADYRGNRADA 732

Query: 737 GSLVPKGFPRSGKF 750
           G +  +G P+S KF
Sbjct: 733 GRIA-QGLPKSNKF 745


>gi|158423631|ref|YP_001524923.1| DNA topoisomerase IV subunit A [Azorhizobium caulinodans ORS 571]
 gi|158330520|dbj|BAF88005.1| gram negative topoisomerase IV subunit A [Azorhizobium caulinodans
           ORS 571]
          Length = 745

 Score =  863 bits (2229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/735 (55%), Positives = 544/735 (74%), Gaps = 2/735 (0%)

Query: 16  NVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKS 75
           +V+ V L+ ALEERYLAYALSTI  RA+PD RDG KPVHRRI+HAM ++ LD G+ FKK 
Sbjct: 12  SVEPVDLKAALEERYLAYALSTIMHRALPDARDGLKPVHRRILHAMRQLKLDPGSGFKKC 71

Query: 76  ARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEAR 135
           AR+VG+VIGK HPHGDQ+VYD+LVRLAQ F QRYPL+ GQGNFGN+DGD+AAA RYTEAR
Sbjct: 72  ARVVGDVIGKFHPHGDQAVYDALVRLAQDFAQRYPLVDGQGNFGNVDGDNAAAMRYTEAR 131

Query: 136 MTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHN 195
           +T+ A L+L G+D+DAVDFR TY+  + EPVV P+ FPNLLANG+ GIAVGMATSIP HN
Sbjct: 132 LTETARLLLDGIDDDAVDFRPTYDGSEEEPVVLPAAFPNLLANGSQGIAVGMATSIPPHN 191

Query: 196 VQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRAR 255
             E+ +A+L L+++P      LL+++ GPDFPTGGI+VE      E+Y  GRG FRVRAR
Sbjct: 192 AAELLDASLHLLEHPNAPASDLLQFVPGPDFPTGGILVEDPVGTAEAYATGRGAFRVRAR 251

Query: 256 WCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFP 315
           W  EE GRG++ +VVTEIPY V KSRL+EKIAEL+  K++PLL D+RDESAED+R+VL P
Sbjct: 252 WHKEETGRGTYVVVVTEIPYGVPKSRLVEKIAELLTDKKLPLLADVRDESAEDIRLVLEP 311

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           + R++D ++LMES+F L+++E+R  LNMNVL  G+VP+V+ L   L+EWL HRREVL RR
Sbjct: 312 RARTVDAEVLMESLFKLTELESRVSLNMNVLVRGQVPKVLSLADALREWLDHRREVLLRR 371

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
           S  R+  I  R+E+L G LIAYLN+DE+I IIR ED+PK  ++  F LT+ Q ++ILN+R
Sbjct: 372 SRNRLSQIAHRLEVLGGYLIAYLNLDEVIRIIREEDEPKVELMRTFELTDLQAESILNMR 431

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LRSLR+LEE +++ E   L  E+E+++ L+ S   QW  I  EIRE ++ +   T++GRR
Sbjct: 432 LRSLRRLEEMELRKEHAALTKEQEQLNKLVASEAAQWKAIGKEIRETRKTYGPDTEIGRR 491

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           RT F       ++   +A++E+EPIT+V+S +GWIR+LK H  D++ + FK  D+L  A 
Sbjct: 492 RTDFAVPPDVHESAFTEALVEREPITIVMSAKGWIRALKGHVADVTGVPFKGDDTLAHAF 551

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
           +A TT +I++LS++G+ +TL A  L  GRGHGE ++L+I+L    +IV+ F +    KL+
Sbjct: 552 YAETTSKIMVLSSNGRFFTLDAAKLPGGRGHGEPVRLMIELEQEAEIVSVFAHRPGGKLI 611

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSI 675
           V S +G  F+V E + +ANTRKGK  L V + +   L V   GD VAV+G+NRKLL+F I
Sbjct: 612 VASREGRGFVVAEDDCLANTRKGKQVLGVDAPDAAVLAVPADGDTVAVIGDNRKLLLFPI 671

Query: 676 DQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGG 735
            Q+PEM+RG+GVRLQ YK+GG+SD+  F   +GLTW DS+GR++  +E  LL W G+R  
Sbjct: 672 AQVPEMTRGRGVRLQRYKEGGLSDLKVFNRADGLTWEDSSGRTWTVTE--LLDWQGERAS 729

Query: 736 VGSLVPKGFPRSGKF 750
            G L PKGFPR+ KF
Sbjct: 730 SGRLPPKGFPRNNKF 744


>gi|146341364|ref|YP_001206412.1| DNA topoisomerase IV subunit A [Bradyrhizobium sp. ORS278]
 gi|146194170|emb|CAL78191.1| DNA topoisomerase IV, subunit A [Bradyrhizobium sp. ORS278]
          Length = 750

 Score =  861 bits (2224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/734 (54%), Positives = 539/734 (73%), Gaps = 1/734 (0%)

Query: 17  VKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSA 76
           +  V+LR ALEERYLAYALSTI  RA+PD RDG KPVHRRI++ M  + LD G AFKKSA
Sbjct: 13  IHEVALRDALEERYLAYALSTIMHRALPDARDGLKPVHRRILYGMRLLRLDPGTAFKKSA 72

Query: 77  RIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARM 136
           +IVG+V+G  HPHGDQ++YD++VRLAQ F  RYPL+ GQGNFGNIDGD+ AAYRYTEARM
Sbjct: 73  KIVGDVMGSFHPHGDQAIYDAMVRLAQDFSSRYPLVDGQGNFGNIDGDNPAAYRYTEARM 132

Query: 137 TQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNV 196
           T VA L+L+G+DED V+FR  Y+ +  EPVV P  FPNLLANG  GIAVGMATSIP HN 
Sbjct: 133 TDVARLLLEGIDEDGVEFRPNYDGQSKEPVVLPGGFPNLLANGAQGIAVGMATSIPPHNA 192

Query: 197 QEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW 256
            E+C+AAL LI+ P+     LL ++ GPDFPTGG +++S+ESI+E+Y  GRG FRVRA+W
Sbjct: 193 AELCDAALHLIEKPDAKSRALLRWVKGPDFPTGGTVIDSKESIIEAYTTGRGSFRVRAKW 252

Query: 257 CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPK 316
             EE  RG+W +V+TEIP+ VQKSRL+EKIAEL+  K++PL+ D+RDESAEDVR+V+ PK
Sbjct: 253 KQEEGNRGTWVVVITEIPFLVQKSRLVEKIAELLNEKKLPLVGDVRDESAEDVRLVIEPK 312

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           ++++DP L+MES+F L+D+E++ PLN+NVL  G++P+V+ L   L+EWL H R+VL RRS
Sbjct: 313 SKNVDPALMMESLFRLTDLESKIPLNLNVLIKGKIPKVVGLAECLREWLDHLRDVLLRRS 372

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
           ++R + I+ R+EIL G LIAYLNIDE+I IIR ED+PKPV++  F LTE Q +AILN+RL
Sbjct: 373 NYRKKQIENRLEILGGYLIAYLNIDEVIRIIRTEDEPKPVLMKTFKLTEVQAEAILNMRL 432

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           RSLRKLEE +I++E  NL  E + I+ LL S   QW ++  +++ V+++F   T LG+RR
Sbjct: 433 RSLRKLEEMEIRTEDKNLRGELKGINELLGSEPLQWAKVGEQVKTVRDMFGPKTPLGKRR 492

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
           T F +    D A +++A IE+EP+TVV+S +GW+R+LK H  DLS L FK  D L  +  
Sbjct: 493 TNFADAPEHDLAAIEEAFIEREPVTVVVSEKGWVRTLKGHVADLSNLQFKTDDQLGQSFF 552

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
           A  T ++LL +T+GK Y+L  G L  GRGHGE I++ IDL+ +  IV+ FV     K LV
Sbjct: 553 AENTSKVLLFATNGKFYSLDVGKLPGGRGHGEPIRMFIDLDQDASIVSMFVTKGERKFLV 612

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSID 676
            +S G  F+V+E + ++NTRKGK  L V++  + + +  VTGD VAV+G N K+++F +D
Sbjct: 613 AASDGQGFVVKEEDCVSNTRKGKQVLNVTAPAEARAICTVTGDQVAVIGTNHKMVVFGLD 672

Query: 677 QIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGV 736
           Q+PEM+RG+GVRLQ Y    +SDV  F+  +GL W DSAGR    S  +L  + G R   
Sbjct: 673 QVPEMARGRGVRLQKYTSAQLSDVTTFEQKQGLAWKDSAGRDQGLSWKELADYRGNRADA 732

Query: 737 GSLVPKGFPRSGKF 750
           G +  +G P+S KF
Sbjct: 733 GRIA-QGLPKSNKF 745


>gi|296447775|ref|ZP_06889689.1| DNA topoisomerase IV, A subunit [Methylosinus trichosporium OB3b]
 gi|296254694|gb|EFH01807.1| DNA topoisomerase IV, A subunit [Methylosinus trichosporium OB3b]
          Length = 750

 Score =  859 bits (2220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/736 (54%), Positives = 537/736 (72%), Gaps = 1/736 (0%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           E +  V LR ALEERYL YALSTI  RA+PD RDG KPVHRRI++ M  + L   A FKK
Sbjct: 15  EALIPVELREALEERYLTYALSTITGRALPDARDGLKPVHRRILYGMQTLRLAPDAPFKK 74

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEA 134
            A+IVG+V+G  HPHGDQ++YD+LVRLAQ F  RYPL+ GQGNFGN+DGD+AAAYRYTEA
Sbjct: 75  CAKIVGDVMGSFHPHGDQAIYDALVRLAQDFSSRYPLVDGQGNFGNVDGDAAAAYRYTEA 134

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           RMT VA L+L+G+DEDA+DFR  Y+ E+ EPVV P+  PNLLANG  GIAVGMATS+P H
Sbjct: 135 RMTAVARLLLEGIDEDAIDFRPNYSGEEQEPVVLPAALPNLLANGAQGIAVGMATSVPPH 194

Query: 195 NVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
           N+ E+C+AAL LI + E + E+L+ ++ GPDFPTGG++V+ R  IVE+YR GRG FR+RA
Sbjct: 195 NLAELCDAALYLISHREATAEQLMNFVQGPDFPTGGVVVDPRPQIVETYRTGRGSFRLRA 254

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLF 314
           RW  EE  RG W  VVTEIPY VQKSRLIEK+AELI+ K+ PL  D+RDESAEDVR+V+ 
Sbjct: 255 RWHKEETARGQWVAVVTEIPYGVQKSRLIEKLAELIVDKKAPLAGDVRDESAEDVRVVIE 314

Query: 315 PKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFR 374
           P+ R++DP L+ME++F LS++E RFP+NMNVL  G VP+V+ LD  L++WL HRREVL R
Sbjct: 315 PRARAVDPALMMETLFKLSELEIRFPVNMNVLVDGAVPRVVSLDEALRQWLDHRREVLER 374

Query: 375 RSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNL 434
           RS  R+ AI RR+E+L G++I +LN+DE+I IIR ED+PK  + S F LT+ QVD IL+ 
Sbjct: 375 RSRHRLAAIIRRLEVLDGMIIVFLNLDEVIRIIREEDEPKQALKSAFDLTDVQVDYILDT 434

Query: 435 RLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGR 494
           RLR+LR+LEE +++ E + L+ E+ +I+ LL    +QW  I  +IRE+K+       L +
Sbjct: 435 RLRALRRLEEMELRKEREKLIEERAEIEGLLAEEAKQWKAITAQIRELKKTVGDPR-LAK 493

Query: 495 RRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIA 554
           RRTTF +   A    L +A+IE+EPITVV+S +GWIR+LK H  DLS L FK  D+L  +
Sbjct: 494 RRTTFEDAPEATDIDLAEALIEREPITVVVSQKGWIRALKGHVSDLSQLQFKGDDALDFS 553

Query: 555 LHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKL 614
             A TT ++L L+++GKA+TL A  L  GRGHGE I+L+ +++ +  IV  F++     L
Sbjct: 554 FFAQTTSKVLALASNGKAFTLDASKLPGGRGHGEPIRLMAEIDEDAAIVKVFLHTPDALL 613

Query: 615 LVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
           L+VS  G  F+V +++++A TRKG+    V    K+K+V    GDHVA++GENRKLL+F 
Sbjct: 614 LLVSDDGRGFVVSQNDLVATTRKGRAVFNVDPPAKLKIVAPAEGDHVAIIGENRKLLVFP 673

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
           + + P+M+RGKGVRLQ YKDGG++D   F + +GLTW D++ R +   + +L  W+  R 
Sbjct: 674 LSEAPQMARGKGVRLQRYKDGGVADAKVFALADGLTWTDTSARVHTVDKRELAEWVAHRA 733

Query: 735 GVGSLVPKGFPRSGKF 750
             G L P+GFP++ +F
Sbjct: 734 EAGRLPPRGFPKNNRF 749


>gi|220923263|ref|YP_002498565.1| DNA topoisomerase IV subunit A [Methylobacterium nodulans ORS 2060]
 gi|219947870|gb|ACL58262.1| DNA topoisomerase IV, A subunit [Methylobacterium nodulans ORS
           2060]
          Length = 748

 Score =  858 bits (2218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/735 (56%), Positives = 538/735 (73%), Gaps = 1/735 (0%)

Query: 16  NVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKS 75
            +++V L+ ALEERYLAYALSTI  RA+PD RDG KPVHRRI++ M  + LD   AFKK 
Sbjct: 13  GIESVELKAALEERYLAYALSTIMHRALPDARDGLKPVHRRILYGMRLLRLDPNTAFKKC 72

Query: 76  ARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEAR 135
           A+IVG+V+G  HPHGDQ++YD+LVRL+Q F QRYPL+ GQGNFGNIDGD  AAYRYTEAR
Sbjct: 73  AKIVGDVMGDFHPHGDQAIYDALVRLSQDFAQRYPLVDGQGNFGNIDGDGPAAYRYTEAR 132

Query: 136 MTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHN 195
           +T+VA L+L G+DEDAVDFR +YN E  EPVV P  FPNLLANG+ GIAVGMATSIP HN
Sbjct: 133 LTEVARLLLDGIDEDAVDFRPSYNGEKDEPVVLPGAFPNLLANGSQGIAVGMATSIPPHN 192

Query: 196 VQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRAR 255
             E+C+AAL LI +P  + E+L  ++ GPDFPTGGI+V+S E+I E+YR GRG FRVRAR
Sbjct: 193 AAELCDAALYLITHPTATSEQLTSFVKGPDFPTGGIVVDSAEAIAEAYRTGRGAFRVRAR 252

Query: 256 WCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFP 315
           W  E++GRG+W +VVTEIPY V K+RLIEK+AEL+  +++PLL D+RDESAEDVRIVL P
Sbjct: 253 WTREDLGRGAWNVVVTEIPYGVPKARLIEKMAELLTERKLPLLADVRDESAEDVRIVLEP 312

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           ++R++DP +LMES+F L+++E+RF LNMNVL  G+VP+V+ L   L+EWL HRR VL RR
Sbjct: 313 RSRTVDPVVLMESLFRLTELESRFSLNMNVLVSGQVPRVVGLAEALREWLDHRRTVLQRR 372

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
           S  R+  I++R+EIL GLLI YL++D++I IIR ED+PK  ++  F LTE Q +AIL+ R
Sbjct: 373 SRHRLAQIEKRLEILGGLLIVYLDLDQVIRIIREEDEPKAELMRYFQLTEVQANAILDTR 432

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LRSLRKLEE ++K E   L AEK  +D+LL S   QW  IA ++R VK+ F   T LGRR
Sbjct: 433 LRSLRKLEEMELKREQAALTAEKADLDALLGSEALQWKSIAAQVRAVKKTFGPETPLGRR 492

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           RTT           L +AMIE+EPITV++S +GWIRSLK H  DLS + FK  D+LK++ 
Sbjct: 493 RTTLENPPDTSDLDLAEAMIEREPITVIVSQKGWIRSLKGHVADLSGVQFKGDDALKLSF 552

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
              TT ++L+L+++GK +TL A  L  GRG G+ I+L+ DL+   DIVT + Y +  KLL
Sbjct: 553 PTETTAKLLVLASNGKVFTLDAAKLPGGRGFGDPIRLMADLDEGTDIVTVWPYRAGAKLL 612

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKV-TGDHVAVVGENRKLLIFS 674
             +  G  F      ++ANTRKGK  + +     +   V+V  GDHVA  GENR L++F 
Sbjct: 613 FGTIDGRGFTTGSDGLVANTRKGKQVVALDGAAVVTHCVEVGEGDHVAACGENRLLVVFP 672

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
           + +IPEM+RGKGVRLQ Y++  ++ +  FK+ EGLTW DSAGR+ +    +L  W+G RG
Sbjct: 673 LTEIPEMARGKGVRLQRYRESTLAYLTVFKLAEGLTWPDSAGRTRSVVGEELAKWVGHRG 732

Query: 735 GVGSLVPKGFPRSGK 749
            VG + P+GFPRS +
Sbjct: 733 TVGIMAPRGFPRSNR 747


>gi|170742439|ref|YP_001771094.1| DNA topoisomerase IV subunit A [Methylobacterium sp. 4-46]
 gi|168196713|gb|ACA18660.1| DNA topoisomerase IV, A subunit [Methylobacterium sp. 4-46]
          Length = 748

 Score =  855 bits (2208), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/736 (55%), Positives = 539/736 (73%), Gaps = 1/736 (0%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + ++ V L+ ALEERYLAYALSTI  RA+PD RDG KPVHRRI++AM  + LD G A KK
Sbjct: 12  DGIENVELKTALEERYLAYALSTIMHRALPDARDGLKPVHRRILYAMRMLRLDPGTAHKK 71

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEA 134
            AR+VG+VIGK HPHGD +VYD+LVRLAQ F QRYPL+ GQGNFGNIDGD+ AA RYTE 
Sbjct: 72  CARVVGDVIGKYHPHGDTAVYDALVRLAQDFAQRYPLVDGQGNFGNIDGDNPAAQRYTEC 131

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           RMT+VA L+L G++EDAVDFR  Y+ ++ EPVV P+ FPNLLANG  GIAVGMATSIP H
Sbjct: 132 RMTEVARLLLDGMEEDAVDFRPNYDGQEEEPVVLPAAFPNLLANGAQGIAVGMATSIPPH 191

Query: 195 NVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
           N  E+C+AAL LI +P  +  +L  ++ GPDFPTGG++++S E+I E+YR GRG FRVRA
Sbjct: 192 NAAELCDAALYLITHPTATSAQLTSFVKGPDFPTGGVVIDSAEAIAEAYRTGRGAFRVRA 251

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLF 314
           RW  E++GRG W +VVTEIPY V K+RLIEK+AEL+  K++PLL D+RDESAEDVRIVL 
Sbjct: 252 RWTREDLGRGLWQVVVTEIPYGVPKARLIEKMAELLTEKKLPLLADVRDESAEDVRIVLE 311

Query: 315 PKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFR 374
           P++R++DP +LMES+F L+++E+RF LNMNVL  G+VP+V+ L  +L+EWL HRR VL R
Sbjct: 312 PRSRTVDPVVLMESLFRLTELESRFSLNMNVLMSGQVPRVVGLAEVLREWLDHRRTVLQR 371

Query: 375 RSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNL 434
           RS  R+  I+RR+EIL GLLI YL++D++I IIR ED+PK  ++  F LTE Q +AIL+ 
Sbjct: 372 RSRHRLGQIERRLEILGGLLIVYLDLDQVIRIIREEDEPKAELMRHFQLTEVQANAILDT 431

Query: 435 RLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGR 494
           RLRSLRKLEE ++K E   L AEK  +D+LL+S   QW  IA ++R VK+ F   T LGR
Sbjct: 432 RLRSLRKLEEMELKREQAALTAEKADLDALLDSEPLQWKSIAGQVRAVKKTFGPETALGR 491

Query: 495 RRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIA 554
           RRTT           L +AMIE+EPITV++S +GWIR+LK H  DLS + FK  D+LK++
Sbjct: 492 RRTTLENPPDTSDLDLAEAMIEREPITVIVSQKGWIRALKGHVADLSTVQFKGDDALKLS 551

Query: 555 LHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKL 614
               TT ++L+L+T+GK +TL A  L  GRG G+ I+L+ DL+   DIVT F + +  KL
Sbjct: 552 FPTETTAKLLVLATNGKVFTLDAAKLPGGRGFGDPIRLMADLDEGSDIVTVFPFRAGAKL 611

Query: 615 LVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKV-TGDHVAVVGENRKLLIF 673
           L  +S G  F      ++ANTRKGK  + +     +   V+   GDHVAV GENR L++F
Sbjct: 612 LFGTSDGRGFTTLADGLVANTRKGKQVVALDGAATVTHCVEAGAGDHVAVCGENRLLVVF 671

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
            + +IP+M+RGKGVRLQ Y++  ++ +  F++ EGL+W DSAGR+      +L  W+G R
Sbjct: 672 PLTEIPDMARGKGVRLQRYRESTLAYLSVFRLAEGLSWPDSAGRTRTVVGEELAKWVGHR 731

Query: 734 GGVGSLVPKGFPRSGK 749
           G VG++ P+GFPRS +
Sbjct: 732 GTVGAMAPRGFPRSNR 747


>gi|170748445|ref|YP_001754705.1| DNA topoisomerase IV subunit A [Methylobacterium radiotolerans JCM
           2831]
 gi|170654967|gb|ACB24022.1| DNA topoisomerase IV, A subunit [Methylobacterium radiotolerans JCM
           2831]
          Length = 748

 Score =  843 bits (2177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/736 (54%), Positives = 528/736 (71%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + +++V L+ ALEERYLAYALSTI  RA+PD RDG KPVHRRI++ M  + LD   A KK
Sbjct: 11  DGIESVELKSALEERYLAYALSTIMHRALPDARDGLKPVHRRILYGMRLLRLDPTTAHKK 70

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEA 134
            A+IVG+V+G  HPHGDQ++YD+LVRL+Q F QRYPL+ GQGNFGNIDGD  AAYRYTEA
Sbjct: 71  CAKIVGDVMGDFHPHGDQAIYDALVRLSQDFAQRYPLVDGQGNFGNIDGDGPAAYRYTEA 130

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           R+T+VA L+L G+DED VDFR +YN E  EPVV P+ FPNLLANG+ GIAVGMATSIP H
Sbjct: 131 RLTEVARLLLDGIDEDTVDFRPSYNGEKEEPVVLPAAFPNLLANGSQGIAVGMATSIPPH 190

Query: 195 NVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
           N  E+C+AAL LI++PE +  +L +++ GPDFPTGGI+++S ES+ E+YR GRG FRVRA
Sbjct: 191 NAAELCDAALYLINHPEATSGQLAKFVQGPDFPTGGILIDSAESVAEAYRTGRGAFRVRA 250

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLF 314
           RW  E++GRG+W IVVTEIPY + K RLIEK+AEL+  K++PLL D+RDESAEDVRIVL 
Sbjct: 251 RWAKEDLGRGTWNIVVTEIPYGIPKGRLIEKMAELLQEKKLPLLADVRDESAEDVRIVLE 310

Query: 315 PKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFR 374
           P++R++DP +LMES+F L+++E R PLN+NVL  G VP+V+ L   L+EW+ HRR VL R
Sbjct: 311 PRSRTVDPVILMESLFRLTELEARIPLNLNVLVGGLVPKVIGLAECLREWVDHRRVVLQR 370

Query: 375 RSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNL 434
           RS +R+  IDRR+EIL GLLI YL++DE+I IIR ED+PK  +++RF LTE Q +AIL+ 
Sbjct: 371 RSRYRLGQIDRRLEILGGLLIVYLDLDEVIRIIREEDEPKAALMARFELTEIQANAILDT 430

Query: 435 RLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGR 494
           RLRSLRKLEE ++K E D L AEK +ID+LL S   QW  I  +IR VK+ F   T LGR
Sbjct: 431 RLRSLRKLEEMELKREFDALTAEKAEIDALLASEPAQWKAIQAQIRAVKKTFGPETKLGR 490

Query: 495 RRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIA 554
           RRTT              A++E+EPITV++S +GWIR+LK H  DLS + FK  D+LKIA
Sbjct: 491 RRTTLASPPDVGGIDFTAALVEREPITVIVSTKGWIRALKGHVADLSGVAFKGDDTLKIA 550

Query: 555 LHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKL 614
               TT +ILLL+T+GK +TL A  L  GRG G+ ++L+ DL+   +IV A  Y    KL
Sbjct: 551 FPTETTQKILLLATNGKVFTLEASKLPGGRGFGDPVRLMADLDDGTEIVAALPYRPETKL 610

Query: 615 LVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
           L+  S G  F+     ++ANTRKGK  L +  +    ++V   GDHVAVV   + LLIF 
Sbjct: 611 LIAGSDGRGFVAPADALVANTRKGKNVLGLDGDATAAVLVPADGDHVAVVNTEKLLLIFP 670

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
           + ++ E++RGKGVRLQ  + G + D   FK+ +GL W D +      + + L  WLG R 
Sbjct: 671 VSEVAELARGKGVRLQRCRSGSLLDAHVFKLADGLPWQDGSAEGRLANVSVLEKWLGHRA 730

Query: 735 GVGSLVPKGFPRSGKF 750
            VG ++ + FP+  +F
Sbjct: 731 EVGLMMARSFPKFERF 746


>gi|240137549|ref|YP_002962020.1| DNA topoisomerase IV subunitA [Methylobacterium extorquens AM1]
 gi|240007517|gb|ACS38743.1| DNA topoisomerase IV subunitA [Methylobacterium extorquens AM1]
          Length = 748

 Score =  842 bits (2175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/736 (54%), Positives = 534/736 (72%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + +++V L+ ALEERY AYALSTI +RA+PD RDG KPVHRRI++ M  + LD  +AFKK
Sbjct: 11  DGIESVELKTALEERYYAYALSTIMQRALPDARDGLKPVHRRILYGMRLLRLDPTSAFKK 70

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEA 134
            A+IVG+V+G  HPHGDQ++YD+LVRL+Q F QRYPL+ GQGNFGNIDGD  AAYRYTEA
Sbjct: 71  CAKIVGDVMGDFHPHGDQAIYDALVRLSQDFAQRYPLVDGQGNFGNIDGDGPAAYRYTEA 130

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           R+T+VA L+L G+DED VDFR +YN E  EP+V P+ FPNLLANG+ GIAVGMATSIP H
Sbjct: 131 RLTEVARLLLDGIDEDTVDFRASYNGEKEEPIVLPAAFPNLLANGSQGIAVGMATSIPPH 190

Query: 195 NVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
           N  E+C+AAL LI N E + E+L  ++ GPDFPTGGI+++S ESI E+YR GRGGFRVRA
Sbjct: 191 NAAELCDAALYLIQNREATSEQLCTFVQGPDFPTGGILIDSAESIREAYRTGRGGFRVRA 250

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLF 314
           RW  E++GRG+W IVVTEIPY V K+RLIEK+A+L+  K++PLL D+RDESAEDVR+VL 
Sbjct: 251 RWAKEDLGRGTWNIVVTEIPYGVPKARLIEKLADLLQEKKLPLLADVRDESAEDVRVVLE 310

Query: 315 PKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFR 374
           P++RS+DP +LMES+F LS++E+R PLN+NVL  G VP+V+ L   L+EW+ HRR VL R
Sbjct: 311 PRSRSVDPVMLMESLFRLSELESRIPLNLNVLVGGVVPRVIGLAECLREWVDHRRVVLQR 370

Query: 375 RSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNL 434
           RSS+R+  I+RR+EIL GLLI YL++DE+I IIR ED+PK  +++RF LTE Q +AIL+ 
Sbjct: 371 RSSYRLGQIERRLEILGGLLIVYLDLDEVIRIIREEDEPKAALMARFELTEVQANAILDT 430

Query: 435 RLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGR 494
           RLRSLRKLEE ++K E + L AEKE I+ LL S K QW +I  +IR VK+ F   T LGR
Sbjct: 431 RLRSLRKLEEMELKREFEALTAEKEGIEGLLASEKLQWTEITKQIRAVKKTFGPETKLGR 490

Query: 495 RRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIA 554
           RRTT              AM+E+EPITV++S +GWIR+LK H  DLS + FK  D+LK+A
Sbjct: 491 RRTTLENPPDTAGIDFTAAMVEREPITVILSEKGWIRALKGHVADLSGVTFKGDDTLKVA 550

Query: 555 LHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKL 614
             + TT +ILLL+++GK +T+ A  L  GRG G+ ++L++DL+   +IV A  Y    KL
Sbjct: 551 FLSETTAKILLLASNGKVFTIEASKLPGGRGFGDPVRLMVDLDDGTEIVAALPYKPESKL 610

Query: 615 LVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
           LV  S G  FI     ++ANTRKGK  L +    +  L+V   GDHVAV   ++ +L+F 
Sbjct: 611 LVGGSDGRGFIAPSDALVANTRKGKAILGLDEGTRAVLLVPAEGDHVAVCSSDKLMLVFP 670

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
             ++ E+ RGKGVRLQ  +   ++D   F + EGL W D +G++   +   L  W+G R 
Sbjct: 671 ASEVTELGRGKGVRLQRCRQSQLADACVFTLAEGLPWRDGSGQARLANAGMLEKWMGHRS 730

Query: 735 GVGSLVPKGFPRSGKF 750
             G+L+ + FP+  +F
Sbjct: 731 DAGTLMTRSFPKFERF 746


>gi|218529182|ref|YP_002419998.1| DNA topoisomerase IV subunit A [Methylobacterium chloromethanicum
           CM4]
 gi|218521485|gb|ACK82070.1| DNA topoisomerase IV, A subunit [Methylobacterium chloromethanicum
           CM4]
          Length = 748

 Score =  841 bits (2172), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/736 (54%), Positives = 534/736 (72%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + +++V L+ ALEERY AYALSTI +RA+PD RDG KPVHRRI++ M  + LD  +AFKK
Sbjct: 11  DGIESVELKTALEERYYAYALSTIMQRALPDARDGLKPVHRRILYGMRLLRLDPTSAFKK 70

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEA 134
            A+IVG+V+G  HPHGDQ++YD+LVRL+Q F QRYPL+ GQGNFGNIDGD  AAYRYTEA
Sbjct: 71  CAKIVGDVMGDFHPHGDQAIYDALVRLSQDFAQRYPLVDGQGNFGNIDGDGPAAYRYTEA 130

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           R+T+VA L+L G+DED VDFR +YN E  EP+V P+ FPNLLANG+ GIAVGMATSIP H
Sbjct: 131 RLTEVARLLLDGIDEDTVDFRASYNGEKEEPIVLPAAFPNLLANGSQGIAVGMATSIPPH 190

Query: 195 NVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
           N  E+C+AAL LI N E + E+L  ++ GPDFPTGGI+++S ESI E+YR GRGGFRVRA
Sbjct: 191 NAAELCDAALYLIQNREATSEQLCTFVQGPDFPTGGILIDSAESIREAYRTGRGGFRVRA 250

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLF 314
           RW  E++GRG+W IVVTEIPY V K+RLIEK+A+L+  K++PLL D+RDESAEDVR+VL 
Sbjct: 251 RWAKEDLGRGTWNIVVTEIPYGVPKARLIEKLADLLQEKKLPLLADVRDESAEDVRVVLE 310

Query: 315 PKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFR 374
           P++RS+DP +LMES+F LS++E+R PLN+NVL  G VP+V+ L   L+EW+ HRR VL R
Sbjct: 311 PRSRSVDPVMLMESLFRLSELESRIPLNLNVLVGGVVPRVIGLAECLREWVDHRRVVLQR 370

Query: 375 RSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNL 434
           RSS+R+  I+RR+EIL GLLI YL++DE+I IIR ED+PK  +++RF LTE Q +AIL+ 
Sbjct: 371 RSSYRLGQIERRLEILGGLLIVYLDLDEVIRIIREEDEPKAALMARFELTEVQANAILDT 430

Query: 435 RLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGR 494
           RLRSLRKLEE ++K E + L AEKE I+ LL S K QW +I  +IR VK+ F   T LGR
Sbjct: 431 RLRSLRKLEEMELKREFEALTAEKEGIEGLLASEKLQWTEITKQIRAVKKTFGPETKLGR 490

Query: 495 RRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIA 554
           RRTT              AM+E+EPITV++S +GWIR+LK H  +L+ + FK  D+LK+A
Sbjct: 491 RRTTLENPPDTAGIDFTAAMVEREPITVILSEKGWIRALKGHVTELAGVAFKGDDTLKVA 550

Query: 555 LHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKL 614
             + TT +ILLL+++GK +TL A  L  GRG G+ ++L++DL+   +IV A  Y    KL
Sbjct: 551 FLSETTAKILLLASNGKVFTLEASKLPGGRGFGDPVRLMVDLDDGTEIVAALPYKPESKL 610

Query: 615 LVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
           LV  S G  FI     ++ANTRKGK  L +    +  L+V   GDHVAV   ++ +L+F 
Sbjct: 611 LVGGSDGRGFIAPSDALVANTRKGKAILGLDEGTRAVLLVPAEGDHVAVCSSDKLMLVFP 670

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
             ++ E+ RGKGVRLQ  +   ++D   F + EGL W D +G++   +   L  W+G R 
Sbjct: 671 ASEVTELGRGKGVRLQRCRQSQLADACVFTLAEGLPWRDGSGQARLANAGMLEKWMGHRS 730

Query: 735 GVGSLVPKGFPRSGKF 750
             G+L+ + FP+  +F
Sbjct: 731 DAGTLMTRSFPKFERF 746


>gi|163850485|ref|YP_001638528.1| DNA topoisomerase IV subunit A [Methylobacterium extorquens PA1]
 gi|163662090|gb|ABY29457.1| DNA topoisomerase IV, A subunit [Methylobacterium extorquens PA1]
          Length = 748

 Score =  840 bits (2169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/736 (54%), Positives = 534/736 (72%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + +++V L+ ALEERY AYALSTI +RA+PD RDG KPVHRRI++ M  + LD  +AFKK
Sbjct: 11  DGIESVELKTALEERYYAYALSTIMQRALPDARDGLKPVHRRILYGMRLLRLDPTSAFKK 70

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEA 134
            A+IVG+V+G  HPHGDQ++YD+LVRL+Q F QRYPL+ GQGNFGNIDGD  AAYRYTEA
Sbjct: 71  CAKIVGDVMGDFHPHGDQAIYDALVRLSQDFAQRYPLVDGQGNFGNIDGDGPAAYRYTEA 130

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           R+T+VA L+L G+DED VDFR +YN E  EP+V P+ FPNLLANG+ GIAVGMATSIP H
Sbjct: 131 RLTEVARLLLDGIDEDTVDFRASYNGEKEEPIVLPAAFPNLLANGSQGIAVGMATSIPPH 190

Query: 195 NVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
           N  E+C+AAL LI N E + E+L  ++ GPDFPTGGI+++S ESI E+YR GRGGFRVRA
Sbjct: 191 NAAELCDAALYLIQNREATSEQLCTFVQGPDFPTGGILIDSAESIREAYRTGRGGFRVRA 250

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLF 314
           RW  E++GRG+W IVVTEIPY V K+RLIEK+A+L+  K++PLL D+RDESAEDVR+VL 
Sbjct: 251 RWAKEDLGRGTWNIVVTEIPYGVPKARLIEKLADLLQEKKLPLLADVRDESAEDVRVVLE 310

Query: 315 PKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFR 374
           P++RS+DP +LMES+F LS++E+R PLN+NVL  G VP+V+ L   L+EW+ HRR VL R
Sbjct: 311 PRSRSVDPVMLMESLFRLSELESRIPLNLNVLVGGVVPRVIGLTECLREWVDHRRVVLQR 370

Query: 375 RSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNL 434
           RSS+R+  I+RR+EIL GLLI YL++DE+I IIR ED+PK  +++RF LTE Q +AIL+ 
Sbjct: 371 RSSYRLGQIERRLEILGGLLIVYLDLDEVIRIIREEDEPKAALMARFELTEVQANAILDT 430

Query: 435 RLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGR 494
           RLRSLRKLEE ++K E + L AEKE I+ LL S K QW +I  +IR VK+ F   T LGR
Sbjct: 431 RLRSLRKLEEMELKREFEALTAEKEGIEGLLASEKLQWTEITKQIRAVKKTFGPETKLGR 490

Query: 495 RRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIA 554
           RRTT              AM+E+EPITV++S +GWIR+LK H  +L+ + FK  D+LK+A
Sbjct: 491 RRTTLENPPDTAGIDFTAAMVEREPITVILSEKGWIRALKGHVTELAGVAFKGDDTLKVA 550

Query: 555 LHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKL 614
             + TT +ILLL+++GK +T+ A  L  GRG G+ ++L++DL+   +IV A  Y    KL
Sbjct: 551 FLSETTAKILLLASNGKVFTIEASKLPGGRGFGDPVRLMVDLDDGTEIVAALPYKPESKL 610

Query: 615 LVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
           LV  S G  FI     ++ANTRKGK  L +    +  L+V   GDHVAV   ++ +L+F 
Sbjct: 611 LVGGSDGRGFIAPSDALVANTRKGKAILGLDEGTRAVLLVPAEGDHVAVCSSDKLMLVFP 670

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
             ++ E+ RGKGVRLQ  +   ++D   F + EGL W D +G++   +   L  W+G R 
Sbjct: 671 ASEVTELGRGKGVRLQRCRQSQLADACVFTLAEGLPWRDGSGQARLANAGMLEKWMGHRS 730

Query: 735 GVGSLVPKGFPRSGKF 750
             G+L+ + FP+  +F
Sbjct: 731 DAGTLMTRSFPKFERF 746


>gi|6655026|gb|AAF22873.1| topoisomerase II [Bradyrhizobium japonicum]
          Length = 755

 Score =  839 bits (2167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/740 (54%), Positives = 533/740 (72%), Gaps = 8/740 (1%)

Query: 17  VKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSA 76
           +  V LR ALEERYLAYALSTI  RA+PD RDG KPVHRRI++ M  + LD G AFKKSA
Sbjct: 13  IHEVPLREALEERYLAYALSTIMHRALPDARDGLKPVHRRILYGMRLLRLDPGTAFKKSA 72

Query: 77  RIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLI--SGQGNFGNIDGDSAAAYR-YTE 133
           +IVG+V+G  HPHGDQ++YD++VRLAQ F  RYPL+   GQGNFGNIDGD+ AAY  +  
Sbjct: 73  KIVGDVMGSFHPHGDQAIYDAMVRLAQDFSSRYPLVEVDGQGNFGNIDGDNPAAYPLHRS 132

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           A +T VA L+L+G+DED V+FR  Y+ +  EP+V P  FPNLLANG  GIAVGMATSIP 
Sbjct: 133 AHVTDVARLLLEGIDEDGVEFRPNYDGQSKEPIVLPGGFPNLLANGAQGIAVGMATSIPP 192

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN  E+C+AAL LI+ P+   + LL+++ GPDFPTGGI V+S+++I E+Y  GRG FRVR
Sbjct: 193 HNAAELCDAALHLIEKPDAKSKALLKWVKGPDFPTGGICVDSKQAIAEAYTTGRGSFRVR 252

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           ARW  EE  RG+W +VVTEIP+ VQKSRLIEKIAEL   K++PL+ D+RDESAEDVRIV+
Sbjct: 253 ARWEQEEGARGTWVVVVTEIPFLVQKSRLIEKIAELQDQKKLPLVGDVRDESAEDVRIVI 312

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            PK++++DP L+MES+F L+++E + PLN+NVL  GR+P+V+ L   L+EWL H R+VL 
Sbjct: 313 EPKSKNVDPALMMESLFRLTELENKIPLNLNVLIKGRIPKVVGLAECLREWLDHLRDVLI 372

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS++R   I+ R+E+L G LIAYLNID++I IIR ED+PKP ++  F LTE Q +AILN
Sbjct: 373 RRSNYRKAQIEHRLEVLGGFLIAYLNIDKVIKIIRTEDEPKPALMKAFKLTEVQAEAILN 432

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
           +RLRSLRKLEE +I++E  NL  E + I+++L S  +QW ++  ++ +V+++F   T LG
Sbjct: 433 MRLRSLRKLEEMEIRTEDKNLRNELKGINAVLASEAEQWKKVGEQVGKVRDMFGPKTPLG 492

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
           +RRTTF +    D A +++A +E+EP+TVV+S++GWIR++K H  DLS L FK+ D L  
Sbjct: 493 KRRTTFADAPEHDLAAIEEAFVEREPVTVVVSDKGWIRTMKGHVEDLSGLAFKQDDRLGF 552

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
           A  A TT ++LL +T+GK Y+L    L  GRGHGE I+L IDL      V  FV     K
Sbjct: 553 AFFAETTSKLLLFATNGKFYSLDVAKLPGGRGHGEPIRLFIDLEQEAAPVALFVNKGGRK 612

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENR---KL 670
            LV S +G  F+V E + +  T+KGK  L V    + + V +V GD VA  G  R   K+
Sbjct: 613 FLVASHEGQGFVVNEDDCVGTTKKGKQVLNVDMPNEARTVTEVVGDTVA--GHRRETAKM 670

Query: 671 LIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWL 730
           L+F +DQIPEM+RG+GVRLQ YKDGG+SDV+ F    GLTW DSAGR ++ +  +L  W 
Sbjct: 671 LVFPLDQIPEMARGRGVRLQKYKDGGLSDVVVFDAKAGLTWKDSAGREFSATMKELAEWQ 730

Query: 731 GKRGGVGSLVPKGFPRSGKF 750
           G R   G L PKGFP+S KF
Sbjct: 731 GTRADAGRLPPKGFPKSNKF 750


>gi|254560021|ref|YP_003067116.1| DNA topoisomerase IV subunitA [Methylobacterium extorquens DM4]
 gi|254267299|emb|CAX23131.1| DNA topoisomerase IV subunitA [Methylobacterium extorquens DM4]
          Length = 748

 Score =  838 bits (2165), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/736 (54%), Positives = 534/736 (72%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + +++V L+ ALEERY AYALSTI +RA+PD RDG KPVHRRI++ M  + LD  +AFKK
Sbjct: 11  DGIESVELKTALEERYYAYALSTIMQRALPDARDGLKPVHRRILYGMRLLRLDPTSAFKK 70

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEA 134
            A+IVG+V+G  HPHGDQ++YD+LVRL+Q F QRYPL+ GQGNFGNIDGD  AAYRYTEA
Sbjct: 71  CAKIVGDVMGDFHPHGDQAIYDALVRLSQDFAQRYPLVDGQGNFGNIDGDGPAAYRYTEA 130

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           R+T+VA L+L G+DED VDFR +YN E  EP+V P+ FPNLLANG+ GIAVGMATSIP H
Sbjct: 131 RLTEVARLLLDGIDEDTVDFRASYNGEKEEPIVLPAAFPNLLANGSQGIAVGMATSIPPH 190

Query: 195 NVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
           N  E+C+AAL LI N E + E+L  ++ GPDFPTGGI+++S ESI E+YR GRGGFRVRA
Sbjct: 191 NAAELCDAALYLIQNREATSEQLCTFVQGPDFPTGGILIDSAESIREAYRTGRGGFRVRA 250

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLF 314
           RW  E++GRG+W IVVTEIPY V K+RLIEK+A+L+  K++PLL D+RDESAEDVR+VL 
Sbjct: 251 RWAKEDLGRGTWNIVVTEIPYGVPKARLIEKLADLLQEKKLPLLADVRDESAEDVRVVLE 310

Query: 315 PKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFR 374
           P++RS+DP +LMES+F LS++E+R PLN+NVL  G VP+V+ L   L+EW+ HRR VL R
Sbjct: 311 PRSRSVDPVMLMESLFRLSELESRIPLNLNVLVGGVVPRVIGLAECLREWVDHRRVVLQR 370

Query: 375 RSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNL 434
           RSS+R+  I+RR+EIL GLLI YL++DE+I IIR ED+PK  +++RF LTE Q +AIL+ 
Sbjct: 371 RSSYRLGQIERRLEILGGLLIVYLDLDEVIRIIREEDEPKAALMARFELTEVQANAILDT 430

Query: 435 RLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGR 494
           RLRSLRKLEE ++K E + L AEKE I+ LL S K QW +I  +IR VK+ F   T LG+
Sbjct: 431 RLRSLRKLEEMELKREFEALTAEKEGIEGLLASEKLQWTEITKQIRAVKKTFGPETKLGK 490

Query: 495 RRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIA 554
           RRTT              AM+E+EPITV++S +GWIR+LK H  +L+ + FK  D+LK+A
Sbjct: 491 RRTTLENPPDTAGIDFTAAMVEREPITVILSEKGWIRALKGHVTELAGVAFKGDDTLKVA 550

Query: 555 LHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKL 614
             + TT +ILLL+++GK +T+ A  L  GRG G+ ++L++DL+   +IV A  Y    KL
Sbjct: 551 FLSETTAKILLLASNGKVFTIEASKLPGGRGFGDPVRLMVDLDDGTEIVAALPYKPESKL 610

Query: 615 LVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
           LV  S G  FI     ++ANTRKGK  L +    +  L+V   GDHVAV   ++ +L+F 
Sbjct: 611 LVGGSDGRGFIAPSDALVANTRKGKAILGLDEGTRAVLLVPAEGDHVAVCSSDKLMLVFP 670

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
             ++ E+ RGKGVRLQ  +   ++D   F + EGL W D +G++   +   L  W+G R 
Sbjct: 671 ASEVTELGRGKGVRLQRCRQSQLADACVFTLAEGLPWRDGSGQARLANAGMLEKWMGHRS 730

Query: 735 GVGSLVPKGFPRSGKF 750
             G+L+ + FP+  +F
Sbjct: 731 DAGTLMTRSFPKFERF 746


>gi|296535957|ref|ZP_06898105.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Roseomonas cervicalis
           ATCC 49957]
 gi|296263705|gb|EFH10182.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Roseomonas cervicalis
           ATCC 49957]
          Length = 745

 Score =  832 bits (2148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/734 (54%), Positives = 534/734 (72%), Gaps = 4/734 (0%)

Query: 17  VKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSA 76
           V+   L  AL ERYLAYA+STI  R++PD+RDG KPVHRR++ AM ++ LD  A FKK A
Sbjct: 14  VRPTHLADALSERYLAYAMSTITARSLPDVRDGLKPVHRRLLWAMHQLRLDPAAGFKKCA 73

Query: 77  RIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARM 136
           RIVG+V+GK HPHGD ++YD++VRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTEAR+
Sbjct: 74  RIVGDVMGKYHPHGDAAIYDAMVRLAQEFAARYPLVEGQGNFGNIDGDNAAAMRYTEARL 133

Query: 137 TQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNV 196
           T++A+ +L+G++E+AVDFR TY+ E+ EP+V P+ FPNLLANG +GIAVGMATSIP HN 
Sbjct: 134 TEIAKAMLEGIEENAVDFRATYDGEEQEPIVLPAAFPNLLANGAAGIAVGMATSIPPHNA 193

Query: 197 QEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW 256
            E+C AAL LIDNP+  +++LL  + GPDFPTGG++VES E+I E+Y  GRGGFR+RARW
Sbjct: 194 GELCAAALVLIDNPKAELDELLAVMPGPDFPTGGVLVESPEAIREAYATGRGGFRIRARW 253

Query: 257 CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPK 316
             E++  G+W I+VTEIPYQV KSRLIE+IA+L+  K++PLL D+RDES + VRIVL PK
Sbjct: 254 AEEKLKNGAWQIIVTEIPYQVAKSRLIEQIAQLMEEKKLPLLADVRDESTDVVRIVLEPK 313

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           +R+++P +LME++F  + +E RFPLNMNVL   R P+VM L  +L+ WL HR  VL RRS
Sbjct: 314 SRTVEPAVLMETLFRATSLEARFPLNMNVLDASRTPRVMGLREVLRCWLDHRHVVLVRRS 373

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
             R+ AI RR+EIL+G LI YLN+DE+I IIR ED PKP +++RF+LTE Q +AILN+RL
Sbjct: 374 EHRLAAIARRLEILEGYLIVYLNLDEVIRIIREEDHPKPALMARFALTETQAEAILNMRL 433

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           RSLRKLEE +I+ E   L AE++ + +LL S  ++W +IA EI   +  F + T+LGRRR
Sbjct: 434 RSLRKLEEMEIRKEHKKLSAEQKSLQALLGSEGKRWKRIAEEIAATRARFGEETELGRRR 493

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
           +T  + + A     ++A +E+E ITV++S +GWIR++K H    +   FKEGD L+ ALH
Sbjct: 494 STL-DAAPAAVVIDERAFVEREMITVILSEKGWIRAVKGHLPPETEHKFKEGDRLRAALH 552

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
           A TTDRI L +T+GK +TL A  +  GRG G+ ++L++DL +  ++V+ FV+    K LV
Sbjct: 553 AETTDRICLFATNGKCFTLKADAIPRGRGDGQPVRLMVDLTNEDEVVSLFVWRPERKFLV 612

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSID 676
            +S G  F+V+  ++ A  R GK  L V S  +   ++   GD VA++GENRKLL+F ++
Sbjct: 613 AASDGRGFVVKSEDLTAEKRTGKQVLLVDSPVEAARLIPAEGDTVAIIGENRKLLVFPLE 672

Query: 677 QIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGV 736
           Q+PEM RG+GV LQ YKDGG++DV  F   EGLTW    G    R E DL  W G R G 
Sbjct: 673 QVPEMVRGRGVTLQGYKDGGMADVKVFSAREGLTW--KIGERV-RMETDLTTWRGNRAGA 729

Query: 737 GSLVPKGFPRSGKF 750
           G   P GFP++ +F
Sbjct: 730 GRQPPNGFPKTNRF 743


>gi|188580257|ref|YP_001923702.1| DNA topoisomerase IV subunit A [Methylobacterium populi BJ001]
 gi|179343755|gb|ACB79167.1| DNA topoisomerase IV, A subunit [Methylobacterium populi BJ001]
          Length = 748

 Score =  830 bits (2145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/736 (54%), Positives = 531/736 (72%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + +++V L+ ALEERY AYALSTI +RA+PD RDG KPVHRRI++ M  + LD  +AFKK
Sbjct: 11  DGIESVELKTALEERYYAYALSTIMQRALPDARDGLKPVHRRILYGMRLLRLDPTSAFKK 70

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEA 134
            A+IVG+V+G  HPHGDQ++YD+LVRL+Q F QRYPL+ GQGNFGNIDGD  AAYRYTEA
Sbjct: 71  CAKIVGDVMGDFHPHGDQAIYDALVRLSQDFAQRYPLVDGQGNFGNIDGDGPAAYRYTEA 130

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           R+T+VA L+L G+DED VDFR +YN E  EPVV P+ FPNLLANG+ GIAVGMATSIP H
Sbjct: 131 RLTEVARLLLDGIDEDTVDFRPSYNGEKEEPVVLPAAFPNLLANGSQGIAVGMATSIPPH 190

Query: 195 NVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
           N  E+C+AAL LI N E + E+L  ++ GPDFPTGGI+++S + I E+YR GRGGFRVRA
Sbjct: 191 NAAELCDAALYLIQNREATSEQLCTFVQGPDFPTGGILIDSPDVIREAYRTGRGGFRVRA 250

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLF 314
           RW  E++GRG+W IVVTEIPY V K+RLIEK+A+L+  K++PLL D+RDESAEDVR+VL 
Sbjct: 251 RWAKEDLGRGTWNIVVTEIPYGVPKARLIEKLADLLQEKKLPLLADVRDESAEDVRVVLE 310

Query: 315 PKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFR 374
           P++RS+DP LLMES+F LS++E R PLN+NVL  G VP+V+ L   L+EW+ HRR VL R
Sbjct: 311 PRSRSVDPVLLMESLFRLSELEARVPLNLNVLVGGVVPRVIGLAECLREWVDHRRVVLQR 370

Query: 375 RSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNL 434
           RSS+R+  I+RR+EIL GLLI YL++DE+I IIR ED+PK  +++RF LTE Q +AIL+ 
Sbjct: 371 RSSYRLGQIERRLEILGGLLIVYLDLDEVIRIIREEDEPKAALMARFELTEVQANAILDT 430

Query: 435 RLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGR 494
           RLRSLRKLEE ++K E + L  EKE I++LL S K QW +I  +IR VK+ F   T LG+
Sbjct: 431 RLRSLRKLEEMELKREFEALTQEKEGIEALLGSEKLQWTEITKQIRAVKKTFGPETKLGK 490

Query: 495 RRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIA 554
           RRTT              AM+E+EPITV++S +GWIR+LK H  DLS + FK  D+LK++
Sbjct: 491 RRTTLENPPDTAGIDFTAAMVEREPITVILSEKGWIRALKGHVADLSGVTFKGDDTLKVS 550

Query: 555 LHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKL 614
             + TT +ILLL+++GK +T+ A  L  GRG G+ ++L++DL+   +IV A  Y    KL
Sbjct: 551 FLSETTAKILLLASNGKVFTIEASKLPGGRGFGDPVRLMVDLDDGTEIVAALPYKPESKL 610

Query: 615 LVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
           LV  S G  FI     ++ANTRKGK  L +       L+V   GDH+AV   ++ +L+F 
Sbjct: 611 LVAGSDGRGFIAPSDALVANTRKGKAILGLDEGTSATLLVPAEGDHIAVCSSDKLMLVFP 670

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
             ++ E+SRGKGVRLQ  +   ++D   F + +GL W D +G++       L  ++G R 
Sbjct: 671 ASEVTELSRGKGVRLQRCRQSRLTDACVFTLADGLPWRDGSGQARLYQVAMLEKFMGHRS 730

Query: 735 GVGSLVPKGFPRSGKF 750
             G+L+ + FP+  +F
Sbjct: 731 DAGALMTRSFPKFERF 746


>gi|163793045|ref|ZP_02187021.1| Type IIA topoisomerase, A subunit [alpha proteobacterium BAL199]
 gi|159181691|gb|EDP66203.1| Type IIA topoisomerase, A subunit [alpha proteobacterium BAL199]
          Length = 744

 Score =  827 bits (2136), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/727 (55%), Positives = 531/727 (73%), Gaps = 4/727 (0%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIG 84
           AL +RYLAYALSTI  R++PD+RDG KPVHRR++ AM ++ LD G+ FKKSAR+VG+V+G
Sbjct: 20  ALSQRYLAYALSTIMSRSLPDVRDGLKPVHRRLLFAMRQLRLDPGSGFKKSARVVGDVMG 79

Query: 85  KLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELIL 144
           K HPHGD S+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTEAR+T+VA L+L
Sbjct: 80  KFHPHGDSSIYDALVRLAQDFAVRYPLVDGQGNFGNIDGDNAAAMRYTEARLTEVAALLL 139

Query: 145 QGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAAL 204
            G+DED VDFR TY+ E  EPVV PS FPNLLANG  GIAVGMATSIP HNV E+C A  
Sbjct: 140 DGIDEDTVDFRQTYDGEGEEPVVLPSAFPNLLANGAQGIAVGMATSIPPHNVDELCTALQ 199

Query: 205 ALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRG 264
            LI +PE   E L+E + GPD PTGG++VE+RES++E+YR GRG FRVRA+W VE +  G
Sbjct: 200 HLIKHPEARDETLVEMVPGPDLPTGGVLVEARESVLEAYRTGRGSFRVRAKWEVEPLKNG 259

Query: 265 SWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDL 324
           +W IVVTEIPYQVQKSRL+E++AEL+  +++ LL+DIRDESA D+R+VL PK+R++DPD+
Sbjct: 260 TWQIVVTEIPYQVQKSRLVERMAELLQNRKLTLLDDIRDESAMDIRLVLEPKSRNVDPDV 319

Query: 325 LMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAID 384
           LMES+F  +D+E+R  LN+NVL    VP+VM L   L+ +L HR++VL RR+  R++ I 
Sbjct: 320 LMESLFRQTDLESRISLNLNVLDKDNVPRVMSLREALQAFLDHRQDVLVRRTRHRLEKIA 379

Query: 385 RRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEE 444
            R+E+L G LIAYLN+DEII I+R ED+PK VM+  F L++ Q +AILN+RLR+LR+LEE
Sbjct: 380 HRLEVLGGYLIAYLNLDEIIRIVREEDEPKAVMMRTFELSDVQAEAILNMRLRALRRLEE 439

Query: 445 YQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSR 504
            +I+ E +NL AE++ + +LLN   +QW  ++ ++ E++  F K+T++GRRRT       
Sbjct: 440 IEIRKEFENLSAERDDLTALLNDDARQWRAVSDQLGEIRRGFGKTTEIGRRRTVIGSTPN 499

Query: 505 ADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRIL 564
                  +A++E+EPITV+ S +GWIR+LK H      + +KEGD  +  LHA TTD+IL
Sbjct: 500 P-VVVPTEALVEREPITVICSEKGWIRALKGHIGLDQEVKYKEGDGERFRLHAETTDKIL 558

Query: 565 LLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAF 624
           + +TDG+ YT+    L SGRGHGE ++L+IDL +++D+V    Y +  +LLV SS+G  F
Sbjct: 559 VFATDGRFYTIGGDKLPSGRGHGEPLRLMIDLANDEDVVAIRPYRTGDRLLVASSEGRGF 618

Query: 625 IVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRG 684
           +V   +++A TR GK  L V S  +  + V V GD VAVVG NRKLL+F    IPEM RG
Sbjct: 619 VVPVDDVVAQTRAGKQVLVVDSGARANICVTVAGDTVAVVGTNRKLLVFDAADIPEMVRG 678

Query: 685 KGVRLQSYKDGG-ISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKG 743
           KGV LQ YK GG ++D + FK  +GL+W+   GR   R+E DL  W GKR G G   P G
Sbjct: 679 KGVILQKYKPGGHLADAVVFKAEDGLSWVLQGGR--RRTEPDLGVWRGKRAGAGKNPPTG 736

Query: 744 FPRSGKF 750
           FPR  +F
Sbjct: 737 FPRPPRF 743


>gi|254462505|ref|ZP_05075921.1| DNA topoisomerase IV, A subunit [Rhodobacterales bacterium
           HTCC2083]
 gi|206679094|gb|EDZ43581.1| DNA topoisomerase IV, A subunit [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 767

 Score =  826 bits (2133), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/770 (53%), Positives = 544/770 (70%), Gaps = 29/770 (3%)

Query: 6   ISNSNTLVEENVKAVS--LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSE 63
           +S+  T    NV  +S  LR AL +RYL YALSTI  RA+PD RDG KPVHRRI++AM E
Sbjct: 1   MSDDTTDENLNVPDLSEPLRRALGDRYLTYALSTIMHRALPDARDGLKPVHRRILYAMRE 60

Query: 64  MGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG 123
           + L     F+KSA+I G+V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDG
Sbjct: 61  LKLSATGGFRKSAKISGDVMGNYHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDG 120

Query: 124 DSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGI 183
           D+ AA RYTEARMT  AE +L+G+ E+AVDFR+ Y+   +EPVV P+ FPNLLANG+SGI
Sbjct: 121 DNPAAARYTEARMTLAAEALLEGLAENAVDFRENYDGTLTEPVVLPASFPNLLANGSSGI 180

Query: 184 AVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESY 243
           AVGMAT+IP HN+ E+CEA L LI  P+   + LL ++ GPDFPTGG IVE +E+I E+Y
Sbjct: 181 AVGMATNIPPHNIAELCEACLHLIKTPDARDDTLLNFVPGPDFPTGGTIVEPKENIAEAY 240

Query: 244 RLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRD 303
           R GRG FR+R ++ VE++GRG W IVVTEIPYQVQKS+LIEKIA+LI  K+IP+L DIRD
Sbjct: 241 RTGRGSFRLRCKYEVEDLGRGQWQIVVTEIPYQVQKSKLIEKIADLIQTKKIPILGDIRD 300

Query: 304 ESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKE 363
           ESAEDVRIVL P++++++PD+LM  ++  SD+E RF LNMNVL  G  P+V  +  +L+ 
Sbjct: 301 ESAEDVRIVLEPRSKNVEPDILMSMLYRSSDLEVRFSLNMNVLIDGLTPKVCSMKEVLRA 360

Query: 364 WLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMV----- 418
           +L HRR+VL RRS+ RM+ ID R+E+L+GL+IA+LN+D +I IIR +D PK  ++     
Sbjct: 361 FLDHRRDVLIRRSTHRMEKIDHRLEVLEGLIIAFLNLDRVIDIIRYDDDPKAALMREDWG 420

Query: 419 -----------------SRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKI 461
                                LTE Q +AILN+RLRSLR+LEE ++K E D L+ E+  +
Sbjct: 421 RTFTRAMSEADYVGPPTGEGELTEVQAEAILNMRLRSLRRLEEMELKRERDALMEERAGL 480

Query: 462 DSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPIT 521
           D LLNS + QW+ IA +IRE K+ F K    G RR+ F E    ++  L +AMI++EPIT
Sbjct: 481 DDLLNSVELQWSSIADQIRETKKQFGKDHPAGARRSQFAEAGEVEEVPL-EAMIDREPIT 539

Query: 522 VVISNRGWIRSLKSHSVDLS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNL 580
           VV S  GWIR++  H +DL+  L FK+GD  +   HA TTDR+L   ++G+ YT+ A NL
Sbjct: 540 VVCSEMGWIRAMTGH-IDLTRELKFKDGDGPRFIFHAETTDRLLAFGSNGRFYTVSAANL 598

Query: 581 LSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKT 640
             GRG GE ++L++DL +   +V  F++ S  KLLV SS G+ F+V E +++A TR GK 
Sbjct: 599 PGGRGMGEPLRLIVDLPNEAGLVDLFIHKSGRKLLVASSAGDGFVVPEDDVVAQTRSGKQ 658

Query: 641 FLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDV 700
            L V  + +  +   VTGD VAVVGENRK+L+F +D++PEM RGKGVRLQ YKDGG+SDV
Sbjct: 659 VLNVRGDNRALVCKPVTGDSVAVVGENRKVLVFPLDELPEMGRGKGVRLQKYKDGGMSDV 718

Query: 701 ICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
             F + +GL+W+D AGR+  R+E +L  W GKR G G + P+GFPR  +F
Sbjct: 719 ATFTMADGLSWLDPAGRT--RTEVELAEWTGKRAGSGRMAPRGFPRDNRF 766


>gi|119385273|ref|YP_916329.1| DNA topoisomerase IV subunit A [Paracoccus denitrificans PD1222]
 gi|119375040|gb|ABL70633.1| DNA topoisomerase IV subunit A [Paracoccus denitrificans PD1222]
          Length = 747

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/737 (53%), Positives = 534/737 (72%), Gaps = 7/737 (0%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           ++   +  L  A+ ERYL YALSTI  RA+PD RDG KPVHRRI+ AM E+ L    AF+
Sbjct: 17  QDQTTSEPLSRAIGERYLTYALSTIMNRALPDARDGLKPVHRRILFAMRELRLSPTGAFR 76

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           KSA+I G+V+G  HPHGD ++YD++ RLAQPF  RYPL+ GQGNFGNIDGD+ AA RYTE
Sbjct: 77  KSAKISGDVMGNYHPHGDAAIYDAMARLAQPFAMRYPLVDGQGNFGNIDGDNPAASRYTE 136

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           AR+T  AE +++G+ E+AVDFR  Y+    EP+V P+ FPNLL NG SGIAVGMAT++P 
Sbjct: 137 ARLTAAAEALMEGLAENAVDFRPNYDGTLEEPIVLPAAFPNLLCNGASGIAVGMATNVPP 196

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN+ E+ +A L LI  P+   + L+  + GPDFPTGG++VESRE+I E+YR GRG  R+R
Sbjct: 197 HNLHEVIDACLHLIKAPDARDDTLVSIVPGPDFPTGGVLVESRETIAEAYRTGRGSLRLR 256

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           ARW VE++GRG W IVVTEIPYQVQKS+LIE++AE+I  K++P+L D+RDESAED+RIVL
Sbjct: 257 ARWSVEDLGRGQWQIVVTEIPYQVQKSKLIERLAEVIQLKKVPILADVRDESAEDIRIVL 316

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            P+ R++D + LM ++F +SD+E RF LNMNVL  GRVP+V  L  +L+ +L HRREVL 
Sbjct: 317 EPRTRAVDAEQLMAALFRVSDLEVRFGLNMNVLIDGRVPKVCSLKEVLRAFLDHRREVLV 376

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS+ R+  I  R+E+L+G +IA+LN+D +I IIR+ED PK VM++ F L++ QV+AILN
Sbjct: 377 RRSNHRLDKIAARLEVLEGYMIAFLNLDRVIEIIRHEDDPKAVMIAEFKLSDVQVEAILN 436

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
           +RLR+LR+LEE ++++E +NL  E+E + ++L     QW +IA E+RE +  F KS   G
Sbjct: 437 MRLRALRRLEEIELRAEHENLTREREGLAAMLADEGAQWARIAEELRETRAKFGKSASGG 496

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
           +RRT   E     +  +  AMIE+EPITV++S  GWIR++K H    + + FK+GD   +
Sbjct: 497 QRRTEIGEAGEVAEIDM-DAMIEREPITVILSKMGWIRAMKGHQPLDAEVKFKDGDGPFM 555

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
           ALHA TTD++++ + +G+ YTLPA NL  GRG GE ++L+IDL ++  ++  F +    +
Sbjct: 556 ALHAETTDKLMVFAANGRFYTLPANNLPGGRGMGEPLRLMIDLPNDAAVIDMFPWRDGER 615

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
            LV S  G+ F+V  ++I+A TR GK  L   +     L  +VTGDHVAVVG+NRKLL+F
Sbjct: 616 YLVASKAGDGFVVAGADILAQTRAGKQVLNGEA----ALCRRVTGDHVAVVGQNRKLLVF 671

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
            + ++PEM+RGKGVRLQ YKDGG+SD +C  + EGL W ++ GR+  RSE DL  WLGKR
Sbjct: 672 PLSELPEMARGKGVRLQKYKDGGLSDAVCITLAEGLRWQETGGRT--RSEPDLTEWLGKR 729

Query: 734 GGVGSLVPKGFPRSGKF 750
            G G + P+GFPR  +F
Sbjct: 730 AGAGYMAPRGFPRDNRF 746


>gi|114771233|ref|ZP_01448653.1| DNA topoisomerase IV subunit A [alpha proteobacterium HTCC2255]
 gi|114548158|gb|EAU51045.1| DNA topoisomerase IV subunit A [alpha proteobacterium HTCC2255]
          Length = 748

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/730 (53%), Positives = 539/730 (73%), Gaps = 5/730 (0%)

Query: 22  LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGE 81
           LR A+ +RYL YALSTI  RA+PD RDG KPVHRRI++AM  + L     F KSA+I G+
Sbjct: 22  LRRAIGDRYLTYALSTIMHRALPDARDGLKPVHRRILYAMYRLKLVSNGKFLKSAKISGD 81

Query: 82  VIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAE 141
            +G  HPHGD ++YD++ RLAQ F  RYP++ GQGNFGNIDGD+ AA RYTEARMT VAE
Sbjct: 82  TMGDFHPHGDAAIYDAMARLAQDFSVRYPMVDGQGNFGNIDGDNPAAARYTEARMTAVAE 141

Query: 142 LILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICE 201
            +L G++E+AVDF+D Y+   +EP V P+ FPNLLANG++GIAVGMAT+IP HN+ E+ +
Sbjct: 142 AMLIGMEENAVDFQDNYDGRLTEPSVLPASFPNLLANGSTGIAVGMATNIPPHNIGELLD 201

Query: 202 AALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEV 261
           A++ LI  P    E LL+++ GPDFPTGGI+VE R+S++E+YR GRG  R+R++W +E++
Sbjct: 202 ASIHLIKAPNARDETLLDFVPGPDFPTGGILVEPRDSLLETYRTGRGPMRLRSKWEIEDL 261

Query: 262 GRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLD 321
            RG W IVVTEIPYQVQKS+LIEKIAELI  K++P+L D+RDESAED+R+VL P+ +++D
Sbjct: 262 PRGLWQIVVTEIPYQVQKSKLIEKIAELIQLKKLPILADVRDESAEDIRLVLEPRAKTVD 321

Query: 322 PDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQ 381
           P +LME++F +SD+E RF LN+N L  GR P+V  +  +L+ ++ H+R+VL RRS  RM 
Sbjct: 322 PTVLMETLFRMSDLEVRFNLNLNTLIDGRTPKVCSMKEVLRAFIDHKRDVLLRRSKHRMD 381

Query: 382 AIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRK 441
            ID R+E+L+G ++A+LN+D +I IIRNED+PK +M+  FSL++ QV+AILN+RLRSLRK
Sbjct: 382 KIDHRLEVLEGYIVAFLNLDRVIEIIRNEDEPKKIMMKEFSLSDVQVEAILNMRLRSLRK 441

Query: 442 LEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCE 501
           LEE ++++ELD+L  E+  +D LL S K QW +I  E+RE +++F K++D G RRT   E
Sbjct: 442 LEEIELRTELDSLQLERADLDDLLASEKMQWERIINELRETRKVFGKNSDSGNRRTELAE 501

Query: 502 VSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSA-LHFKEGDSLKIALHAHTT 560
               ++  + +AMIEKEPITVV S+ GW+R++K H VDLS  L +K+GD  +   HA TT
Sbjct: 502 APDFEEVPI-EAMIEKEPITVVCSSMGWLRAMKGH-VDLSQELKYKDGDEKRFVFHAETT 559

Query: 561 DRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSK 620
           D++L+   +G+ YT+    L  GRG GE I+L++DL ++ ++V  F++    KLL+ SS 
Sbjct: 560 DKLLMFGGNGRFYTMSCSELPGGRGMGEPIRLIVDLPNDANMVDLFIHQPDRKLLLASSA 619

Query: 621 GNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPE 680
           G+ F+VEE++I+A TR GK  L V  +    +   V GD+VA VG+NRK+LIF ID++P 
Sbjct: 620 GDGFVVEENDIVAQTRTGKQALNVKGDITALICKPVVGDYVATVGQNRKVLIFPIDELPV 679

Query: 681 MSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLV 740
           MSRGKGVR+Q YKDGG++D   F   +GL+W+D AGR   R E +L  W+GKR G G + 
Sbjct: 680 MSRGKGVRMQKYKDGGLNDATTFHFIDGLSWLDPAGR--RRIETELADWIGKRAGAGRMA 737

Query: 741 PKGFPRSGKF 750
           P+GFPR  KF
Sbjct: 738 PRGFPRENKF 747


>gi|144899858|emb|CAM76722.1| Gram negative topoisomerase IV, subunit A [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 741

 Score =  824 bits (2128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/739 (53%), Positives = 539/739 (72%), Gaps = 5/739 (0%)

Query: 13  VEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAF 72
           V  +++  SL  AL ERYLAYA+STI  R++PD+RDG KPVHRR++ AM ++ LD    F
Sbjct: 6   VSGDIRDTSLSEALGERYLAYAMSTIVSRSLPDVRDGLKPVHRRLLFAMRQLKLDPEGGF 65

Query: 73  KKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYT 132
           KK AR+VG+VIGK HPHGD SVYD++VRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYT
Sbjct: 66  KKCARVVGDVIGKYHPHGDMSVYDAMVRLAQDFAVRYPLVEGQGNFGNIDGDNAAAMRYT 125

Query: 133 EARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIP 192
           EA++T VA  +++ +D+D VDFR TY+  + EPVV P+ FPNLLANG +GIAVGMAT+IP
Sbjct: 126 EAKLTAVAAALMENLDDDTVDFRPTYDGSEEEPVVMPAAFPNLLANGAAGIAVGMATNIP 185

Query: 193 SHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRV 252
            HNV EIC A   LI  P+  ++ L+ ++ GPDFPTGG++VES+ SI E+YR GRG FR+
Sbjct: 186 PHNVGEICNALTHLIAAPDCPVDDLVRHMPGPDFPTGGVLVESQASIHEAYRSGRGSFRL 245

Query: 253 RARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIV 312
           RA+W VE++  G + I+VTEIPYQVQKS++IEKIAEL+  K++PLL DIRDESAEDVR+V
Sbjct: 246 RAKWEVEKLSHGLYQIIVTEIPYQVQKSKVIEKIAELLNEKKLPLLADIRDESAEDVRVV 305

Query: 313 LFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVL 372
           L P+NR+++ ++LME +F  +D+E R  LNMNVL    VP VM L  +L+ +L HR EVL
Sbjct: 306 LEPRNRTVEAEMLMEQLFRQTDLEVRVSLNMNVLDRDAVPSVMNLKQVLQAFLDHRMEVL 365

Query: 373 FRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAIL 432
            RRS FR+  I+RR+E+L+G L+AYLN+DE+I IIR ED+PK VM+  F LTE Q +AIL
Sbjct: 366 ERRSRFRLDKIERRLEVLEGYLVAYLNLDEVIRIIREEDEPKAVMMRTFGLTEVQTEAIL 425

Query: 433 NLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDL 492
           N+RLRSLRKLEE++I+ E D L AEK  +++LL    ++W+ IA ++   ++ F   T L
Sbjct: 426 NMRLRSLRKLEEFEIRKEHDQLSAEKSDLEALLADESRRWSTIAAQVAATRKAFGPGTPL 485

Query: 493 GRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLK 552
           G RRT   +   A    + +A +E+EPIT+++S +GWIR++K H   L  + FKEGD LK
Sbjct: 486 GDRRTQLADAPSAVVVPI-EAFVEREPITLLLSEKGWIRAMKGHVDQLDGVKFKEGDQLK 544

Query: 553 IALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTC 612
           +AL A TTD++L+ ++DG+ YT+    L SGRG GE ++L+ID+ ++ +++  F +    
Sbjct: 545 LALKAETTDKLLVFTSDGRFYTIGGDKLPSGRGFGEPLRLMIDMANDAEVLCVFAHKPGR 604

Query: 613 KLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSE-EKMKLVVKVTGDHVAVVGENRKLL 671
           KLL+ SS G  FIVEE+E++A T+ GK  L +  E EK    +   GD VA++G+NRKLL
Sbjct: 605 KLLLSSSGGRGFIVEEAEVLAQTKAGKMVLNLGDEGEKAAFCLPAEGDAVAIIGDNRKLL 664

Query: 672 IFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLG 731
           +F  ++IP M+RG+GV LQ Y+DGG++D+  F + +GL+W  S  R+  R+E DL  WLG
Sbjct: 665 VFMAEEIPVMARGRGVLLQKYRDGGVADIKVFTLADGLSW-KSGERT--RTEQDLTPWLG 721

Query: 732 KRGGVGSLVPKGFPRSGKF 750
           KR  VG L P GFPR+ KF
Sbjct: 722 KRASVGRLPPTGFPRANKF 740


>gi|83593183|ref|YP_426935.1| DNA topoisomerase IV subunit A [Rhodospirillum rubrum ATCC 11170]
 gi|83576097|gb|ABC22648.1| DNA topoisomerase IV subunit A [Rhodospirillum rubrum ATCC 11170]
          Length = 743

 Score =  824 bits (2128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/736 (54%), Positives = 540/736 (73%), Gaps = 8/736 (1%)

Query: 17  VKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSA 76
           ++   L  AL ERYLAYALSTI  R++PD+RDG KPVHRR+++AM  + LD G+ FKK A
Sbjct: 12  IRETPLSEALSERYLAYALSTIVSRSLPDVRDGLKPVHRRLLYAMRMLKLDPGSGFKKCA 71

Query: 77  RIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARM 136
           R+VG+VIGK HPHGD +VY+++VRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTEAR+
Sbjct: 72  RVVGDVIGKYHPHGDAAVYEAMVRLAQEFAVRYPLVEGQGNFGNIDGDNAAAMRYTEARL 131

Query: 137 TQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNV 196
           T VA  +++G+D+DAVDFR TY+ ED EPVV P+ FPNLLANG+SGIAVGMAT+IP HNV
Sbjct: 132 TAVASALMEGLDDDAVDFRPTYDGEDHEPVVMPAAFPNLLANGSSGIAVGMATNIPPHNV 191

Query: 197 QEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW 256
            E+CEA L LI  P    E LL ++ GPDFPTGG++ E  ++I E+YR GRG  R+RARW
Sbjct: 192 GELCEALLHLIKVPACPPEALLSFVKGPDFPTGGVLAEHPQAIAEAYRTGRGAMRLRARW 251

Query: 257 CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPK 316
             E +  G + IV+TEIPYQ+QK++L+E+IAELI  +++P+L D+RDESA+D+R+VL P+
Sbjct: 252 EKENLSHGLYQIVITEIPYQIQKAKLVERIAELINGRKLPILADVRDESADDLRLVLEPR 311

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           NR++D + LME +F L+D+E RF LNMNVL    VP+V+ L   L  +L HR  VL RRS
Sbjct: 312 NRTVDAETLMEQLFRLTDLEIRFNLNMNVLDGDGVPKVLGLKEALVAFLDHRLVVLGRRS 371

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
             R+  I+ R+E+L G LIAYLN+DE+I IIR ED+PKP +++ F L++ Q +AILN+RL
Sbjct: 372 RHRLGKIEHRLEVLAGTLIAYLNLDEVIRIIREEDEPKPALMAAFGLSDVQTEAILNMRL 431

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           RSLR+LEE +I+ E D L AEK  +++LL      W  IA +IRE ++ F   T LGRRR
Sbjct: 432 RSLRRLEEMEIRREHDALSAEKAGLEALLADEGLCWKVIAKQIRETRKTFGGDTALGRRR 491

Query: 497 TTFCEVSRADKATLQ--QAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIA 554
           T   E+  A  A +   +A++E+EPITV++S RGW+R++K H        FKEGD+L +A
Sbjct: 492 T---ELGSAPTAVIVPIEALVEREPITVLLSERGWLRAVKGHQEPGEENKFKEGDALLLA 548

Query: 555 LHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKL 614
           LHA TTD++L+L + G+ +TLPA  L  GRG GE ++L++DL ++ DIV+  V+D   +L
Sbjct: 549 LHAQTTDKLLILDSTGRFFTLPADKLARGRGFGEPVRLMLDLPNDADIVSLLVHDPARRL 608

Query: 615 LVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
           ++ +S G  F+VEE +++A TR GK  + V + E+  L  +V GDHVAV+G+NRKLL+F 
Sbjct: 609 ILAASGGRGFVVEEKDVLAQTRAGKQVMTVDAGERALLCREVRGDHVAVIGQNRKLLVFP 668

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
           + Q+P ++RGKGV LQ YKDGGI+D+  F I +GLTW  S  R+  R+E+DL  WLG R 
Sbjct: 669 LTQVPVLARGKGVILQRYKDGGIADIKTFAIADGLTW-KSGERT--RTESDLTAWLGDRA 725

Query: 735 GVGSLVPKGFPRSGKF 750
           G+G L P+GFPR+  F
Sbjct: 726 GLGRLPPQGFPRTNSF 741


>gi|148260212|ref|YP_001234339.1| DNA topoisomerase IV subunit A [Acidiphilium cryptum JF-5]
 gi|326402843|ref|YP_004282924.1| DNA topoisomerase IV subunit A [Acidiphilium multivorum AIU301]
 gi|146401893|gb|ABQ30420.1| DNA topoisomerase IV subunit A [Acidiphilium cryptum JF-5]
 gi|325049704|dbj|BAJ80042.1| DNA topoisomerase IV subunit A [Acidiphilium multivorum AIU301]
          Length = 744

 Score =  823 bits (2125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/735 (53%), Positives = 521/735 (70%), Gaps = 6/735 (0%)

Query: 16  NVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKS 75
           NV+   L  AL ERYLAYALSTI  R++PD+RDG KPVHRR+I AM ++ LD G+ FKK 
Sbjct: 8   NVQDTKLATALSERYLAYALSTIMARSLPDVRDGLKPVHRRLIFAMRQLRLDPGSGFKKC 67

Query: 76  ARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEAR 135
           AR+VG+V+GK HPHGD S+Y++LVRLAQ F  RYPLI GQGNFGNIDGD+AAA RYTE+R
Sbjct: 68  ARVVGDVMGKFHPHGDMSIYEALVRLAQDFASRYPLIEGQGNFGNIDGDNAAAMRYTESR 127

Query: 136 MTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHN 195
           +T+VA  +L+G+DEDAVDFR TY+ ED+EPVV P  FPNLLANG +GIAVGMATSIP HN
Sbjct: 128 LTEVAAALLEGIDEDAVDFRPTYDNEDTEPVVLPGAFPNLLANGAAGIAVGMATSIPPHN 187

Query: 196 VQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRAR 255
             E+C AA+ LI +PE     LL+++ GPDFPTGG +VE R +++ +Y  GRG  RVRAR
Sbjct: 188 AAELCAAAIHLIRHPEADTAALLDFVQGPDFPTGGELVEDRATLLSAYETGRGSLRVRAR 247

Query: 256 WCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFP 315
           W   ++  G+W IVVTEIPYQVQKSRLIE++A+L+  +++PLL DIRDES E VRIVL P
Sbjct: 248 WSRSDLKGGAWQIVVTEIPYQVQKSRLIEQVAQLMAERKLPLLGDIRDESTERVRIVLEP 307

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           K+R++DPD+LM S+F  +  E RF +NMNVL   R P+VM L  +L+ WL HR EVL RR
Sbjct: 308 KSRTVDPDMLMASLFRATAFEQRFSMNMNVLDADRTPRVMGLREMLRAWLDHRHEVLERR 367

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
           S  R+ AI RR+EIL+G L  +LN+DE+I IIR ED+PKP +++ F+LT+ Q +AILN+R
Sbjct: 368 SRHRLAAIARRLEILEGYLAVFLNLDEVIRIIRTEDEPKPALIAAFTLTDTQAEAILNMR 427

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LRSLRKLEE +I+ E   L AE++ +D++L    ++W +I  EI    + F      G R
Sbjct: 428 LRSLRKLEEMEIRKEHKALTAERKALDAMLADPAKRWARIETEIEATAKTFGGGP--GAR 485

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           RTT        +  + +A++E+EP+TV++S +GWIR+LK H+V  + L FKEGD LK  L
Sbjct: 486 RTTISGAVPVTEVAV-EALVEREPLTVILSEKGWIRALKGHAVAEAELKFKEGDRLKALL 544

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
              + DR+ + +T+G+ Y+L A +L  GRG G+AI+L++DL +  ++   F+ D   + L
Sbjct: 545 RCSSLDRVTVFATNGRVYSLRAADLPRGRGDGQAIRLMVDLGNEDEVAALFIADPEARYL 604

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSI 675
           V  + G  FI+  +E+ A  R GK  L V   ++  L  KV GDH+AV+G+NRKLL+F +
Sbjct: 605 VAGTDGRGFIIAGAELGAEKRTGKQILTVRPGQEAMLCRKVAGDHLAVIGQNRKLLVFPL 664

Query: 676 DQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGG 735
           +Q+PEM+RG GV LQ YKDGG++D   F +  GL+W         R+E  L  WLG RG 
Sbjct: 665 EQVPEMARGAGVILQKYKDGGLADAKAFTLASGLSWRLG---DKQRTETRLAEWLGARGQ 721

Query: 736 VGSLVPKGFPRSGKF 750
            G L P GFPRSG F
Sbjct: 722 AGRLPPTGFPRSGTF 736


>gi|294084097|ref|YP_003550855.1| DNA topoisomerase IV subunit A [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663670|gb|ADE38771.1| DNA topoisomerase IV, A subunit [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 740

 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/750 (53%), Positives = 531/750 (70%), Gaps = 11/750 (1%)

Query: 1   MGVDNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHA 60
           M  D  +N      E++   S   AL ERYLAYALSTI  R++PD+RDG KPVHRR++ A
Sbjct: 1   MANDTYTNPG----EHIDQTSFSDALSERYLAYALSTITSRSLPDVRDGLKPVHRRLLFA 56

Query: 61  MSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGN 120
           M ++ LD G  FKKSAR+VG+V+GK HPHGD ++YD++VRLAQ F  RY L+ GQGNFGN
Sbjct: 57  MRQLKLDPGQGFKKSARVVGDVMGKFHPHGDAAIYDAMVRLAQEFAMRYRLVDGQGNFGN 116

Query: 121 IDGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGT 180
           IDGD+AAA RYTEARMT+VA L+L G+DED+VDFR TY+ E  EPV+ P+ FPNLLANG 
Sbjct: 117 IDGDNAAAMRYTEARMTEVARLLLDGIDEDSVDFRPTYDGESEEPVLLPAGFPNLLANGA 176

Query: 181 SGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIV 240
            GIAVGMATSIP HNV E+ +A+L LI +P  SI+ L++Y+ GPDFPTGG++VE  +SI 
Sbjct: 177 QGIAVGMATSIPPHNVIELADASLHLIKHPNASIDTLMQYVKGPDFPTGGLLVEPADSIR 236

Query: 241 ESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLED 300
           ++Y  GRGGFRVRARW +E+   G W IVVTEIPYQVQKSRLIE++AE++ AK++P+L D
Sbjct: 237 DAYATGRGGFRVRARWEIEKEKGGGWQIVVTEIPYQVQKSRLIERLAEMLNAKKLPVLAD 296

Query: 301 IRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGI 360
           IRDESAED+RIVL PK+R L+P+++MES+F LSD+ETR PLN+NVL     P VM L G 
Sbjct: 297 IRDESAEDLRIVLEPKSRRLEPEIVMESLFKLSDLETRVPLNLNVLDATGRPGVMDLRGA 356

Query: 361 LKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSR 420
           L  WLAHR+ VL RR+ FR+  I  R+E+L+G LI YLN+DE+IAIIR  + P+  +++R
Sbjct: 357 LNAWLAHRQVVLQRRAHFRLGKIAHRLEVLEGYLIVYLNLDEVIAIIRESEHPRDALIAR 416

Query: 421 FSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIR 480
           F LTE Q +AIL++RLRSLR+LEE  +++E DNL+AE+  + +LL +   QW +IA EI+
Sbjct: 417 FDLTETQANAILDMRLRSLRRLEEMALRTERDNLVAEQADLQNLLANEDLQWKKIATEIK 476

Query: 481 EVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDL 540
           ++K+ F+K     RRRTT  +    D     + ++E+EPIT++ S +GWIR++K H    
Sbjct: 477 DMKDSFAKHD---RRRTTLADAPEIDFDP-TEILVEREPITIICSAKGWIRAMKGHQELD 532

Query: 541 SALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQ 600
           S   FKEGD   + LHA TTD+ILL + +G+ YTL    L  GRG GE + LL DL  + 
Sbjct: 533 SEFKFKEGDGPGLVLHAETTDKILLFADNGRFYTLAGDRLPRGRGFGEPVSLLTDLPADI 592

Query: 601 DIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH 660
           +I+T  +     K+LV +S G+  IV+    IA TR GK  L +  + +      V GD 
Sbjct: 593 EIIT-LLRGVAGKMLVAASTGHGLIVDMQSAIAQTRSGKQILNLPGDARAVACCMVDGDM 651

Query: 661 VAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYN 720
           VA VG NRKLL F I ++PEM+RG+GV LQ +KDGG++DV  +   +GL+W    GR+  
Sbjct: 652 VASVGVNRKLLAFPISELPEMTRGRGVILQRFKDGGLADVTVYHSDKGLSWQAGGGRT-- 709

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           R+E D+  W+ KR G G L P GFPR  KF
Sbjct: 710 RTETDMSNWIAKRAGAGKLPPTGFPRPAKF 739


>gi|114327659|ref|YP_744816.1| DNA topoisomerase IV subunit A [Granulibacter bethesdensis CGDNIH1]
 gi|114315833|gb|ABI61893.1| topoisomerase IV subunit A [Granulibacter bethesdensis CGDNIH1]
          Length = 739

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/737 (53%), Positives = 527/737 (71%), Gaps = 13/737 (1%)

Query: 17  VKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSA 76
           V+   L  AL ERYLAYALSTI  R++PD+RDG KPVHRR+I+AM ++ LD  A FKK A
Sbjct: 11  VEDTRLADALSERYLAYALSTIMARSLPDVRDGLKPVHRRLIYAMHQLRLDPDAGFKKCA 70

Query: 77  RIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARM 136
           RIVG+VIGK HPHGD + Y++LVRLAQ F  RYPL+ GQGNFGNIDGD AAAYRYTEAR+
Sbjct: 71  RIVGDVIGKYHPHGDSAAYEALVRLAQDFASRYPLVDGQGNFGNIDGDGAAAYRYTEARL 130

Query: 137 TQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNV 196
           T+VA  +L+G+D+DAVD R TYN E+ EP V P+ FPNLLANG +GIAVGMATSIP HN 
Sbjct: 131 TEVARTMLEGIDDDAVDLRPTYNAEEVEPAVLPAAFPNLLANGAAGIAVGMATSIPPHNA 190

Query: 197 QEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW 256
            ++C+AALALI+NP+     LL+++ GPDFPTGGI+VE R S++++Y  GRGGFRVRARW
Sbjct: 191 GQVCDAALALIENPQADTAMLLDHLKGPDFPTGGILVEDRASMLQAYETGRGGFRVRARW 250

Query: 257 CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPK 316
             E+   GSW I++TEIPYQVQK+RLIE++A L+  K++PLL DIRDES E VRIVL PK
Sbjct: 251 HKEDGRLGSWRIIITEIPYQVQKARLIEQVAALMEEKKLPLLADIRDESTETVRIVLEPK 310

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           +R++ PD+LME++F  + +E+RFPLNMNVL   R P+VM +  +L++WL HR EVL RRS
Sbjct: 311 SRTIAPDVLMETMFRATALESRFPLNMNVLDATRTPRVMGVKEVLRQWLDHRHEVLIRRS 370

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
           + R+ +IDRR+EIL G L+ YLN+DE+I I+R ED+PK  +++ FSLT+ Q +++LN+RL
Sbjct: 371 THRLASIDRRLEILDGFLLVYLNLDEVIRIVREEDEPKAALIAAFSLTDMQAESVLNMRL 430

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           RSLRKLEE +I+ E   L  E++ +D+LL S   +W +IA E+  V++ F  S  LG RR
Sbjct: 431 RSLRKLEEMEIRREHAKLSKERKDLDALLKSEPLRWKRIAHEVAAVRDQFG-SGKLGDRR 489

Query: 497 TTFCEVSRADKATLQ---QAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
           T          AT++   +A +E+EPITV++S +GW+R+LK H  D   L FKEGD+L+ 
Sbjct: 490 TDIA----GPPATVEVAAEAFVEREPITVILSEKGWMRALKGHIADTVELRFKEGDALRF 545

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
           AL   TTDR+ LL+T+GKAYTL A +L  GRG G+ ++LL    +  D++   V     +
Sbjct: 546 ALPCETTDRLCLLATNGKAYTLKAADLPRGRGDGQPVRLLAGFGNEDDVIALLVPKEEAR 605

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
            L+VSS G  F++  ++++A  R G+  L V   E+    V   GDHVAV+ E+RKLL+F
Sbjct: 606 YLLVSSAGRGFVIRGADLLAEKRTGRQALNVKPGEEAAFCVPAEGDHVAVISESRKLLVF 665

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
            ++Q+PEM+RG GV L   K G   D++   +  GL+W+        R E DL  WLG R
Sbjct: 666 PLEQVPEMARGAGVILN--KGGAPRDIMVLTLAHGLSWMSG---EKQRVERDLSYWLGAR 720

Query: 734 GGVGSLVPKGFPRSGKF 750
           G  G + P GFP+SG+F
Sbjct: 721 GQSGKVPPNGFPKSGRF 737


>gi|114570117|ref|YP_756797.1| DNA topoisomerase IV subunit A [Maricaulis maris MCS10]
 gi|114340579|gb|ABI65859.1| DNA topoisomerase IV subunit A [Maricaulis maris MCS10]
          Length = 758

 Score =  817 bits (2110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/726 (53%), Positives = 524/726 (72%), Gaps = 2/726 (0%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIG 84
           AL  RYLAYALSTI +RA+PD RDG KPVHRR+++AM E+ L+   AFKKSAR+VG+VIG
Sbjct: 20  ALSRRYLAYALSTITQRALPDARDGLKPVHRRLLYAMRELKLNPDQAFKKSARVVGDVIG 79

Query: 85  KLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELIL 144
           K HPHGDQSVY++LVRLAQ F  RYPL+ GQGNFGNIDGD AAA RYTEAR+T+ AEL+L
Sbjct: 80  KYHPHGDQSVYEALVRLAQDFASRYPLVEGQGNFGNIDGDGAAAMRYTEARLTKAAELLL 139

Query: 145 QGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAAL 204
           Q +D+  VDF +TY+  + EP+V P  FPNLLANG++GIAVGMATS+P HNV EIC AAL
Sbjct: 140 QDIDQGTVDFEETYDGSEREPLVLPGAFPNLLANGSTGIAVGMATSVPPHNVAEICAAAL 199

Query: 205 ALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRG 264
           ALID PE   E LL++I GPD PTGG IVE  E+I  +Y  GRGGFRVRA+W  E++GRG
Sbjct: 200 ALIDKPETETEALLKHIKGPDLPTGGTIVEPPEAIRSAYETGRGGFRVRAKWEKEDIGRG 259

Query: 265 SWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDL 324
            W IVVTEIPY VQKS+L+E+IA+L+ AK++PLL+D+ DES ED+R+VL PK++ +DPD+
Sbjct: 260 MWRIVVTEIPYLVQKSKLVERIAQLMDAKKLPLLDDVLDESTEDIRLVLEPKSKLVDPDM 319

Query: 325 LMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAID 384
           LMES+F L+D+ETR  LN+NVL    VP+VM L  +L+ WL HRREV  RR++ R+  ++
Sbjct: 320 LMESLFKLTDLETRVSLNLNVLDPRGVPRVMGLREVLQIWLEHRREVAVRRATTRLAKVE 379

Query: 385 RRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEE 444
            R+E+L G LI Y ++DE+I IIR ED+PK  +++ F LTE Q +AILN+RLR+LRKLEE
Sbjct: 380 DRLEVLAGYLIVYADLDEVIRIIRFEDEPKAKLMAHFELTERQAEAILNMRLRALRKLEE 439

Query: 445 YQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSR 504
            +I+ E  NL AE++ +  L+ S   QW+++  E++ + EI++++T LG+RRT F +   
Sbjct: 440 LEIRKEDTNLRAERKTLKELIGSTALQWDKVRGEVKSLGEIYAETTPLGKRRTVFDKAPD 499

Query: 505 ADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRIL 564
                  +A + +EPIT V+S RGW+R+LK H  D++ L FKEGD    A+   TTDR+L
Sbjct: 500 ISGEAPIEAFVVREPITAVLSERGWVRALKGHINDVTELKFKEGDKSAFAVKCETTDRLL 559

Query: 565 LLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAF 624
           + +TDGK YTL A  L  GRGHGE ++L +DL  +   +  F YD    LLV S   + F
Sbjct: 560 MFATDGKFYTLEASKLPGGRGHGEPVRLHVDLPDDAAPIGLFKYDPERTLLVASDGNSGF 619

Query: 625 IVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRG 684
            ++E + +A  + GK  L ++  ++  L +  TGD VA++GEN+KLL+F +++IP MSRG
Sbjct: 620 RIQEKDCLALKKGGKQILNLAEGDEAFLCIPATGDRVALIGENKKLLVFELEEIPVMSRG 679

Query: 685 KGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGF 744
           KGV+L   K   ++D   F   +GLTW+D AGR +N   +D L W  KR   G + P+GF
Sbjct: 680 KGVKLLGGKGAKLADATVFNAEDGLTWLDGAGRRFNL--DDWLLWTAKRAQAGKMAPRGF 737

Query: 745 PRSGKF 750
           PRS +F
Sbjct: 738 PRSLRF 743


>gi|83949819|ref|ZP_00958552.1| DNA topoisomerase IV subunit A [Roseovarius nubinhibens ISM]
 gi|83837718|gb|EAP77014.1| DNA topoisomerase IV subunit A [Roseovarius nubinhibens ISM]
          Length = 768

 Score =  816 bits (2107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/756 (52%), Positives = 534/756 (70%), Gaps = 28/756 (3%)

Query: 19  AVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARI 78
           A  LR A+ ERYL YALSTI  RA+PD RDG KPVHRRII+AM E+ L     F+KSA+I
Sbjct: 16  AEPLRRAIGERYLTYALSTIMHRALPDARDGLKPVHRRIIYAMRELRLGSTGGFRKSAKI 75

Query: 79  VGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQ 138
            G+V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEARMT 
Sbjct: 76  SGDVMGNYHPHGDAAIYDAMARLAQDFAVRYPLVDGQGNFGNIDGDNPAASRYTEARMTA 135

Query: 139 VAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQE 198
           VAE +L+G+ E+AVDFRD Y+   +EPVV P+ FPNLLANG+SGIAVGMAT+IP HN+ E
Sbjct: 136 VAEAMLEGLAENAVDFRDNYDGTLTEPVVLPASFPNLLANGSSGIAVGMATNIPPHNIPE 195

Query: 199 ICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCV 258
           + +A L LI  P+   + LL Y+ GPDFPTGGIIVE RE+I E+YR GRG FR+R R+ V
Sbjct: 196 LVDACLHLIKVPDARDDTLLNYVPGPDFPTGGIIVEPRENIAEAYRTGRGAFRLRCRYEV 255

Query: 259 EEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNR 318
           E++GRG W IVVTEIPYQVQKS+LIEK+AE+I  K++P+L D+RDESA+D+R++L P+++
Sbjct: 256 EDLGRGQWQIVVTEIPYQVQKSKLIEKLAEVIQTKKVPILADVRDESADDIRVILEPRSK 315

Query: 319 SLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSF 378
           ++DP++LM  ++  +D+E RF LNMNVL  G  P+V  +  +L+ +L  RREVL RRS  
Sbjct: 316 NVDPEVLMGMLYRSTDLEVRFSLNMNVLIDGVTPKVCSMKEVLRAFLDFRREVLQRRSVH 375

Query: 379 RMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPK-----------------------P 415
           RM+ ID R+E+L+GL++A+LN+D +I IIR ++ PK                       P
Sbjct: 376 RMEKIDHRLEVLEGLIVAFLNLDRVIDIIRYDEDPKAALMREDWGRDFVRAMDEADYVPP 435

Query: 416 VMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQI 475
              +   LTE Q +A+LN+RLR+LR+LEE  +  E D L+ E+  ++ LL S   QW  I
Sbjct: 436 APGAPDGLTEVQAEAVLNMRLRALRRLEEMALVKERDALMEERAGLEDLLESEDLQWAAI 495

Query: 476 ACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKS 535
           + ++RE K+ F K  + G RRTTF E    ++  + +AMIE+EPITVV S  GWIR++  
Sbjct: 496 SDQLREAKKTFGKDYEGGARRTTFAEAGEVEEVPI-EAMIEREPITVVCSQMGWIRAMTG 554

Query: 536 HSVDLS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLI 594
           H +DL   L FK+GD      HA TTDR+L+ ++ G+ YT+ A NL  GRG GE ++L++
Sbjct: 555 H-IDLGRELKFKDGDGPSFMFHAETTDRLLVFASTGRFYTISAANLPGGRGMGEPLRLMV 613

Query: 595 DLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVV 654
           DL +  +I+  F++    K+L+ SS G+ F+V E E++A TR GK  L V  + + ++  
Sbjct: 614 DLPNEAEIIDIFIHKPGGKMLLASSAGDGFVVPEEELLAQTRTGKQVLNVRGDTRARVCK 673

Query: 655 KVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDS 714
            V+GDHVAVVGENRK+L+F +D++PEM RGKGVRLQ YKDGG+SD   F + EGL+W+D 
Sbjct: 674 PVSGDHVAVVGENRKVLVFPLDELPEMGRGKGVRLQKYKDGGLSDATTFTLAEGLSWLDP 733

Query: 715 AGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           AGR+  R+E DL  WLGKR G G + P+GFPR  +F
Sbjct: 734 AGRT--RTETDLGEWLGKRAGTGRMAPRGFPRDNRF 767


>gi|84499895|ref|ZP_00998161.1| DNA topoisomerase IV subunit A [Oceanicola batsensis HTCC2597]
 gi|84391829|gb|EAQ04097.1| DNA topoisomerase IV subunit A [Oceanicola batsensis HTCC2597]
          Length = 769

 Score =  815 bits (2104), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/760 (52%), Positives = 532/760 (70%), Gaps = 29/760 (3%)

Query: 16  NVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKS 75
           +  A  L  A+ +RYL YALSTI  RA+PD RDG KPVHRRI++AM E+ L  G  F+KS
Sbjct: 13  DTSAEPLSRAIGDRYLTYALSTIMHRALPDARDGLKPVHRRILYAMRELRLSAGGRFRKS 72

Query: 76  ARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEAR 135
           ++I G+V+G  HPHGDQ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEAR
Sbjct: 73  SKISGDVMGNFHPHGDQAIYDAMARLAQDFNVRYPLVDGQGNFGNIDGDNPAASRYTEAR 132

Query: 136 MTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHN 195
           +T +AE +++G+ E+AVDFRD Y+   +EPVV P+  PNLLANG SGIAVGMAT+IP HN
Sbjct: 133 LTAIAEAMMEGLAENAVDFRDNYDGTLTEPVVLPAAIPNLLANGASGIAVGMATNIPPHN 192

Query: 196 VQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRAR 255
           ++E+C AAL LI  P+   E LL Y+ GPDFPTGG +VE R ++ E+YR GRG FR+RA+
Sbjct: 193 IEELCNAALHLIKTPDARDETLLNYVPGPDFPTGGTMVEPRVNVAEAYRTGRGSFRLRAK 252

Query: 256 WCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFP 315
           W  E++GRG W IVVTEIPYQVQKSRLIEKIAELI  KR+P+L DIRDESA+D+R++L P
Sbjct: 253 WEKEDLGRGQWQIVVTEIPYQVQKSRLIEKIAELIQTKRVPILADIRDESADDIRMILEP 312

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           +++++DPD+LM  +F  SD+E RF LNMNVL  G  P+V  L  +L+ +L HRREVL RR
Sbjct: 313 RSKAVDPDVLMNMLFRNSDLEVRFSLNMNVLIDGVTPKVCSLKEVLRAFLDHRREVLLRR 372

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSR--------------- 420
           S  RM+ ID R+E+L+G +IA+LN+D +I IIR +D PK  +++                
Sbjct: 373 SRHRMEKIDHRLEVLEGFIIAFLNLDRVIDIIRYDDDPKAALMAEDWSVKRGRAASEADY 432

Query: 421 ---------FSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQ 471
                      L+E Q +AILN+RLRSLR+LEE ++  E D L+ E+  ++ LL S   Q
Sbjct: 433 VSPIGLDAAGELSEVQAEAILNMRLRSLRRLEELELIRERDALMEERAGLEDLLESEDLQ 492

Query: 472 WNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIR 531
           W +I+ +IREV++ F   ++ G RRT   E    ++  L +AMIE+EPITVV S  GW+R
Sbjct: 493 WVRISDQIREVRKTFGAKSEGGARRTLIEEAGEVEEVPL-EAMIEREPITVVCSRMGWVR 551

Query: 532 SLKSHSVDLS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAI 590
           ++K H +DL+  L FK+GD  + A HA TTDR+L+  T+G+ YT+ A NL  GRG GE +
Sbjct: 552 AMKGH-IDLTQKLKFKDGDEGRFAFHAETTDRLLVFGTNGRFYTVSASNLPGGRGMGEPL 610

Query: 591 QLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM 650
           +L+ID  +  DIV   ++    KL+V SS G+ F+V E +++A TR GK  L V  +   
Sbjct: 611 RLMIDFPNEADIVDILIHKPGRKLVVASSAGDGFLVSEDDVLAQTRSGKQVLNVRGDATA 670

Query: 651 KLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLT 710
            +   V GD VAVVGENRK+L+F ++ +PEM+RGKGVRLQ YKDGG+SDV  F + EGL+
Sbjct: 671 LVCKPVQGDTVAVVGENRKVLVFPVEDLPEMARGKGVRLQKYKDGGLSDVTTFNLAEGLS 730

Query: 711 WIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           W D AGR   R +++L  W G+R G G + P+GFPR  KF
Sbjct: 731 WFDPAGR--RRVQSELAEWTGRRAGSGRMAPRGFPRDNKF 768


>gi|110678712|ref|YP_681719.1| DNA topoisomerase IV subunit A [Roseobacter denitrificans OCh 114]
 gi|109454828|gb|ABG31033.1| DNA topoisomerase IV, A subunit [Roseobacter denitrificans OCh 114]
          Length = 765

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/753 (52%), Positives = 531/753 (70%), Gaps = 28/753 (3%)

Query: 22  LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGE 81
           LR AL ERYL YALSTI  RA+PD RDG KPVHRRI++AM E+ L     F+KSA+I G+
Sbjct: 16  LRRALGERYLTYALSTIMHRALPDARDGLKPVHRRILYAMRELRLSSTGGFRKSAKISGD 75

Query: 82  VIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAE 141
           V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEARMT VAE
Sbjct: 76  VMGNYHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDGDNPAASRYTEARMTAVAE 135

Query: 142 LILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICE 201
            +L+G++E+AVDFR+ Y+   +EPVV P++FPNLLANG+SGIAVGMAT+IP HN+ E+C+
Sbjct: 136 AMLEGLNENAVDFRENYDGTLTEPVVLPAQFPNLLANGSSGIAVGMATNIPPHNIAELCD 195

Query: 202 AALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEV 261
           A + LI  P+   + LL+Y+ GPDFPTGG+IVE  E+I ++YR G+GGFR+R RW VE++
Sbjct: 196 ACIHLIKTPDARDDTLLKYVPGPDFPTGGVIVEPPENIAQAYRTGKGGFRLRCRWEVEDL 255

Query: 262 GRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLD 321
           GRG W IVVTEIPYQVQKS+LIEKIAELI  K+IP+L D+RDESA+D+R+++ P++RS+D
Sbjct: 256 GRGQWQIVVTEIPYQVQKSKLIEKIAELIQTKKIPILADVRDESADDIRMIIEPRSRSVD 315

Query: 322 PDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQ 381
           PD+LM  +F   D+E RF LNMNVL  G  P+V  +  +L+ +L HR+EVL RRS+ R++
Sbjct: 316 PDVLMGMLFRNCDLEVRFSLNMNVLIDGVTPKVCSMKEVLQAFLDHRQEVLQRRSTHRLE 375

Query: 382 AIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPK-----------------------PVMV 418
            ID R+E+L+G +IA+LN+D +I IIR +D PK                       PV  
Sbjct: 376 KIDHRLEVLEGFIIAFLNLDRVIDIIRYDDDPKAALMAEDWGRDHPRALNEADYVPPVST 435

Query: 419 SRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACE 478
              +LTE Q +AILN+RLRSLR+LEE ++  E + L+ E+  ++ LL +   QW  I  +
Sbjct: 436 DDVTLTEVQAEAILNMRLRSLRRLEEMELVREQEALMEERAGLEDLLENPGLQWASITEQ 495

Query: 479 IREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSV 538
           +R  K+ F K  D G RRTTF E +  +   + +AMI++EPITVV S  GW+R++  H +
Sbjct: 496 LRATKKQFGKDWDGGARRTTFSEAAVIEDVPI-EAMIDREPITVVCSQMGWVRAMTGH-I 553

Query: 539 DLS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLN 597
           DL   L FK+GD  +   HA TTDR+L+  ++G+ YT+ A +L  GRG GE ++L+IDL 
Sbjct: 554 DLGRELKFKDGDGPRFIFHAETTDRLLVFGSNGRFYTVSASSLPGGRGMGEPLRLMIDLP 613

Query: 598 HNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVT 657
           +  +IVT   +    KLLV SS G+ F+V E++++A TR GK  L V  + +  +   V 
Sbjct: 614 NEAEIVTILTHAPDRKLLVASSAGDGFVVPEADVVAQTRTGKQVLNVRGDTRAMICKPVN 673

Query: 658 GDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGR 717
           GD VAVVGENRK+L+F ++ +PEM RGKGVRLQ YKDGG+SD   F   EGL+W+D AGR
Sbjct: 674 GDTVAVVGENRKVLVFPLEDLPEMGRGKGVRLQKYKDGGLSDATTFMRAEGLSWLDPAGR 733

Query: 718 SYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           +  RSE DL  W GKR   G + P+GFPR  KF
Sbjct: 734 T--RSETDLAEWTGKRATAGRMAPRGFPRDNKF 764


>gi|332560122|ref|ZP_08414444.1| DNA topoisomerase IV subunit A [Rhodobacter sphaeroides WS8N]
 gi|332277834|gb|EGJ23149.1| DNA topoisomerase IV subunit A [Rhodobacter sphaeroides WS8N]
          Length = 767

 Score =  811 bits (2095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/751 (52%), Positives = 531/751 (70%), Gaps = 25/751 (3%)

Query: 22  LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGE 81
           LR A+ ERYL YALSTI  RA+PD RDG KPVHRRI+ AM E+ L     F+KSA+I G+
Sbjct: 19  LRRAIGERYLTYALSTIMHRALPDARDGLKPVHRRILFAMRELRLSPTGGFRKSAKIAGD 78

Query: 82  VIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAE 141
           V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEAR+T +AE
Sbjct: 79  VMGNYHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDGDNPAASRYTEARLTPIAE 138

Query: 142 LILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICE 201
           L+++G+ E+AVDFR  Y+    EPVV P+ FPNLLANG SGIAVGMAT+IP HN+ E+ E
Sbjct: 139 LLMEGLAENAVDFRPNYDGTLEEPVVMPAAFPNLLANGASGIAVGMATNIPPHNLDELIE 198

Query: 202 AALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEV 261
             LALI +P I+ + L+  I GPDFPTGG+IVE +E I+E+YR GRGGFR+RA+W  E++
Sbjct: 199 GCLALIRDPAIADDTLVSLIPGPDFPTGGVIVEPKEQILEAYRTGRGGFRLRAKWQTEDL 258

Query: 262 GRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLD 321
           GRG+W IVVTEIPYQVQKS+LIE++AELI  K++P L D+RDESA+DVRIVL P+ R++D
Sbjct: 259 GRGTWQIVVTEIPYQVQKSKLIERLAELIQTKKVPALADVRDESADDVRIVLEPRARTVD 318

Query: 322 PDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQ 381
           P++LM  +F  SD+E RF LNMNVL  GR P+V  L  +L+ +L HRR+VL RRS  RM+
Sbjct: 319 PEMLMGMLFRNSDLEIRFSLNMNVLIDGRTPRVCSLKEVLRAFLDHRRDVLIRRSQHRME 378

Query: 382 AIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVS-----RFS-------------- 422
            ID R+E+L GL++A+LN+D +I IIR +  PK  +++     RF               
Sbjct: 379 KIDHRLEVLGGLIVAFLNLDRVIDIIRYDADPKRALMAESWGRRFKRANSEKDYVGPGPG 438

Query: 423 ---LTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEI 479
              L+E Q +AILN+RLRSLR+LEE ++ +E D LLAE+  +++L+ S + QW++I  ++
Sbjct: 439 PGDLSEVQAEAILNMRLRSLRRLEEMELLAERDALLAERADLEALIGSERLQWDRIGHDL 498

Query: 480 REVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVD 539
            E++++F K T  G RRT F E    ++  L +AMIE+EPITV+ S  GWIR++K H   
Sbjct: 499 GEIRKLFGKWTVAGARRTQFAEAGEVEEVPL-EAMIEREPITVICSQMGWIRAMKGHQPL 557

Query: 540 LSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHN 599
            +   FK+GD  +   HA TTDR+LL+ ++G+ YTL   +L  GRG GE ++L++DL + 
Sbjct: 558 DTEAKFKDGDGPRFLFHAETTDRLLLVGSNGRFYTLTGASLPGGRGMGEPVRLMVDLPNE 617

Query: 600 QDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGD 659
            +I   FV+    KLL+ SS G+ F+V   E++A TR GK  L +    +  +   V GD
Sbjct: 618 AEIHDIFVWRPAEKLLLASSAGDGFVVPSEEVLAQTRAGKAVLSMKEGVRTAVCRPVRGD 677

Query: 660 HVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSY 719
           HVAVVGENRKLL+F + ++PEM++GKGVRLQ YKDGG+SD I F+I  GL+W D AGR+ 
Sbjct: 678 HVAVVGENRKLLVFPVSELPEMAKGKGVRLQKYKDGGLSDAITFEIARGLSWKDPAGRT- 736

Query: 720 NRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
            R+E +L  W   R G G + P+GFPR  +F
Sbjct: 737 -RTETELAEWTAARAGAGKMAPRGFPRDNRF 766


>gi|85705044|ref|ZP_01036144.1| DNA topoisomerase IV subunit A [Roseovarius sp. 217]
 gi|85670366|gb|EAQ25227.1| DNA topoisomerase IV subunit A [Roseovarius sp. 217]
          Length = 768

 Score =  811 bits (2095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/770 (52%), Positives = 541/770 (70%), Gaps = 32/770 (4%)

Query: 9   SNTLVEENVK--AVS--LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEM 64
           S+ L + N++  AVS  LR A+ ERYL YALSTI  RA+PD RDG KPVHRRI++AM E+
Sbjct: 2   SDLLDDPNMQPEAVSEPLRRAIGERYLTYALSTIMHRALPDARDGLKPVHRRILYAMREL 61

Query: 65  GLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGD 124
            L     F+KSA+I G+V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD
Sbjct: 62  RLSSTGGFRKSAKISGDVMGNYHPHGDAAIYDAMARLAQDFAVRYPLVDGQGNFGNIDGD 121

Query: 125 SAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIA 184
           + AA RYTEARMT  AE +L G+ EDAVDFRD Y+    EP+V P+ FPNLLANG+SGIA
Sbjct: 122 NPAASRYTEARMTAFAEALLDGLAEDAVDFRDNYDGTLREPIVLPASFPNLLANGSSGIA 181

Query: 185 VGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYR 244
           VGMAT+IP HN+ E+ +A L LI +P+   E LL YI GPDFPTGG+IVE  ESI ++Y 
Sbjct: 182 VGMATNIPPHNIAELIDACLHLIKSPDARDETLLTYIPGPDFPTGGVIVEPPESIAQAYL 241

Query: 245 LGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDE 304
            GRG FR+R +W +E++GRG W IVVTEIPYQVQKS+LIE+IAELI  +++P+L D+RDE
Sbjct: 242 TGRGAFRLRCKWALEDLGRGQWQIVVTEIPYQVQKSKLIERIAELIQTRKVPILADVRDE 301

Query: 305 SAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEW 364
           SA+DVR+VL P+++++DP++LM  ++  S++E RF LNMNVL  G  P+V  L  +L+ +
Sbjct: 302 SADDVRLVLEPRSKNVDPEVLMGMMYRNSELELRFSLNMNVLIDGVTPKVCSLKEVLRAF 361

Query: 365 LAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPK---------- 414
           L  R+EVL RRS+ RM+ ID R+E+L+GL++A+LN+D +I IIR +D PK          
Sbjct: 362 LDFRQEVLLRRSAHRMEKIDHRLEVLEGLIVAFLNLDRVIDIIRYDDDPKAALMREDWGR 421

Query: 415 -------------PVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKI 461
                        P       LT+ Q +AILN+RLRSLR+LEE ++++E D L+ E+  +
Sbjct: 422 TVPRAMSEADYVSPPPTDEPGLTDVQAEAILNMRLRSLRRLEEMELRAERDALMQERAGL 481

Query: 462 DSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPIT 521
           + LL     QW  +A +++EV++ F K+  +G RRT F E    ++  L +AMI++EPIT
Sbjct: 482 EDLLEDVSLQWAAVADQLKEVQKTFGKTHPIGARRTKFAEAGSVEEVPL-EAMIDREPIT 540

Query: 522 VVISNRGWIRSLKSHSVDLS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNL 580
           VV S  GWIR++  H +DLS  L FK+GD+ +   HA TTDRIL+  ++G+ YT+ A NL
Sbjct: 541 VVCSQMGWIRAMTGH-LDLSRELKFKDGDAPRFMFHAETTDRILVFGSNGRFYTISASNL 599

Query: 581 LSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKT 640
             GRG GE ++L++DL +   IV   ++    KLLV S+ G+ FIV E E+IA TR GK 
Sbjct: 600 PGGRGMGEPLRLMVDLPNEAAIVDLLIHKPGRKLLVASTAGDGFIVPEDEVIAQTRSGKQ 659

Query: 641 FLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDV 700
            L +    +  +   VTGDHVA VG+NRK+L+FS+D++PE+ RGKGVRLQ YKDGG+SD 
Sbjct: 660 VLNLKDPARASVCRPVTGDHVACVGDNRKVLVFSLDELPELGRGKGVRLQKYKDGGLSDA 719

Query: 701 ICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
             F + EGLTW D AGR+  R+E++L  WLGKR G G + P+GFPR  +F
Sbjct: 720 TTFNLAEGLTWRDPAGRT--RTESNLEEWLGKRAGSGRMAPRGFPRDNRF 767


>gi|163733835|ref|ZP_02141277.1| DNA topoisomerase IV subunit A [Roseobacter litoralis Och 149]
 gi|161392946|gb|EDQ17273.1| DNA topoisomerase IV subunit A [Roseobacter litoralis Och 149]
          Length = 768

 Score =  810 bits (2093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/753 (52%), Positives = 530/753 (70%), Gaps = 28/753 (3%)

Query: 22  LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGE 81
           LR AL ERYL YALSTI  RA+PD RDG KPVHRRI++AM E+ L     F+KSA+I G+
Sbjct: 19  LRRALGERYLTYALSTIMHRALPDARDGLKPVHRRILYAMRELRLSSTGGFRKSAKISGD 78

Query: 82  VIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAE 141
           V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEARMT VAE
Sbjct: 79  VMGNYHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDGDNPAASRYTEARMTAVAE 138

Query: 142 LILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICE 201
            +L G++E+AVDFR+ Y+   +EPVV P++FPNLLANG+SGIAVGMAT+IP HN+ E+CE
Sbjct: 139 AMLDGLNENAVDFRENYDGTLTEPVVLPAQFPNLLANGSSGIAVGMATNIPPHNIAELCE 198

Query: 202 AALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEV 261
           A + LI  P+   + LL+Y+ GPDFPTGG+IVE  E+I ++YR G+GGFR+R RW VE++
Sbjct: 199 ACIHLIKTPDARDDTLLKYVPGPDFPTGGVIVEPPENIAQAYRTGKGGFRLRCRWEVEDL 258

Query: 262 GRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLD 321
           GRG W IVVTEIPYQVQKS+LIEKIAELI  K+IP+L D+RDESA+DVR+++ P++RS+D
Sbjct: 259 GRGQWQIVVTEIPYQVQKSKLIEKIAELIQTKKIPILADVRDESADDVRMIIEPRSRSVD 318

Query: 322 PDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQ 381
            D+LM  +F   D+E RF LNMNVL  G  P+V  +  +L+ +L HR+EVL RRS  R++
Sbjct: 319 ADVLMGMLFRYCDLELRFSLNMNVLIDGVTPKVCSMKEVLQAFLDHRQEVLQRRSQHRLE 378

Query: 382 AIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPK-----------------------PVMV 418
            ID R+E+L+G +IA+LN+D +I IIR +D PK                       PV  
Sbjct: 379 KIDHRLEVLEGFIIAFLNLDRVIDIIRYDDDPKAALMAEDWGKDHPRALNEADYVPPVPT 438

Query: 419 SRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACE 478
              +LTE Q +AILN+RLRSLR+LEE ++  E + L+AE+  ++ LL S + QW  I  +
Sbjct: 439 DDVTLTEVQAEAILNMRLRSLRRLEEMELVREQEALMAERAALEDLLESPELQWASITEQ 498

Query: 479 IREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSV 538
           +R  K+ F K  D G RRTTF E +  +   + +AMI++EPITVV S  GW+R++  H +
Sbjct: 499 LRATKKQFGKDWDGGARRTTFSEATVIEDVPI-EAMIDREPITVVCSEMGWVRAMTGH-I 556

Query: 539 DLS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLN 597
           DL+  L FK+GD  +   HA TTDR+L+  ++G+ YT+ A +L  GRG GE ++L+IDL 
Sbjct: 557 DLTRELKFKDGDGPRFIFHAETTDRLLVFGSNGRFYTVSASSLPGGRGMGEPLRLMIDLP 616

Query: 598 HNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVT 657
           +  +I+T   +    KLLV SS G+ F+V E++++A TR GK  L V  + +  +   V 
Sbjct: 617 NEAEIITILTHAPNRKLLVASSAGDGFVVPEADVVAQTRTGKQVLNVRGDTRAMICKAVQ 676

Query: 658 GDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGR 717
           GD VAVVGENRK+L+F + ++PEM RGKGVRLQ YKDGG+SD   F   +GL+W D AGR
Sbjct: 677 GDTVAVVGENRKVLVFPVGELPEMGRGKGVRLQKYKDGGLSDATTFMQADGLSWQDPAGR 736

Query: 718 SYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           +  RSE +L  W GKR   G + P+GFPR  KF
Sbjct: 737 T--RSETELAEWTGKRATAGRMAPRGFPRDNKF 767


>gi|221641196|ref|YP_002527458.1| DNA topoisomerase IV subunit A [Rhodobacter sphaeroides KD131]
 gi|221161977|gb|ACM02957.1| DNA topoisomerase IV subunit A [Rhodobacter sphaeroides KD131]
          Length = 767

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/751 (52%), Positives = 530/751 (70%), Gaps = 25/751 (3%)

Query: 22  LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGE 81
           LR A+ ERYL YALSTI  RA+PD RDG KPVHRRI+ AM E+ L     F+KSA+I G+
Sbjct: 19  LRRAIGERYLTYALSTIMHRALPDARDGLKPVHRRILFAMRELRLSPTGGFRKSAKIAGD 78

Query: 82  VIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAE 141
           V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEAR+T +AE
Sbjct: 79  VMGNYHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDGDNPAASRYTEARLTPIAE 138

Query: 142 LILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICE 201
           L+++G+ E+AVDFR  Y+    EPVV P+ FPNLLANG SGIAVGMAT+IP HN+ E+ E
Sbjct: 139 LLMEGLAENAVDFRPNYDGTLEEPVVMPAAFPNLLANGASGIAVGMATNIPPHNLDELIE 198

Query: 202 AALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEV 261
             LALI +P I+ + L+  I GPDFPTGG+IVE +E I+E+YR GRG FR+RA+W  E++
Sbjct: 199 GCLALIRDPAIADDTLVSLIPGPDFPTGGVIVEPKEQILEAYRTGRGAFRLRAKWQTEDL 258

Query: 262 GRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLD 321
           GRG+W IVVTEIPYQVQKS+LIE++AELI  K++P L D+RDESA+DVRIVL P+ R++D
Sbjct: 259 GRGTWQIVVTEIPYQVQKSKLIERLAELIQTKKVPALADVRDESADDVRIVLEPRARTVD 318

Query: 322 PDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQ 381
           P++LM  +F  SD+E RF LNMNVL  GR P+V  L  +L+ +L HRR+VL RRS  RM+
Sbjct: 319 PEMLMGMLFRNSDLEIRFSLNMNVLIDGRTPRVCSLKEVLRAFLDHRRDVLIRRSQHRME 378

Query: 382 AIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVS-----RFS-------------- 422
            ID R+E+L GL++A+LN+D +I IIR +  PK  +++     RF               
Sbjct: 379 KIDHRLEVLGGLIVAFLNLDRVIDIIRYDADPKRALMAESWERRFKRANSEKDYVGPGPG 438

Query: 423 ---LTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEI 479
              L+E Q +AILN+RLRSLR+LEE ++ +E D LLAE+  +++L+ S + QW++I  ++
Sbjct: 439 PGDLSEVQAEAILNMRLRSLRRLEEMELLAERDALLAERADLEALIGSERLQWDRIGHDL 498

Query: 480 REVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVD 539
            E++++F K T  G RRT F E    ++  L +AMIE+EPITV+ S  GWIR++K H   
Sbjct: 499 GEIRKLFGKWTVAGARRTQFAEAGEVEEVPL-EAMIEREPITVICSQMGWIRAMKGHQPL 557

Query: 540 LSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHN 599
            +   FK+GD  +   HA TTDR+LL+ ++G+ YTL   +L  GRG GE ++L++DL + 
Sbjct: 558 DTEAKFKDGDGPRFLFHAETTDRLLLVGSNGRFYTLTGASLPGGRGMGEPVRLMVDLPNE 617

Query: 600 QDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGD 659
            +I   FV+    KLL+ SS G+ F+V   E++A TR GK  L +    +  +   V GD
Sbjct: 618 AEIHDIFVWRPAEKLLLASSAGDGFVVPSEEVLAQTRAGKAVLSMKEGVRTAVCRPVRGD 677

Query: 660 HVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSY 719
           HVAVVGENRKLL+F + ++PEM++GKGVRLQ YKDGG+SD I F+I  GL+W D AGR+ 
Sbjct: 678 HVAVVGENRKLLVFPVSELPEMAKGKGVRLQKYKDGGLSDAITFEIARGLSWKDPAGRT- 736

Query: 720 NRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
            R+E +L  W   R G G + P+GFPR  +F
Sbjct: 737 -RTETELAEWTAARAGAGKMAPRGFPRDNRF 766


>gi|149201652|ref|ZP_01878626.1| DNA topoisomerase IV subunit A [Roseovarius sp. TM1035]
 gi|149144700|gb|EDM32729.1| DNA topoisomerase IV subunit A [Roseovarius sp. TM1035]
          Length = 768

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/770 (52%), Positives = 540/770 (70%), Gaps = 32/770 (4%)

Query: 9   SNTLVEENVK--AVS--LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEM 64
           S+ L + N++  AVS  LR A+ ERYL YALSTI  RA+PD RDG KPVHRRI++AM E+
Sbjct: 2   SDLLDDPNMQPEAVSEPLRRAIGERYLTYALSTIMHRALPDARDGLKPVHRRILYAMREL 61

Query: 65  GLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGD 124
            L     F+KSA+I G+V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD
Sbjct: 62  RLSSSGGFRKSAKISGDVMGNYHPHGDAAIYDAMARLAQDFAVRYPLVDGQGNFGNIDGD 121

Query: 125 SAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIA 184
           + AA RYTEARMT  AE +L G+ EDAVDFRD Y+    EPVV P+ FPNLLANG+SGIA
Sbjct: 122 NPAASRYTEARMTAFAEALLDGLAEDAVDFRDNYDGTLREPVVLPASFPNLLANGSSGIA 181

Query: 185 VGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYR 244
           VGMAT+IP HN+ E+ +A L LI +P+   + LL+YI GPDFPTGG+IVE  ESI ++Y 
Sbjct: 182 VGMATNIPPHNIAELIDACLHLIKSPDARDDTLLQYIPGPDFPTGGVIVEPPESIAQAYL 241

Query: 245 LGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDE 304
            GRG FR+R +W +E++GRG W IVVTEIPYQVQKS+LIE+IAELI  +++P+L D+RDE
Sbjct: 242 TGRGAFRLRCKWELEDLGRGQWQIVVTEIPYQVQKSKLIERIAELIQTRKVPILADVRDE 301

Query: 305 SAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEW 364
           SA+DVR+VL P+++++DP++LM  ++  S++E RF LNMNVL  G  P+V  L  +L+ +
Sbjct: 302 SADDVRLVLEPRSKNVDPEVLMGMMYRNSELEVRFSLNMNVLIDGVTPKVCSLKEVLRAF 361

Query: 365 LAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPK---------- 414
           L  R++VL RRS  RM+ ID R+E+L+GL+IA+LN+D +I IIR ++ PK          
Sbjct: 362 LDFRQQVLLRRSVHRMEKIDHRLEVLEGLIIAFLNLDRVIDIIRYDEDPKAALMREDWGR 421

Query: 415 -------------PVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKI 461
                        P   +   LTE Q +AILN+RLRSLR+LEE ++++E D L+AE+  +
Sbjct: 422 TVPRAMSEADYVPPPPTAEAGLTEVQAEAILNMRLRSLRRLEEMELRAERDTLMAERAGL 481

Query: 462 DSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPIT 521
           + LL+    QW  +A +++EVK+ F K+  +G RRT F E    +   L +AMI++EPIT
Sbjct: 482 EDLLDDVSLQWAAVADQLKEVKKTFGKTHPIGARRTQFAEAGSVEDVPL-EAMIDREPIT 540

Query: 522 VVISNRGWIRSLKSHSVDLS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNL 580
           VV S  GWIR++  H +DLS  L FK+GD  +   HA TTDRIL+  ++G+ YTL A NL
Sbjct: 541 VVCSQMGWIRAMTGH-LDLSRELKFKDGDGPRFMFHAETTDRILVFGSNGRFYTLSASNL 599

Query: 581 LSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKT 640
             GRG GE ++L++DL +   IV   ++    KLLV S  G+ FIV E E+IA TR GK 
Sbjct: 600 PGGRGMGEPLRLMVDLPNEAGIVDLLIHKPGRKLLVASDAGDGFIVPEEEVIAQTRSGKQ 659

Query: 641 FLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDV 700
            L +    +  +   VTGDHVA VG+NRK+L+F++D++PE+ RGKGVRLQ YKDGG+SD 
Sbjct: 660 VLNLKEPARALVCRPVTGDHVACVGDNRKVLVFALDELPELGRGKGVRLQKYKDGGLSDA 719

Query: 701 ICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
             F +  GLTW D AGR+  R+E++L  WLGKR G G + P+GFPR  +F
Sbjct: 720 TTFDLAAGLTWRDPAGRT--RTESNLEEWLGKRAGSGRMAPRGFPRDNRF 767


>gi|146278585|ref|YP_001168744.1| DNA topoisomerase IV subunit A [Rhodobacter sphaeroides ATCC 17025]
 gi|145556826|gb|ABP71439.1| DNA topoisomerase IV subunit A [Rhodobacter sphaeroides ATCC 17025]
          Length = 767

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/751 (52%), Positives = 528/751 (70%), Gaps = 25/751 (3%)

Query: 22  LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGE 81
           LR A+ ERYL YALSTI  RA+PD RDG KPVHRRI+ AM E+ L     F+KSA+I G+
Sbjct: 19  LRRAIGERYLTYALSTIMHRALPDARDGLKPVHRRILFAMRELRLSPTGGFRKSAKIAGD 78

Query: 82  VIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAE 141
           V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEAR+T +AE
Sbjct: 79  VMGNYHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDGDNPAASRYTEARLTPIAE 138

Query: 142 LILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICE 201
           L+++G+ E+AVDFR  Y+    EPVV P+ FP+LLANG SGIAVGMAT+IP HN+ E+ E
Sbjct: 139 LLMEGLAENAVDFRPNYDGTLEEPVVMPAAFPHLLANGASGIAVGMATNIPPHNLDELIE 198

Query: 202 AALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEV 261
             LA+I +P I+ E L+  I GPDFPTGG+IVE +ESI+E YR GRG FR+RA+W  E++
Sbjct: 199 GCLAMIRHPAIADEALVGLIPGPDFPTGGVIVEPKESILEGYRTGRGAFRLRAKWQTEDL 258

Query: 262 GRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLD 321
           GRG+W IVVTEIPYQVQKS+LIE++AELI  K++P L D+RDESA+DVRIVL P+ R++D
Sbjct: 259 GRGTWQIVVTEIPYQVQKSKLIERLAELIQTKKVPALADVRDESADDVRIVLEPRARTVD 318

Query: 322 PDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQ 381
           P++LM  +F  SD+E RF +NMNVL  GR P+V  L  +L+ +L HRREVL RRS  RM+
Sbjct: 319 PEMLMGMLFRNSDLEVRFSMNMNVLIDGRTPKVCSLKEVLRAFLDHRREVLIRRSEHRME 378

Query: 382 AIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVS-----RFS-------------- 422
            ID R+E+L GL++A+LN+D +I IIR +++PK  +++     +F               
Sbjct: 379 KIDHRLEVLGGLIVAFLNLDRVIDIIRYDEEPKRALMAETWGRKFKRATSEKDYVGPGAG 438

Query: 423 ---LTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEI 479
              LTE Q +AILN+RLRSLR+LEE ++ +E D L AE+  +  L+ S  +QW +I  ++
Sbjct: 439 PGELTEVQAEAILNMRLRSLRRLEEMELLAERDALTAERADLADLVGSEPRQWERIGADL 498

Query: 480 REVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVD 539
            E++++F K T  G RRT F E    ++  L +AMIE+EPITV+ S  GWIR++K H   
Sbjct: 499 GEIRKLFGKWTVAGARRTQFAEAGEVEEVPL-EAMIEREPITVICSKMGWIRAMKGHQPL 557

Query: 540 LSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHN 599
            S + FK+GD  +   HA TTDR+LL+ ++G+ YTL   +L  GRG GE ++L++DL + 
Sbjct: 558 GSEVKFKDGDGPRFMFHAETTDRLLLVGSNGRFYTLTGASLPGGRGMGEPVRLMVDLPNE 617

Query: 600 QDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGD 659
            +I    ++    KLL+ SS G+ F+V   E++A TR GK  L +       +   + GD
Sbjct: 618 AEIADLIIWRPGEKLLLASSAGDGFVVPSEEVLAQTRAGKAVLSMKDGVTTAVCRPIRGD 677

Query: 660 HVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSY 719
           HVAVVG+NRKLL+F + ++PEM+RGKGVRLQ YKDGG+SD I F++  GL+W D AGR+ 
Sbjct: 678 HVAVVGQNRKLLVFPLSELPEMARGKGVRLQKYKDGGLSDAITFELARGLSWKDPAGRT- 736

Query: 720 NRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
            R+E DL  W G R G G + P+GFPR  +F
Sbjct: 737 -RTETDLAEWTGARAGAGKMAPRGFPRDNRF 766


>gi|294675703|ref|YP_003576318.1| DNA topoisomerase IV subunit A [Rhodobacter capsulatus SB 1003]
 gi|294474523|gb|ADE83911.1| DNA topoisomerase IV, A subunit [Rhodobacter capsulatus SB 1003]
          Length = 767

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/755 (51%), Positives = 535/755 (70%), Gaps = 12/755 (1%)

Query: 5   NISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEM 64
            +S+ +        A  L  A+ ERYL YALSTI  RA+PD RDG KPVHRRI+ AM E+
Sbjct: 15  TMSSDDETPTSATHAEPLSRAIGERYLTYALSTIMHRALPDARDGLKPVHRRILFAMREL 74

Query: 65  GLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGD 124
            L     F+KSA+I G+V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGN+GNIDGD
Sbjct: 75  KLSSTGGFRKSAKISGDVMGNYHPHGDAAIYDAMARLAQDFAMRYPLVDGQGNYGNIDGD 134

Query: 125 SAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIA 184
             AA RYTEAR+   AE +L+G+ ED+VDFR  Y+   +EPVV P+ FPNLLANG SGIA
Sbjct: 135 GPAASRYTEARLASPAEALLEGLAEDSVDFRPNYDGTLTEPVVLPAAFPNLLANGASGIA 194

Query: 185 VGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYR 244
           VGMAT++P HN+ E+ +  LA+I +P I   +L++ I GPDFPTGG+IVE + +I+E+YR
Sbjct: 195 VGMATNVPPHNLDELVDGCLAMIADPAIEEARLVDLIPGPDFPTGGVIVEPKANILEAYR 254

Query: 245 LGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDE 304
            GRG FR+RARW +E++GRG W IVVTEIPYQVQK++LIE++AELI  K++P L D+RDE
Sbjct: 255 TGRGAFRLRARWALEDLGRGQWQIVVTEIPYQVQKAKLIERLAELIETKKVPALADVRDE 314

Query: 305 SAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEW 364
           SAEDVRIVL P+ R+++P  LM  +F  S++E RF LNMNVL  GRVP+V  L  +L+ +
Sbjct: 315 SAEDVRIVLEPRARTVEPAQLMGMLFRNSELEVRFSLNMNVLIDGRVPKVCSLKEVLRAF 374

Query: 365 LAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSR---- 420
           L HRREVL RRS  R++ I  R+E+L+G +IA+LN+D +I IIR ED PK  +++     
Sbjct: 375 LDHRREVLCRRSRHRLEKIANRLEVLEGYIIAFLNLDRVIEIIRTEDDPKAALMAENWAA 434

Query: 421 -----FSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQI 475
                  LTE Q +AILN+RLRSLR+LEE ++++E D+LL E+  +++LL S   QW QI
Sbjct: 435 EAGAVVHLTEVQAEAILNMRLRSLRRLEEMELRAERDDLLKERAGLEALLASEVAQWAQI 494

Query: 476 ACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKS 535
           + E+ ++++ + K+T +G RRT F E    ++  + +AMIE+EPITV++S  GW+R++K 
Sbjct: 495 SSELEDLRKTWGKATKIGARRTDFAEAGEVEEVPI-EAMIEREPITVILSKMGWVRAMKG 553

Query: 536 HSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLID 595
           H    + + FK+GD    ALHA TTDRI+L+ ++G+A+TL   NL  GRG GE ++L+++
Sbjct: 554 HQPLDAEVKFKDGDGQAFALHAETTDRIVLMGSNGRAWTLLGANLPGGRGMGEPVRLMLE 613

Query: 596 LNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVK 655
           + +  ++    V     K L+ SS+G+ FI    E+IA+TR GK  L +S   + ++   
Sbjct: 614 MPNEVEVTHVLVPKPGEKYLLASSEGDGFIAPAEELIASTRTGKQVLNMSDGVRTRVCRV 673

Query: 656 VTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSA 715
            +GD VA VGENRKLL+F ++++PEM+RGKGVRLQ +KDGG+SD I F++ EGL+W D A
Sbjct: 674 ASGDAVACVGENRKLLVFPLEELPEMARGKGVRLQKFKDGGLSDAITFRLAEGLSWKDPA 733

Query: 716 GRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           GR+  R+E DL  WLGKR   G + P+GFPR  +F
Sbjct: 734 GRT--RTEADLSEWLGKRASAGRMAPRGFPRDNRF 766


>gi|77462241|ref|YP_351745.1| DNA topoisomerase IV subunit A [Rhodobacter sphaeroides 2.4.1]
 gi|77386659|gb|ABA77844.1| DNA topoisomerase IV subunit A [Rhodobacter sphaeroides 2.4.1]
          Length = 767

 Score =  808 bits (2087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/751 (52%), Positives = 529/751 (70%), Gaps = 25/751 (3%)

Query: 22  LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGE 81
           LR A+ ERYL YALSTI  RA+PD RDG KPVHRRI+ AM E+ L     F+KSA+I G+
Sbjct: 19  LRRAIGERYLTYALSTIMHRALPDARDGLKPVHRRILFAMRELRLSPTGGFRKSAKIAGD 78

Query: 82  VIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAE 141
           V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEAR+T +AE
Sbjct: 79  VMGNYHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDGDNPAASRYTEARLTPIAE 138

Query: 142 LILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICE 201
           L+++G+ E+AVDFR  Y+    EPVV P+ FPNLLANG SGIAVGMAT+IP HN+ E+ E
Sbjct: 139 LLMEGLAENAVDFRPNYDGTLEEPVVMPAAFPNLLANGASGIAVGMATNIPPHNLDELIE 198

Query: 202 AALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEV 261
             LALI +P I+ + L+  I GPDFPTGG+IVE +E I+E+YR GRG FR+RA+W  E++
Sbjct: 199 GCLALIRDPAIADDTLVSLIPGPDFPTGGVIVEPKEQILEAYRTGRGAFRLRAKWQTEDL 258

Query: 262 GRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLD 321
           GRG+W IVVTEIPYQVQKS+LIE++AELI  K++P L D+RDESA+DVRIVL P+ R++D
Sbjct: 259 GRGTWQIVVTEIPYQVQKSKLIERLAELIQTKKVPALADVRDESADDVRIVLEPRARTVD 318

Query: 322 PDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQ 381
           P++LM  +F  SD+E RF LNMNVL  GR P+V  L  +L+ +L HRR VL RRS  RM+
Sbjct: 319 PEMLMGMLFRNSDLEIRFSLNMNVLIDGRTPRVCSLKEVLRAFLDHRRNVLIRRSQHRME 378

Query: 382 AIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVS-----RFS-------------- 422
            ID R+E+L GL++A+LN+D +I IIR +  PK  +++     RF               
Sbjct: 379 KIDHRLEVLGGLIVAFLNLDRVIDIIRYDADPKRALMAESWGRRFKRANSEKDYVGPGPG 438

Query: 423 ---LTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEI 479
              L+E Q +AILN+RLRSLR+LEE ++ +E D LLAE+  +++L+ S + QW++I  ++
Sbjct: 439 PGDLSEVQAEAILNMRLRSLRRLEEMELLAERDALLAERADLEALIGSERLQWDRIGHDL 498

Query: 480 REVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVD 539
            E++++F K T  G RRT F E    ++  L +AMIE+EPITV+ S  GWIR++K H   
Sbjct: 499 GEIRKLFGKWTVAGARRTQFAEAGEVEEVPL-EAMIEREPITVICSQMGWIRAMKGHQPL 557

Query: 540 LSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHN 599
            +   FK+GD  +   HA TTDR+LL+ ++G+ YTL   +L  GRG GE ++L++DL + 
Sbjct: 558 DTEAKFKDGDGPRFLFHAETTDRLLLVGSNGRFYTLTGASLPGGRGMGEPVRLMVDLPNE 617

Query: 600 QDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGD 659
            +I   FV+    KLL+ SS G+ F+V   E++A TR GK  L +    +  +   V GD
Sbjct: 618 AEIHDIFVWRPAEKLLLASSAGDGFVVPSEEVLAQTRAGKAVLSMKEGVRTAVCRPVRGD 677

Query: 660 HVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSY 719
           HVAVVGENRKLL+F + ++PEM++GKGVRLQ YKDGG+SD I F+I  GL+W D AGR+ 
Sbjct: 678 HVAVVGENRKLLVFPVSELPEMAKGKGVRLQKYKDGGLSDAITFEIARGLSWKDPAGRT- 736

Query: 720 NRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
            R+E +L  W   R G G + P+GFPR  +F
Sbjct: 737 -RTETELAEWTAARAGAGKMAPRGFPRDNRF 766


>gi|126461103|ref|YP_001042217.1| DNA topoisomerase IV subunit A [Rhodobacter sphaeroides ATCC 17029]
 gi|126102767|gb|ABN75445.1| DNA topoisomerase IV subunit A [Rhodobacter sphaeroides ATCC 17029]
          Length = 767

 Score =  808 bits (2087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/751 (52%), Positives = 530/751 (70%), Gaps = 25/751 (3%)

Query: 22  LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGE 81
           LR A+ ERYL YALSTI  RA+PD RDG KPVHRRI+ AM E+ L     F+KSA+I G+
Sbjct: 19  LRRAIGERYLTYALSTIMHRALPDARDGLKPVHRRILFAMRELRLSPTGGFRKSAKIAGD 78

Query: 82  VIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAE 141
           V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEAR+T +AE
Sbjct: 79  VMGNYHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDGDNPAASRYTEARLTPIAE 138

Query: 142 LILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICE 201
           L+++G+ E+AVDFR  Y+    EPVV P+ FPNLLANG SGIAVGMAT+IP HN+ E+ E
Sbjct: 139 LLMEGLAENAVDFRPNYDGTLEEPVVMPAAFPNLLANGASGIAVGMATNIPPHNLDELIE 198

Query: 202 AALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEV 261
             LALI +P I+ + L+  I GPDFPTGG+IVE +E I+E+YR GRG FR+RA+W  E++
Sbjct: 199 GCLALIRDPAIADDTLVSLIPGPDFPTGGVIVEPKEQILEAYRTGRGAFRLRAKWQTEDL 258

Query: 262 GRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLD 321
           GRG+W IVVTEIPYQVQKS+LIE++AELI  K++P L D+RDESA+DVRIVL P+ R++D
Sbjct: 259 GRGTWQIVVTEIPYQVQKSKLIERLAELIQTKKVPALADVRDESADDVRIVLEPRARTVD 318

Query: 322 PDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQ 381
           P++LM  +F  SD+E RF LNMNVL  GR P+V  L  +L+ +L HRR+VL RRS  RM+
Sbjct: 319 PEMLMGMLFRNSDLEIRFSLNMNVLIDGRTPRVCSLKEVLRAFLDHRRDVLIRRSQHRME 378

Query: 382 AIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVS-----RFS-------------- 422
            ID R+E+L GL++A+LN+D +I IIR +  PK  +++     +F               
Sbjct: 379 KIDHRLEVLGGLIVAFLNLDRVIDIIRYDADPKRALMAESWGRKFKRANSEKDYVGPGPG 438

Query: 423 ---LTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEI 479
              L+E Q +AILN+RLRSLR+LEE ++ +E D LLAE+  +++L+ S + QW++I  ++
Sbjct: 439 PGDLSEVQAEAILNMRLRSLRRLEEMELLAERDALLAERADLEALIGSERLQWDRIGHDL 498

Query: 480 REVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVD 539
            E++++F K T  G RRT F E    ++  L +AMIE+EPITV+ S  GWIR++K H   
Sbjct: 499 GEIRKLFGKWTVAGARRTQFAEAGEVEEVPL-EAMIEREPITVICSQMGWIRAMKGHQPL 557

Query: 540 LSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHN 599
            +   FK+GD  +   HA TTDR+LL+ ++G+ YTL   +L  GRG GE ++L++DL + 
Sbjct: 558 DTEAKFKDGDGPRFLFHAETTDRLLLVGSNGRFYTLTGASLPGGRGMGEPVRLMVDLPNE 617

Query: 600 QDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGD 659
            +I   FV+    KLL+ SS G+ F+V   E++A TR GK  L +    +  +   V GD
Sbjct: 618 AEIHDIFVWRPAEKLLLASSAGDGFVVPSEEVLAQTRAGKAVLSMKEGVRTAVCRPVRGD 677

Query: 660 HVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSY 719
           HVAVVGENRKLL+F + ++PEM++GKGVRLQ YKDGG+SD I F+I  GL+W D AGR+ 
Sbjct: 678 HVAVVGENRKLLVFPVSELPEMAKGKGVRLQKYKDGGLSDAITFEIARGLSWKDPAGRT- 736

Query: 720 NRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
            R+E +L  W   R G G + P+GFPR  +F
Sbjct: 737 -RTETELAEWTAARAGAGKMAPRGFPRDNRF 766


>gi|254487742|ref|ZP_05100947.1| DNA topoisomerase IV, A subunit [Roseobacter sp. GAI101]
 gi|214044611|gb|EEB85249.1| DNA topoisomerase IV, A subunit [Roseobacter sp. GAI101]
          Length = 773

 Score =  808 bits (2086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/775 (51%), Positives = 542/775 (69%), Gaps = 34/775 (4%)

Query: 5   NISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEM 64
           +I++ + L   NV    LR AL +RYL YALSTI  RA+PD RDG KPVHRRI++AM E+
Sbjct: 3   DITDPSDLDPRNVSE-PLRLALGDRYLTYALSTIMHRALPDARDGLKPVHRRILYAMREL 61

Query: 65  GLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGD 124
            L     F+KSA+I G+V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD
Sbjct: 62  RLSSTGGFRKSAKISGDVMGNYHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDGD 121

Query: 125 SAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIA 184
           + AA RYTEARMT VAE +L+G++E+AVDFR+ Y+   +EPVV P++FPNLLANG+SGIA
Sbjct: 122 NPAASRYTEARMTAVAEAMLEGLNENAVDFRENYDGTLTEPVVLPAQFPNLLANGSSGIA 181

Query: 185 VGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYR 244
           VGMAT+IP HN+ E+ +A + LI  PE   + LL ++ GPDFPTGGIIVE  E+I  +YR
Sbjct: 182 VGMATNIPPHNISELVDACIHLIKTPEARDDTLLNFVPGPDFPTGGIIVEPPENIANAYR 241

Query: 245 LGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDE 304
            G+GGFR+R RW VE++GRG W IV+TEIPYQVQKS+LIEKIAELI  K+IP+L D+RDE
Sbjct: 242 TGKGGFRLRCRWNVEDLGRGVWQIVITEIPYQVQKSKLIEKIAELIQLKKIPILGDVRDE 301

Query: 305 SAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEW 364
           SAED+R+++ P+++++DP++LM  ++  SD+E RF LNMNVL  G  P+V  +  +L+ +
Sbjct: 302 SAEDIRLIIEPRSKNVDPEVLMGMLYRSSDLEVRFSLNMNVLIDGLTPKVCSMKEVLRAF 361

Query: 365 LAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPK---------- 414
           L HRREVL RRS+ R++ ID R+E+L+G +IA+LN+D +I IIR +  PK          
Sbjct: 362 LDHRREVLQRRSAHRLEKIDHRLEVLEGFIIAFLNLDRVIDIIRYDADPKAALMAEDWGK 421

Query: 415 -------------PVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKI 461
                        P   +  SLTE Q DAILN+RLRSLR+LEE ++  E   L+AE+  +
Sbjct: 422 KHSRATDESDYVPPAPTTENSLTEIQADAILNMRLRSLRRLEEMELLREQSELMAERAGL 481

Query: 462 DSLLNSGKQQWNQIACEIREVKEIFSK-----STDLGRRRTTFCEVSRADKATLQQAMIE 516
           + LL+S   QW+ I  ++R  K+ F K       ++G RRTTF E    +   L +AMI+
Sbjct: 482 EDLLDSEALQWDSIIEQLRATKKQFGKDWKLDGVNVGLRRTTFAEAGEIEDVPL-EAMID 540

Query: 517 KEPITVVISNRGWIRSLKSHSVDLS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTL 575
           +EPITVV S  GWIR++  H +DL+  L FK+GD  +   HA TTDR+L+  ++G+ YT+
Sbjct: 541 REPITVVCSEMGWIRAMTGH-IDLNRELKFKDGDGPRFVFHAETTDRLLVFGSNGRFYTI 599

Query: 576 PAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANT 635
            A +L  GRG GE ++L++DL ++  IV  F++    KLLV SS G+ F+V E E++A T
Sbjct: 600 GAVSLPGGRGMGEPLRLMVDLPNDVQIVDIFIHKPGRKLLVASSAGDGFVVPEDEVLAQT 659

Query: 636 RKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDG 695
           R GK  L V  + K  +   + G+ VAVVGENRK+L+F +D++PEM RGKGVRLQ YKDG
Sbjct: 660 RSGKQVLNVRGDAKAMICAPIKGEAVAVVGENRKVLVFGLDELPEMGRGKGVRLQKYKDG 719

Query: 696 GISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           G+SD   F + EGL+W+D AGR+  R+E+DL  W GKR   G + P+GFPR  +F
Sbjct: 720 GMSDATTFTLSEGLSWLDPAGRT--RTESDLTEWTGKRASAGRMAPRGFPRDNRF 772


>gi|159042777|ref|YP_001531571.1| DNA topoisomerase IV subunit A [Dinoroseobacter shibae DFL 12]
 gi|157910537|gb|ABV91970.1| DNA topoisomerase IV, A subunit [Dinoroseobacter shibae DFL 12]
          Length = 777

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/751 (52%), Positives = 524/751 (69%), Gaps = 23/751 (3%)

Query: 22  LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGE 81
           LR A+  RYL YALSTI  RA+PD RDG KPVHRRI++AM E+ L     F+KSA+I G+
Sbjct: 27  LRRAIGARYLQYALSTIMHRALPDARDGLKPVHRRILYAMRELRLSATGGFRKSAKISGD 86

Query: 82  VIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAE 141
           V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEAR+T  AE
Sbjct: 87  VMGNYHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDGDNPAASRYTEARLTAAAE 146

Query: 142 LILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICE 201
            +++G+ E+AVDFRD Y+   +EP V P+ FPNLLANG+SGIAVGMAT+IP HN+ E+ +
Sbjct: 147 ALMEGLAENAVDFRDNYDGTLTEPEVLPAAFPNLLANGSSGIAVGMATNIPPHNLHELID 206

Query: 202 AALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEV 261
             L LI  P    E LLE I GPDFPTGG+IVE +ESI ++Y  GRG FR+RARW  E++
Sbjct: 207 GCLHLIRAPNARDETLLEMIPGPDFPTGGVIVEPKESIAQAYATGRGAFRLRARWAREDL 266

Query: 262 GRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLD 321
           GRG W IV+TEIPYQVQKS+LIEKIA+LI  K++P+L DIRDESA+DVRI+L P+++++D
Sbjct: 267 GRGQWQIVITEIPYQVQKSKLIEKIADLIQTKKVPILADIRDESADDVRIILEPRSKNVD 326

Query: 322 PDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQ 381
           P++LM ++F LS++ETRF LNMNVL  GR P+V  L  +L+ +L HRR+VL RRS  R+ 
Sbjct: 327 PEVLMGTLFRLSELETRFSLNMNVLIDGRTPKVCSLREVLRAFLDHRRDVLGRRSRHRLA 386

Query: 382 AIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMV----------------------S 419
            ID R+E+L+G L+A+LN+D +I IIR ++ PK  ++                       
Sbjct: 387 KIDHRLEVLEGFLVAFLNLDRVIDIIRYDEDPKAALMREDWSLKHVRATDEADYKTPAPG 446

Query: 420 RFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEI 479
              LTE Q +AILN+RLRSLR+LEE ++ SE D L+AE+ +++ LL     QW +IA E+
Sbjct: 447 EGELTEVQAEAILNMRLRSLRRLEEMELISERDALMAERAELEDLLADEALQWARIADEL 506

Query: 480 REVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVD 539
           REV++ F K T LG+RRT F   +   + +L+  MIE+EPITVV S  GWIR++K H   
Sbjct: 507 REVRKQFGKGTALGKRRTDFAVATEMAEVSLED-MIEREPITVVCSKMGWIRAMKGHVAL 565

Query: 540 LSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHN 599
             AL FK+GD  +   HA TTD++L    +G+ YTL    L  GRG GE I+L++DL + 
Sbjct: 566 DQALKFKDGDEGRFIFHAETTDKLLAFGANGRFYTLSCAALPGGRGMGEPIRLMVDLPNE 625

Query: 600 QDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGD 659
            ++V  F++    +L+V S  G+ FIV E+E++A TR GK  L V S  +  L   V GD
Sbjct: 626 AELVDLFLHVPGRRLIVASDAGDGFIVPETEVLAQTRTGKQVLNVKSPHRALLARPVAGD 685

Query: 660 HVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSY 719
            +A VGENRKLL+F+ D++PEM RGKGVRLQ YKDGG+SD+  F   +GL W+D+ GR+ 
Sbjct: 686 AIAAVGENRKLLVFAADELPEMGRGKGVRLQKYKDGGLSDLRSFDRAQGLQWLDAGGRTR 745

Query: 720 NRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
             ++ +L  W GKR G G + P+GFPR  KF
Sbjct: 746 TVADPELAEWSGKRAGTGRMAPRGFPRDNKF 776


>gi|84515184|ref|ZP_01002547.1| DNA topoisomerase IV subunit A [Loktanella vestfoldensis SKA53]
 gi|84511343|gb|EAQ07797.1| DNA topoisomerase IV subunit A [Loktanella vestfoldensis SKA53]
          Length = 767

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/756 (52%), Positives = 536/756 (70%), Gaps = 32/756 (4%)

Query: 21  SLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVG 80
           SLR A+ +RYL YALSTI  RA+PD RDG KPVHRRI++AMS + L     F KSA+I G
Sbjct: 17  SLRSAIGDRYLTYALSTIMHRALPDARDGLKPVHRRILYAMSRLRLSPTGGFLKSAKISG 76

Query: 81  EVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVA 140
           + +G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEARMT  A
Sbjct: 77  DTMGDFHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDGDNPAASRYTEARMTAAA 136

Query: 141 ELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEIC 200
           E +L+G+ EDAVDFRD Y+   +EP V P+ FPNLLANG+SGIAVGMAT+IP HN+ E+ 
Sbjct: 137 EALLEGLSEDAVDFRDNYDGRLTEPSVLPASFPNLLANGSSGIAVGMATNIPPHNLHELI 196

Query: 201 EAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEE 260
           +A L LI +P  + + LL +I+GPDFPTGG+IVE  E++ E+YR GRG FR+RA+W VE+
Sbjct: 197 DACLHLIKSPGAADDSLLTHILGPDFPTGGVIVEPPENMAEAYRTGRGSFRLRAKWEVED 256

Query: 261 VGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSL 320
           +GRG W IVVTEIPYQVQKS+LIEK+AE+I  K++PLL D+RDESAEDVR+VL P+ RS+
Sbjct: 257 LGRGQWQIVVTEIPYQVQKSKLIEKLAEVIQTKKVPLLADVRDESAEDVRVVLEPRARSV 316

Query: 321 DPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRM 380
           DP++LM  +F  SD+E RF LNMNVL  G  P+V  L  +L+ +L HRR+VL RRS  R+
Sbjct: 317 DPEMLMGMLFRNSDLEIRFSLNMNVLIDGLTPKVCSLKEVLRAFLDHRRDVLVRRSRHRL 376

Query: 381 QAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVS--------------------- 419
             ID R+E+L+G +IA+L++D +I IIR +D PK  +++                     
Sbjct: 377 GKIDHRLEVLEGFIIAFLHLDRVIDIIRYDDDPKSALMAEDWAHPHIRATSEKDYVGPKA 436

Query: 420 ---RFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIA 476
                +LTE Q +AILN+RLRSLR+LEE ++ +E D L AE++ I +LL     QW +IA
Sbjct: 437 TDPEIALTEVQAEAILNMRLRSLRRLEELELIAERDALRAERQGIMALLADEALQWARIA 496

Query: 477 CEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQ-QAMIEKEPITVVISNRGWIRSLKS 535
            E+RE ++ F +++  G RRT F     AD A +  +AMI++EPITVV S  GW+R++  
Sbjct: 497 DELRETRKQFGRTSPGGARRTQFALA--ADVAYVPIEAMIDREPITVVCSQMGWVRAMTG 554

Query: 536 HSVDLSA-LHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLI 594
           H +DL+  L FK+GD+ +   HA TTD++L+   +G+ YT+ A NL  GRG GE ++L+I
Sbjct: 555 H-IDLTRDLKFKDGDAARFTFHAETTDKLLVFGANGRFYTVSAANLPGGRGMGEPLRLMI 613

Query: 595 DLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVV 654
           DL +  +I+   ++    KLLV S+ GN F+V E E++A TR GK  L + +    +L  
Sbjct: 614 DLPNEAEIIDILIHKPGEKLLVASTDGNGFVVPEVEVVAQTRAGKQVLNLGA-STARLCK 672

Query: 655 KVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDS 714
           ++ GDHVAVVGENRK+L+F ID++PEM+RGKGVRLQ YKDGG+SD   F + +GLTW+D 
Sbjct: 673 RIAGDHVAVVGENRKVLVFGIDELPEMTRGKGVRLQKYKDGGLSDATTFTLADGLTWLDP 732

Query: 715 AGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           AGR+  R++++L  W+GKR   G + P+GFPR  +F
Sbjct: 733 AGRT--RTQSELDEWIGKRATAGRMAPRGFPRDNRF 766


>gi|209964783|ref|YP_002297698.1| DNA topoisomerase IV subunit A [Rhodospirillum centenum SW]
 gi|209958249|gb|ACI98885.1| DNA topoisomerase IV, A subunit, putative [Rhodospirillum centenum
           SW]
          Length = 757

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/743 (53%), Positives = 531/743 (71%), Gaps = 20/743 (2%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIG 84
           AL ERYL+YALSTI  R++PD+RDG KPVHRR+++AMS++ L+     KKSAR+VG+VIG
Sbjct: 16  ALGERYLSYALSTIVSRSLPDVRDGLKPVHRRLLYAMSQLRLEPTTPPKKSARVVGDVIG 75

Query: 85  KLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELIL 144
           K HPHGDQSVYD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTEAR+T+VA+ +L
Sbjct: 76  KFHPHGDQSVYDALVRLAQEFAARYPLVEGQGNFGNIDGDNAAAMRYTEARLTEVAKAML 135

Query: 145 QGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAAL 204
            G+DEDA DFR TY+ E  EP+V P+ FPNLLANG++GIAVGMAT+IP HNV EIC  AL
Sbjct: 136 AGIDEDATDFRPTYDGEGEEPMVLPAAFPNLLANGSAGIAVGMATNIPPHNVGEIC-GAL 194

Query: 205 ALIDNPE----------ISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
            LI   E          +++E+L+ +I GPDFPTGG++VESRE+I+E+YR GRG FR RA
Sbjct: 195 NLIIERELLPAPDKRRPVTVEELVSWIPGPDFPTGGVLVESRENILEAYRTGRGAFRTRA 254

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLF 314
           RW  E + +G+W I+VT+IPYQVQKSRL+EKIAEL+  K++PLLED+RDESAED+R+VL 
Sbjct: 255 RWQKEPLAQGTWQIIVTQIPYQVQKSRLVEKIAELLAEKKLPLLEDVRDESAEDIRLVLV 314

Query: 315 PKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSM---GRVPQVMPLDGILKEWLAHRREV 371
           PK+R++DPD++ME +F  +D+ETRF +NMNVL     G VP+VM L  +L+ +L HR+EV
Sbjct: 315 PKSRNVDPDVMMEQMFRNTDLETRFSMNMNVLDAREGGLVPRVMTLYEVLRAFLEHRQEV 374

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           L RRS  R+  ID R+E+L G LIAYLNIDE+I IIR ED+PK  +++RFSLT+ Q +AI
Sbjct: 375 LLRRSRHRLGEIDHRLEVLGGYLIAYLNIDEVIRIIREEDEPKRELMARFSLTDVQAEAI 434

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           LN+RLRSLRKLEE++I+ E D L  E+  +  LL  G ++W  I+ E+ E+   F ++T 
Sbjct: 435 LNMRLRSLRKLEEFEIRKENDALTKERGVLVGLLEDGHKRWKAISKEVAEMDRKFGRTTA 494

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSH--SVDLSALHFKEGD 549
           LG RRT   E  + D A   +AMIE+EP+TV +S +GWIR+++ H  + +++   +K+GD
Sbjct: 495 LGERRTLIGEPPK-DLAVPAEAMIEREPVTVFLSEKGWIRTVRGHQSAQEVAGTKYKDGD 553

Query: 550 SLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYD 609
             +  LHA TTDR+LL +  GK YTL    L  GRG GE ++L++DL   + IV    + 
Sbjct: 554 RERFVLHAETTDRLLLFAGSGKFYTLGVDRLPGGRGFGEPVRLMVDLGEAE-IVALLRHQ 612

Query: 610 STCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRK 669
              +L+V S+ G  F VE  +++A TR GK  L  +      L V   GD VAV+G NRK
Sbjct: 613 PGQRLVVASADGRGFQVEADDVVAQTRAGKQVLTPADGAAAVLAVPAEGDAVAVIGNNRK 672

Query: 670 LLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSEN--DLL 727
           LL+F ++++P M+RGKGV+LQ YKD  +SD+  F + EGL+W         R+    DL 
Sbjct: 673 LLVFKLEELPVMTRGKGVQLQKYKDASLSDLKVFALAEGLSWRMGGSGEKTRTVTLPDLQ 732

Query: 728 GWLGKRGGVGSLVPKGFPRSGKF 750
           GW+  RG  G L P GFP+  +F
Sbjct: 733 GWIAYRGTQGKLPPNGFPKDNRF 755


>gi|126724334|ref|ZP_01740177.1| DNA topoisomerase IV subunit A [Rhodobacterales bacterium HTCC2150]
 gi|126705498|gb|EBA04588.1| DNA topoisomerase IV subunit A [Rhodobacterales bacterium HTCC2150]
          Length = 769

 Score =  803 bits (2075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/772 (50%), Positives = 534/772 (69%), Gaps = 32/772 (4%)

Query: 3   VDNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMS 62
           +D +    T + E      LR AL +RYL YALSTI  RA+PD RDG KPVHRRI++AM+
Sbjct: 5   IDPVDTPETEITE-----PLRRALGDRYLTYALSTIMHRALPDARDGLKPVHRRILYAMN 59

Query: 63  EMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNID 122
            + L     F KSA+I G+ +G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNID
Sbjct: 60  RLRLSASGGFLKSAKISGDTMGDFHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNID 119

Query: 123 GDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSG 182
           GD+ AA RYTEARMT VAE +L+G+ E+AVD+RD Y+    EPVV P+ FPNLLANG++G
Sbjct: 120 GDNPAASRYTEARMTVVAEAMLEGLSENAVDYRDNYDGRLEEPVVLPASFPNLLANGSTG 179

Query: 183 IAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVES 242
           IAVGMAT+IP HNV E+C+A L LI +P    E LL+Y+ GPDFPTGG+IVE +E+I+E+
Sbjct: 180 IAVGMATNIPPHNVAELCDACLHLIKSPNARDETLLDYVPGPDFPTGGVIVEPKENILEA 239

Query: 243 YRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIR 302
           YR GRG FR+R +W  E++GRG W IVVTEIPYQVQKS+LIEK+AE+I  K+IP+L D+R
Sbjct: 240 YRTGRGSFRLRCKWETEDLGRGMWQIVVTEIPYQVQKSKLIEKLAEVIHLKKIPILGDVR 299

Query: 303 DESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILK 362
           DESA+DVRI+L PK++++DPD+LM  ++  SD+E RF LNMNVL  G  P+V  L  +L+
Sbjct: 300 DESADDVRIILEPKSKNVDPDVLMNMLYRSSDLEVRFSLNMNVLIDGLTPKVCSLKDVLR 359

Query: 363 EWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMV---- 418
            ++ HR++VL RRS  R+  ID R+E+L+G +IA+LN+D +I IIR +D PK  ++    
Sbjct: 360 AFIDHRQDVLKRRSQHRIDKIDHRLEVLEGFIIAFLNLDRVIDIIRYDDDPKAALMRENW 419

Query: 419 --------------------SRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEK 458
                                   L+E Q +AILN+RLRSLR+LEE ++  E D L+ E+
Sbjct: 420 AQEFVRATSESDYRSPAVADDEGELSEVQAEAILNMRLRSLRRLEEMELVRERDALMEER 479

Query: 459 EKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKE 518
             +D LL+  + QW +I+ ++RE ++ F K+ + G RR+ F E    ++  + +AMIE+E
Sbjct: 480 ANLDDLLSDERLQWAKISEQLRETRKTFGKNYEGGARRSQFAEAGEVEEVPI-EAMIERE 538

Query: 519 PITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAG 578
           PITVV S  GW+R+LK H+   S + FK+GD  +   HA TTDR+L+  ++G+ YTL A 
Sbjct: 539 PITVVCSKMGWVRALKGHADLTSKVKFKDGDEARFMFHAETTDRLLIFGSNGRFYTLGAN 598

Query: 579 NLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKG 638
           NL  GRG GE ++L++DL +  +IV   ++    KLLV S+ G+ FIV E+++IA TR G
Sbjct: 599 NLPGGRGMGEPLRLMVDLPNEAEIVDILIHQPDRKLLVASTAGDGFIVPENDVIAQTRSG 658

Query: 639 KTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGIS 698
           K  L V    +  ++  V GDH+A VGENRK+L F + ++PEM RGKGVRLQ YKDGG+S
Sbjct: 659 KQVLNVKEGVRAFVLSPVKGDHLACVGENRKVLAFPLTELPEMGRGKGVRLQKYKDGGLS 718

Query: 699 DVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           D   F + +GL+W D AGR+  R+E +L  W+GKR   G + P+GFPR  +F
Sbjct: 719 DATFFTLADGLSWKDPAGRT--RTETELTEWMGKRASAGRMAPRGFPRDNRF 768


>gi|89053044|ref|YP_508495.1| DNA topoisomerase IV subunit A [Jannaschia sp. CCS1]
 gi|88862593|gb|ABD53470.1| DNA topoisomerase IV subunit A [Jannaschia sp. CCS1]
          Length = 775

 Score =  803 bits (2075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/754 (52%), Positives = 528/754 (70%), Gaps = 29/754 (3%)

Query: 22  LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGE 81
           L  A+  RYL YALSTI  RA+PD RDG KPVHRRI++AM E+ L     F+KSA+I G+
Sbjct: 25  LSRAIGSRYLQYALSTIMHRALPDARDGLKPVHRRILYAMRELRLASNGGFRKSAKISGD 84

Query: 82  VIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAE 141
           V+G  HPHGD ++YD++ RLAQ FV RYPL+ GQGNFGNIDGD+ AA RYTEARMT VAE
Sbjct: 85  VMGNYHPHGDAAIYDAMARLAQDFVIRYPLVDGQGNFGNIDGDNPAAARYTEARMTAVAE 144

Query: 142 LILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICE 201
            +L+G+ EDAV+FRD Y+    EP V P++ PNLLANG+SGIAVGMAT+IP HN+ E+  
Sbjct: 145 ALLEGLSEDAVNFRDNYDGTLQEPEVLPAQVPNLLANGSSGIAVGMATNIPPHNLDELIA 204

Query: 202 AALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEV 261
           A L LI  P+   E LL Y+ GPDFPTGG+IVE RES+ E+YR G+GGFRVRA   +E++
Sbjct: 205 ACLHLIKTPDARDETLLNYVQGPDFPTGGVIVEPRESMAETYRTGKGGFRVRATHEIEDL 264

Query: 262 GRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLD 321
           GRG W IVVTEIPYQVQKS+LIEK+AELI  K++P+L D+RDESA+D+RIVL P+++++D
Sbjct: 265 GRGQWQIVVTEIPYQVQKSKLIEKLAELIQLKKMPILADVRDESADDIRIVLEPRSKTVD 324

Query: 322 PDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQ 381
           PD+LM +++  SD+E RF LNMNVL  GR P+V  L  +L+ +L HR++VL RRS  RM 
Sbjct: 325 PDVLMAALYRQSDLENRFSLNMNVLIDGRTPKVCSLKEVLRAFLDHRQDVLMRRSRHRMA 384

Query: 382 AIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMV----------------------S 419
            ID R+E+L+G LIA+LN+D +I IIR +D PK  ++                       
Sbjct: 385 QIDHRLEVLEGFLIAFLNLDRVIDIIRYDDSPKAALMREDWGQDFVRAMSEADYVSPKPG 444

Query: 420 RFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEI 479
              LTE QV+AILN+RLRSLR+LEE ++++E D L+ E+  ++ LL     QW +IA E+
Sbjct: 445 EGELTEVQVEAILNMRLRSLRRLEEMELQAERDRLMEERAGLEDLLAEESLQWGRIAEEL 504

Query: 480 REVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVD 539
           REV++ F    D G RRT F E    ++ +L +AMIE+EP+T+V S  GWIR++K H VD
Sbjct: 505 REVRKKFGSRADGGARRTQFAEAGNIEEVSL-EAMIEREPVTIVCSQMGWIRAMKGH-VD 562

Query: 540 LSA-LHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNH 598
           LS  + F++GD  + A+HA TTD++L+L + G+ YTL A  L  GRG GE ++L++DL +
Sbjct: 563 LSQEMKFRDGDGPRFAIHAETTDKLLILGSQGRVYTLGANGLPGGRGLGEPLRLMVDLPN 622

Query: 599 NQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVT- 657
              IV  FV+    K L+ SS G+ F+V E +I+A TR GK  L V       +   V  
Sbjct: 623 EVQIVDLFVHHPGAKRLMASSAGDGFLVAEEDILAQTRSGKQVLNVKDGVTASVCRAVAP 682

Query: 658 -GDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAG 716
             DHVAVVGENRKLL+F + ++PEM RGKGVRLQ YKDGG+SD   F++ +GL W+D AG
Sbjct: 683 EDDHVAVVGENRKLLVFPLTELPEMGRGKGVRLQKYKDGGLSDARTFRLEDGLVWLDPAG 742

Query: 717 RSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           R+  R+E +L  W  KR G G + P+GFPR  +F
Sbjct: 743 RT--RTEVELGEWAAKRAGAGRMAPRGFPRDNQF 774


>gi|254453718|ref|ZP_05067155.1| DNA topoisomerase IV, A subunit [Octadecabacter antarcticus 238]
 gi|198268124|gb|EDY92394.1| DNA topoisomerase IV, A subunit [Octadecabacter antarcticus 238]
          Length = 803

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/778 (50%), Positives = 541/778 (69%), Gaps = 32/778 (4%)

Query: 1   MGVDNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHA 60
           +G     N + L  +     +LR AL +RYL YALSTI  RA+PD RDG KPVHRRI++A
Sbjct: 29  LGYTRSMNDDALDPKMNPTETLRRALGDRYLTYALSTIMHRALPDARDGLKPVHRRILYA 88

Query: 61  MSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGN 120
           M E+ L     F+KSA+I G+V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGN
Sbjct: 89  MRELKLASKGGFRKSAKISGDVMGNYHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGN 148

Query: 121 IDGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGT 180
           IDGD+ AA RYTEARMT  AE +L+G++E+AVDFR+ Y+    EPVV P+ FPNLLANG+
Sbjct: 149 IDGDNPAAARYTEARMTAAAEALLEGLNENAVDFRENYDGTLEEPVVLPAAFPNLLANGS 208

Query: 181 SGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIV 240
           SGIAVGMAT+IP HN++E+  A L LI +P    E LL+YI GPDFPTGG+IVE +E+I 
Sbjct: 209 SGIAVGMATNIPPHNLEELIGACLHLIKSPNARDETLLDYIPGPDFPTGGVIVEPKENIA 268

Query: 241 ESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLED 300
           E+YR G+GGFR+R ++ VE++GRG W +++TEIPYQVQKSRLIEK+AE+I  K++P+L D
Sbjct: 269 EAYRTGKGGFRLRCKYEVEDLGRGQWQVIITEIPYQVQKSRLIEKLAEIIELKKVPILAD 328

Query: 301 IRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGI 360
           +RDESAED+RIVL PK++++D ++LM  ++  S++ETRF LNMNVL  G  P+V  L  +
Sbjct: 329 VRDESAEDIRIVLEPKSKNVDVEVLMGMLYRNSELETRFSLNMNVLIDGLTPKVCSLKEV 388

Query: 361 LKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVS- 419
           L+ +L HRR+VL RRS+ RM  ID R+E+L+G +IA+LN+D +I IIR ++ PK  +++ 
Sbjct: 389 LRAFLDHRRDVLIRRSTHRMVKIDHRLEVLEGFIIAFLNLDRVIDIIRYDNDPKKALMAE 448

Query: 420 --------------------------RFSLTENQVDAILNLRLRSLRKLEEYQIKSELDN 453
                                        LT+ Q +AILN+RLRSLR+LEE ++  E D 
Sbjct: 449 DWGKTHARAMDEADYVSPLTGLVSEPEMGLTDVQAEAILNMRLRSLRRLEEIELVKERDA 508

Query: 454 LLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQA 513
           L+ E+  ++ LL+S   QW  IA ++RE +++F  +++ G RRT F      +   L +A
Sbjct: 509 LMLERAGLEDLLDSEDLQWKTIADQLRETRKLFGSNSEGGARRTAFAVAGVVEDVPL-EA 567

Query: 514 MIEKEPITVVISNRGWIRSLKSHSVDLS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKA 572
           MI+KEP+TVV S  GWIR+L  H +DL+  L FK+GD  +   HA TTDR+L+  ++G+ 
Sbjct: 568 MIDKEPVTVVCSKMGWIRALTGH-IDLARELKFKDGDEGRFVFHAQTTDRLLVFGSNGRF 626

Query: 573 YTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEII 632
           YT+    L  GRG GE ++L++DL +  +IV  F++ +  KLLV SS G+ F+V E ++I
Sbjct: 627 YTMGTSTLPGGRGMGEPLRLMVDLPNEAEIVALFIHRAGNKLLVASSAGDGFVVPEDDVI 686

Query: 633 ANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSY 692
           A TR GK  L V  + + ++   VTGD+VA VGENRK+L+F +D++PEM RGKGVRLQ Y
Sbjct: 687 AQTRAGKQVLNVKGDVRARVCSTVTGDYVACVGENRKVLLFPLDELPEMGRGKGVRLQKY 746

Query: 693 KDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           KDGG+SD   F + +GL+W+D AGR+  R++ +L  W  KR G G + P+GFPR  +F
Sbjct: 747 KDGGLSDATTFTLADGLSWLDPAGRT--RTQTELAEWAAKRAGAGRMAPRGFPRDNRF 802


>gi|83941524|ref|ZP_00953986.1| DNA topoisomerase IV subunit A [Sulfitobacter sp. EE-36]
 gi|83847344|gb|EAP85219.1| DNA topoisomerase IV subunit A [Sulfitobacter sp. EE-36]
          Length = 775

 Score =  798 bits (2062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/758 (51%), Positives = 533/758 (70%), Gaps = 33/758 (4%)

Query: 22  LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGE 81
           LR AL +RYL YALSTI  RA+PD RDG KPVHRRI+ AM E+ L+    F+KSA+I G+
Sbjct: 21  LRRALGDRYLTYALSTIMHRALPDARDGLKPVHRRILFAMRELRLNSTGGFRKSAKISGD 80

Query: 82  VIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAE 141
           V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEARMT VAE
Sbjct: 81  VMGNYHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDGDNPAASRYTEARMTAVAE 140

Query: 142 LILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICE 201
            +L+G++E+AVDFR+ Y+   +EP V P++FPNLLANG+SGIAVGMAT+IP HN+ E+ +
Sbjct: 141 AMLEGLNENAVDFRENYDGTLTEPAVLPAQFPNLLANGSSGIAVGMATNIPPHNISELVD 200

Query: 202 AALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEV 261
           A + LI  P+   + LL+Y+ GPDFPTGGIIVE  E+I  +YR G+GGFR+R RW  E++
Sbjct: 201 ACIHLIKTPDARDDTLLKYVPGPDFPTGGIIVEPPENIANAYRTGKGGFRLRCRWETEDL 260

Query: 262 GRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLD 321
           GRG+W IV+TEIPYQVQKS+LIEKIAELI  K+IP+L D+RDESA+D+R+++ P+++++D
Sbjct: 261 GRGAWQIVITEIPYQVQKSKLIEKIAELIQTKKIPILGDVRDESADDIRLIIEPRSKNVD 320

Query: 322 PDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQ 381
           P++LM  ++  SD+E RF LNMNVL  G  P+V  +  +L+ +L HRREVL RRS++RM+
Sbjct: 321 PEVLMGMLYRSSDLEVRFSLNMNVLIDGVTPKVCSMKEVLRAFLDHRREVLQRRSTYRME 380

Query: 382 AIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPK-----------------------PVMV 418
            ID R+E+L+G ++A+LN+D +I IIR ++ PK                       P   
Sbjct: 381 KIDHRLEVLEGFIVAFLNLDRVIDIIRYDEDPKSALMAEDWGKDHVRAMDEASYVPPAPS 440

Query: 419 SRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACE 478
           +  SL+E Q DAILN+RLRSLR+LEE ++  E   L+ E+  ++ LL +   QW+ I  +
Sbjct: 441 AENSLSEVQADAILNMRLRSLRRLEEIELLREQAALMEERSGLEDLLENEGTQWDTIIDQ 500

Query: 479 IREVKEIFSK-----STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSL 533
           +RE K+ F K       ++GRRRT+F E    ++  L +AMI++EPITVV S  GWIR++
Sbjct: 501 LRETKKQFGKDWSLDGKNIGRRRTSFSEAGVIEEVPL-EAMIDREPITVVCSQMGWIRAM 559

Query: 534 KSHSVDLS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQL 592
             H +DL+  L FK+GD  +   HA TTDR+L+  ++G+ YT+ A  L  GRG GE ++L
Sbjct: 560 TGH-IDLNRELKFKDGDGPRFIFHAETTDRLLVFGSNGRFYTVSASTLPGGRGMGEPLRL 618

Query: 593 LIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKL 652
           ++DL +   IV   ++ +  KLLV SS G+ FIV E +++A TR GK  L V  + K  +
Sbjct: 619 MVDLPNEVQIVDILIHKAGRKLLVASSAGDGFIVPEDDVLAQTRGGKQVLNVRGDAKAMI 678

Query: 653 VVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWI 712
              VTGD VAVVGENRK+L+F +D++PEM RGKGVRLQ YKDGG+SD I F    GL+W 
Sbjct: 679 CAPVTGDAVAVVGENRKVLVFGLDELPEMGRGKGVRLQKYKDGGMSDAITFSRENGLSWQ 738

Query: 713 DSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           D AGR+  R+E DL  W GKR   G + P+GFPR  +F
Sbjct: 739 DPAGRT--RTEADLTEWTGKRATAGRMAPRGFPRDNRF 774


>gi|197105328|ref|YP_002130705.1| topoisomerase IV, subunit A [Phenylobacterium zucineum HLK1]
 gi|196478748|gb|ACG78276.1| topoisomerase IV, subunit A [Phenylobacterium zucineum HLK1]
          Length = 752

 Score =  796 bits (2056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/730 (53%), Positives = 516/730 (70%), Gaps = 9/730 (1%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIG 84
           AL  RYLAYALS I +RA+PD+RDG KPV RR+++AM EM L+   A +K A++VGEV+G
Sbjct: 24  ALSRRYLAYALSVITDRALPDVRDGLKPVQRRVLYAMREMRLNPENAARKCAKVVGEVMG 83

Query: 85  KLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELIL 144
             HPHGDQ++YD+LVR+AQ F QRYPL+ GQGNFGNIDGD+AAA RYTEA++T  A L+L
Sbjct: 84  GYHPHGDQAIYDTLVRMAQSFAQRYPLVDGQGNFGNIDGDNAAAMRYTEAKLTAAATLLL 143

Query: 145 QGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAAL 204
            G++EDAVDF+ TY+  D EPVV P+ FPNLLANG++GIAVGMATSIP HN  E+ +A L
Sbjct: 144 DGIEEDAVDFKPTYDGSDDEPVVLPAGFPNLLANGSTGIAVGMATSIPPHNAGELIDACL 203

Query: 205 ALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRG 264
            L++NPE S E L+ ++ GPDFPTGG+IVE R+S+ E+Y  GRGG RVRARW  E++G+G
Sbjct: 204 LLLENPEASTEALMTHVQGPDFPTGGVIVEPRQSLAETYATGRGGVRVRARWTKEDLGKG 263

Query: 265 SWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDL 324
           ++ IVVTEIPYQV+K+ L+EK+AELI AK+ PLL D+RDESAEDVR+VL PK+R+++ ++
Sbjct: 264 TYQIVVTEIPYQVKKADLVEKLAELIEAKKAPLLGDVRDESAEDVRLVLEPKSRNVEAEV 323

Query: 325 LMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAID 384
           LMES+F LSD+ETRF +N+NVL     P VM L   LK +L HRREVL RR+  R++ I+
Sbjct: 324 LMESLFKLSDLETRFSVNLNVLDARGTPGVMNLRQALKAFLDHRREVLVRRARHRLEKIE 383

Query: 385 RRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEE 444
            R+ IL GL+IAYLN+DE+I I+R EDKPK  ++  FSL+E Q DAILN RLR L KLEE
Sbjct: 384 ARLHILDGLMIAYLNLDEVIRIVRYEDKPKEKLIETFSLSEIQADAILNTRLRQLAKLEE 443

Query: 445 YQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSR 504
            +I+ E   L  E++ I  +L S   QW  +   +R VK    K  D   RR+TF E  +
Sbjct: 444 MEIRREHAELAEERDGILKMLASDAAQWKLVGEGLRHVKAELGKLND---RRSTFGEAPQ 500

Query: 505 ADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRIL 564
            D     +AMI +EPIT+++S RGWIR+ K    D S L FKEGD L+  + A TTD++L
Sbjct: 501 VDAEAAIEAMIVREPITIILSERGWIRAAKGRIEDPSELKFKEGDKLQFLVPAETTDKLL 560

Query: 565 LLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAF 624
           + ++DG+ +TL    L   RGHGE ++L+IDL+    IV  F +    K L+ S +G  F
Sbjct: 561 IFASDGRFFTLGCDKLPGARGHGEPLRLMIDLDDKVGIVDVFPHKPGAKRLLASKQGYGF 620

Query: 625 IVEESEIIANTRKGKTFLKVSSEEK----MKLVVKVTGDHVAVVGENRKLLIFSIDQIPE 680
           I+ E E IA  R GK  L      K      + + VTGD +AVVG+N K+L+F + ++PE
Sbjct: 621 ILPEEEAIAFRRAGKQVLNAGDPAKKGEGAAVCLPVTGDQIAVVGDNGKILVFPLAELPE 680

Query: 681 MSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLV 740
           M RGKGV+LQSY++GG+ D + F   EG  WID+AGR+  R+ +    W G+R G G L 
Sbjct: 681 MPRGKGVKLQSYREGGLRDALVFNAAEGAAWIDAAGRT--RAWDGWQEWAGRRAGAGKLA 738

Query: 741 PKGFPRSGKF 750
           PKGFP + +F
Sbjct: 739 PKGFPATKRF 748


>gi|114797721|ref|YP_759608.1| DNA topoisomerase IV subunit A [Hyphomonas neptunium ATCC 15444]
 gi|114737895|gb|ABI76020.1| DNA topoisomerase IV, A subunit [Hyphomonas neptunium ATCC 15444]
          Length = 744

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/727 (53%), Positives = 529/727 (72%), Gaps = 6/727 (0%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIG 84
           AL +RYLAYALSTI  RA+PD+RDG KPV RRI++ M  + LD    ++K A+IVG+V+G
Sbjct: 21  ALSKRYLAYALSTITSRALPDVRDGLKPVQRRILYGMRVLRLDPEGGYRKCAKIVGDVMG 80

Query: 85  KLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELIL 144
             HPHGD S+YD+LVRLAQ F  RYPL+ GQGNFGNIDGDSAAAYRYTEARMT+ AEL++
Sbjct: 81  NYHPHGDSSIYDTLVRLAQDFNVRYPLVDGQGNFGNIDGDSAAAYRYTEARMTRGAELLM 140

Query: 145 QGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAAL 204
           +G+DE+AVDFR  Y E D EPVV P+ FPNLLANG +GIAVGMATSIP HNV EI +AA 
Sbjct: 141 EGLDENAVDFRPNYAENDEEPVVLPAGFPNLLANGATGIAVGMATSIPPHNVAEIIDAAR 200

Query: 205 ALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRG 264
            LI+ P+ + E+L+E++ GPDFPTGG+IVE R S++E+Y  GRG FR+RARW VE+ GRG
Sbjct: 201 HLIEKPKATTEELMEFVQGPDFPTGGVIVEDRASMLEAYETGRGAFRMRARWHVEDTGRG 260

Query: 265 SWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDL 324
           ++ I+VTEIPYQVQKSRL+EK++EL+ AK++PLLED+RDESAEDVR+VL P+ ++++PD+
Sbjct: 261 TYQIIVTEIPYQVQKSRLLEKLSELLEAKKVPLLEDVRDESAEDVRLVLVPRAKTVEPDV 320

Query: 325 LMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAID 384
           LMES+F   D+ETRF LNMNVL  G  PQVM L  +L+ +L HRREV+ RR+ FR+  I+
Sbjct: 321 LMESLFRTCDLETRFSLNMNVLHKG-APQVMGLRDVLQAYLDHRREVVVRRAEFRLDKIE 379

Query: 385 RRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEE 444
           +R+ IL+G L AYLNIDE+I IIR ED+PKPV++ RF +++ Q +AILNLRLR+LRKLEE
Sbjct: 380 KRLHILEGFLKAYLNIDEVIRIIRTEDEPKPVLMKRFKISDIQAEAILNLRLRALRKLEE 439

Query: 445 YQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSR 504
            +I+ E   L  E++++  L+ S ++QW +++ E++  ++ F  ST LGRRR TF +   
Sbjct: 440 MEIQGEHTKLTEERDELVLLIGSVRRQWTRVSKELKAARDEFDPSTALGRRRATFEQAPT 499

Query: 505 ADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRIL 564
            D A   +A   KEP+TVV+S +GWIR +K H +D   + FKEGD         +TD+++
Sbjct: 500 VDLAAALEATRPKEPVTVVLSAQGWIRGMKGHGLDPDTIKFKEGDGPSFTEEVMSTDKLV 559

Query: 565 LLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAF 624
            +S+DG+A+ LPA  L  GRGHGE I++ I+L  N  IV  F ++   K ++ SS G  F
Sbjct: 560 FMSSDGRAFMLPADKLPGGRGHGEPIRISIELEDNVAIVGMFKFEPERKRVMASSTGYGF 619

Query: 625 IVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRG 684
           +V E+E+ +N + GK  +       + + V V GD +AVVG NRK+LIF +  +PEM RG
Sbjct: 620 VVPEAELESNRKAGKQIVNTGGGH-LNVCVPVLGDMIAVVGTNRKMLIFPLKDLPEMPRG 678

Query: 685 KGVRLQSYKDGG-ISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKG 743
           KG +LQSY  G  ++D+I F   +GL  + + GR   R+  +   W G+R   G +VPKG
Sbjct: 679 KGNKLQSYSGGAELADLITFDKRDGLIVV-TGGRF--RAFEEWKEWKGQRAQAGKVVPKG 735

Query: 744 FPRSGKF 750
           FPR+G F
Sbjct: 736 FPRTGTF 742


>gi|254438270|ref|ZP_05051764.1| DNA topoisomerase IV, A subunit [Octadecabacter antarcticus 307]
 gi|198253716|gb|EDY78030.1| DNA topoisomerase IV, A subunit [Octadecabacter antarcticus 307]
          Length = 804

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/758 (51%), Positives = 535/758 (70%), Gaps = 32/758 (4%)

Query: 21  SLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVG 80
           +LR AL +RYL YALSTI  RA+PD RDG KPVHRRI++AM E+ L     F+KSA+I G
Sbjct: 50  TLRRALGDRYLTYALSTIMHRALPDARDGLKPVHRRILYAMRELKLASKGGFRKSAKISG 109

Query: 81  EVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVA 140
           +V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEARMT  A
Sbjct: 110 DVMGNYHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDGDNPAAARYTEARMTAAA 169

Query: 141 ELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEIC 200
           E +L+G++E+AVDFR+ Y+    EPVV P+ FPNLLANG+SGIAVGMAT+IP HN++E+ 
Sbjct: 170 EALLEGLNENAVDFRENYDGTLEEPVVLPAAFPNLLANGSSGIAVGMATNIPPHNLEELI 229

Query: 201 EAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEE 260
            A L LI  P+   E L+ YI GPDFPTGG+IVE +E+I E+YR G+GGFR+R ++ VE+
Sbjct: 230 GACLHLIKTPDARDETLMNYIPGPDFPTGGVIVEPKENIAEAYRTGKGGFRLRCKYEVED 289

Query: 261 VGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSL 320
           +GRG W ++VTEIPYQVQKSRLIEK+AE+I  K++P+L D+RDESAED+RIVL PK++++
Sbjct: 290 LGRGQWQVIVTEIPYQVQKSRLIEKLAEVIELKKVPILADVRDESAEDIRIVLEPKSKNV 349

Query: 321 DPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRM 380
           D ++LM  ++  S++ETRF LNMNVL  G  P+V  L  +L+ +L HRR+VL RRS+ RM
Sbjct: 350 DVEVLMGMLYRNSELETRFSLNMNVLIDGLTPKVCSLKEVLRAFLDHRRDVLIRRSTHRM 409

Query: 381 QAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVS--------------------- 419
             ID R+E+L+G +IA+LN+D +I IIR ++ PK  +++                     
Sbjct: 410 VKIDHRLEVLEGFIIAFLNLDRVIDIIRYDNDPKKALMAEDWGKTHVRAMDEADYVSPLT 469

Query: 420 ------RFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWN 473
                    LT+ Q +AILN+RLRSLR+LEE ++  E D L+ E+  ++ LL+S   QW 
Sbjct: 470 ALVGEPEMGLTDVQAEAILNMRLRSLRRLEEIELVKERDALMLERAGLEDLLDSDDLQWK 529

Query: 474 QIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSL 533
            IA ++RE +++F  ++  G RRT F E    +   L +AMI+KEP+TVV S  GWIR++
Sbjct: 530 TIAEQLRETRKLFGSNSKGGARRTAFAEAGVIEDVPL-EAMIDKEPVTVVCSKMGWIRAM 588

Query: 534 KSHSVDLS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQL 592
             H +DL+  L FK+GD  +   HA TTDR+L+  ++G+ YTL A  L  GRG GE ++L
Sbjct: 589 TGH-IDLARELKFKDGDEGRFVFHAQTTDRLLVFGSNGRFYTLGASTLPGGRGMGEPLRL 647

Query: 593 LIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKL 652
           ++DL +  +IV  F++ +  +L++VSS G+ FIV E ++IA TR GK  L V  + + K+
Sbjct: 648 MVDLPNEAEIVALFIHRAGNRLMIVSSAGDGFIVPEDDVIAQTRAGKQALNVKGDVRAKV 707

Query: 653 VVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWI 712
              V GDHVA VGENRK+L+F +D++PEM RGKGVRLQ YKDGG+SD   F + +GL+W+
Sbjct: 708 CSTVIGDHVACVGENRKVLLFPLDELPEMGRGKGVRLQKYKDGGLSDATTFTLADGLSWL 767

Query: 713 DSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           D AGR+  R++ +L  W  KR G G + P+GFPR  +F
Sbjct: 768 DPAGRT--RTQTELGEWAAKRAGAGRMAPRGFPRDNRF 803


>gi|260576309|ref|ZP_05844301.1| DNA topoisomerase IV, A subunit [Rhodobacter sp. SW2]
 gi|259021577|gb|EEW24881.1| DNA topoisomerase IV, A subunit [Rhodobacter sp. SW2]
          Length = 767

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/760 (50%), Positives = 523/760 (68%), Gaps = 25/760 (3%)

Query: 13  VEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAF 72
           +E    +  LR A+ ERYL YALSTI  RA+PD RDG KPVHRRI+ AM E+ L   +AF
Sbjct: 10  IEPQEHSEPLRRAIGERYLTYALSTIMHRALPDARDGLKPVHRRILFAMRELKLSPTSAF 69

Query: 73  KKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYT 132
           +KSA+I G+V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYT
Sbjct: 70  RKSAKISGDVMGNYHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDGDNPAASRYT 129

Query: 133 EARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIP 192
           EAR+T +AE +++G+ E+AVDFR  Y+    EPVV P+ FP+LLANG+SGIAVGMAT+IP
Sbjct: 130 EARLTAIAEALMEGLAENAVDFRPNYDGTLEEPVVMPAAFPHLLANGSSGIAVGMATNIP 189

Query: 193 SHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRV 252
            HN+ E+ +  LALI +P++    L++ I GPDFPTGG+IVE R SI++SYR GRG FR+
Sbjct: 190 PHNLHELIDGCLALIKHPDLPDAALVDLIPGPDFPTGGVIVEPRASILDSYRTGRGSFRL 249

Query: 253 RARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIV 312
           RARW VE++GRG W IVVTEIPYQVQKS+LIE++AELI  K+ PLL D+RDES  DVR++
Sbjct: 250 RARWAVEDLGRGQWQIVVTEIPYQVQKSKLIERLAELIQTKKTPLLADVRDESTADVRLI 309

Query: 313 LFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVL 372
           L P+ R++DPD+LM ++F  SD+E RF LNMNVL  GR P+V  L  +L+ +L H+REVL
Sbjct: 310 LEPRVRTVDPDMLMGTLFRNSDLELRFSLNMNVLIDGRTPKVCSLREVLRAFLDHKREVL 369

Query: 373 FRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPK------------------ 414
            RRS  R++ ID R+EIL+G +I +LN+D +I IIR +  PK                  
Sbjct: 370 QRRSRHRLEKIDHRLEILEGFIITFLNLDRVIDIIRYDADPKRALMAEDWGKKHRRATSE 429

Query: 415 ----PVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQ 470
               P       LTE Q +AILN+RLRSLR+LEE ++ +E D L+ E+  ++ LL S   
Sbjct: 430 KDYVPPAPGEGELTEVQAEAILNMRLRSLRRLEELELIAERDALMVERAGLEDLLASDAL 489

Query: 471 QWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWI 530
           QW +I  ++ EV++ F K++  G RR+TF E   A++    +AMIE+EPITV+ S  GWI
Sbjct: 490 QWKRIGKDLAEVQKTFGKASKGGARRSTFAEAGEAEEVPY-EAMIEREPITVICSKMGWI 548

Query: 531 RSLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAI 590
           R++K H    S   FK+GD  +   HA TTDRI+L+ ++G+ YTL   NL  GRG GE +
Sbjct: 549 RAMKGHVALDSEQKFKDGDEGRFLFHAETTDRIILIGSNGRVYTLLGANLPGGRGMGEPV 608

Query: 591 QLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM 650
           +L++DL ++ +I+   ++    KLL+ S+ G+ F++   E++A T+ GK  L V    K 
Sbjct: 609 RLMVDLPNDAEIIDLMIHRPGLKLLIASTAGDGFVLPSDEVVAQTKAGKQVLVVREGVKT 668

Query: 651 KLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLT 710
            L   V GD VAVVG+NRK+L+F +  +PEM+RGKGVRLQ YKDGG++D   F + +GL+
Sbjct: 669 ALCRPVKGDAVAVVGDNRKMLVFPLADLPEMARGKGVRLQKYKDGGLADATTFVLAQGLS 728

Query: 711 WIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           W D AGR+  R+E DL  W   R   G + P+GFPR  +F
Sbjct: 729 WKDPAGRT--RTETDLAEWQAARATAGRMAPRGFPRDNRF 766


>gi|83311684|ref|YP_421948.1| DNA topoisomerase IV subunit A [Magnetospirillum magneticum AMB-1]
 gi|82946525|dbj|BAE51389.1| Type IIA topoisomerase, A subunit [Magnetospirillum magneticum
           AMB-1]
          Length = 744

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/742 (52%), Positives = 534/742 (71%), Gaps = 8/742 (1%)

Query: 13  VEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAF 72
           V  +++   L  AL ERYLAYA+STI  R++PD+RDG KPVHRR++ AM ++ LD    F
Sbjct: 6   VTGDIRDTPLAEALGERYLAYAMSTIVSRSLPDVRDGLKPVHRRLLFAMRQLKLDPSGGF 65

Query: 73  KKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYT 132
           KK AR+VG+VIGK HPHGD +VYD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYT
Sbjct: 66  KKCARVVGDVIGKYHPHGDVAVYDTLVRLAQDFAVRYPLVEGQGNFGNIDGDNAAAMRYT 125

Query: 133 EARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIP 192
           EA++T++A  +++G+DED+VDFR TY+  + EPVV PS FPNLLANG++GIAVGMATSIP
Sbjct: 126 EAKLTEIAAALMEGLDEDSVDFRPTYDGTEEEPVVMPSAFPNLLANGSAGIAVGMATSIP 185

Query: 193 SHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRV 252
            HN+ EIC+A   LI  P+  +++L+ ++ GPDFPTGG++VE++ +I E+YR G+G FRV
Sbjct: 186 PHNIGEICDALDHLIAKPDCDVDELIAHMPGPDFPTGGVLVETQAAITEAYRTGKGAFRV 245

Query: 253 RARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIV 312
           RA+W VE++  G + IV+TEIPYQVQK++LIEKIAEL+  K++PLL DIRDESAED+R+V
Sbjct: 246 RAKWAVEKLSHGLYQIVITEIPYQVQKAKLIEKIAELLSEKKLPLLADIRDESAEDIRLV 305

Query: 313 LFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGR----VPQVMPLDGILKEWLAHR 368
           L P+NR+++ +L+ME +F  +D+E+RF LNMNVL+        P VM L  +L+ +L HR
Sbjct: 306 LEPRNRTVEAELVMEQLFRQTDLESRFSLNMNVLAPDAHGHLTPGVMNLKEVLRAFLDHR 365

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
             VL RR+ FR++ I +R+E+L+G L  Y ++D++I IIR  D+PK  ++  F L+E Q 
Sbjct: 366 MVVLERRARFRLEKIAKRLEVLEGFLKVYADLDKVIRIIRFADEPKAELIKTFKLSEVQA 425

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AILN+RLRSL KL+E +IK+E   L AEK  +++LL    ++W  IA +  E ++ F  
Sbjct: 426 EAILNMRLRSLNKLQELEIKTEHAELSAEKADLEALLADEPRRWAAIAAQNDETRKAFGG 485

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
           +T LG+RRT   +   A    + +A +E+E IT+V+S +GWIR+LK HS    AL FKEG
Sbjct: 486 ATALGKRRTELGDAPSAVVVPI-EAYVEREAITMVLSEKGWIRALKGHSDAPEALKFKEG 544

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           D L   L A TTD+IL+ +TDG+ YT+    L SGRGHGE ++L+IDL  + DI    V+
Sbjct: 545 DQLGHLLKAWTTDKILVFATDGRFYTIGGDKLPSGRGHGEPLRLMIDLAGDVDIAAVMVH 604

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENR 668
               KLLV ++    F+VEE+E++A TR GK  L  +  EK K  +   GD VAV+GENR
Sbjct: 605 KPGRKLLVATNTDRGFVVEENEVLAQTRAGKMVLNCADGEKAKFCLPFEGDAVAVIGENR 664

Query: 669 KLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLG 728
           KLL+F  ++IP ++RG+GV LQ Y+DGG++D+  F + +GLTW  + G    R+E+DL  
Sbjct: 665 KLLVFMAEEIPVLTRGRGVILQKYRDGGMADIKVFTLAQGLTW--NLGDRV-RTESDLTP 721

Query: 729 WLGKRGGVGSLVPKGFPRSGKF 750
           WLGKR  VG L P GFPR+ +F
Sbjct: 722 WLGKRASVGRLPPTGFPRNNRF 743


>gi|83858199|ref|ZP_00951721.1| DNA topoisomerase IV subunit A [Oceanicaulis alexandrii HTCC2633]
 gi|83853022|gb|EAP90874.1| DNA topoisomerase IV subunit A [Oceanicaulis alexandrii HTCC2633]
          Length = 746

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/725 (53%), Positives = 526/725 (72%), Gaps = 3/725 (0%)

Query: 21  SLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVG 80
           S   AL  RYLAYALSTI +RA+PD RDG KPVHRR+++AM  + L    AFKK AR+VG
Sbjct: 16  SFNDALSSRYLAYALSTITQRALPDARDGLKPVHRRLLYAMRLLKLSPDTAFKKCARVVG 75

Query: 81  EVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVA 140
           +VIG+ HPHGDQ+VY++LVRLAQ F  RYPL+ GQGNFGN+DGD AAA RYTEAR+T+ A
Sbjct: 76  DVIGRFHPHGDQAVYEALVRLAQDFASRYPLVEGQGNFGNVDGDGAAAMRYTEARLTEAA 135

Query: 141 ELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEIC 200
            LILQ  DE  VDFR+TY+ ED EP+V P+ FPNLLANG++GIAVGMAT+IP HN  E+C
Sbjct: 136 ILILQDYDEGTVDFRETYDGEDKEPLVLPAAFPNLLANGSAGIAVGMATNIPPHNAAELC 195

Query: 201 EAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEE 260
           +AA  LI  P  + E LL Y+ GPDFPTGG+ VE+RE+I+E+Y  GRGGFR+RARW VEE
Sbjct: 196 DAARHLIKTPGAATETLLNYVQGPDFPTGGVCVETRENILEAYETGRGGFRLRARWEVEE 255

Query: 261 VGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSL 320
           +GRG W IVVTEIPY VQK++LIE+IA L+  K++PLL D+ DESAEDVR++L PK+R++
Sbjct: 256 LGRGQWQIVVTEIPYLVQKAKLIERIAALLDQKKLPLLADVMDESAEDVRLILEPKSRTI 315

Query: 321 DPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRM 380
           DP LLMES+F L+D+E RF LN+NVL     P+V+ L   L+ WL HRR V+ RR++ R+
Sbjct: 316 DPALLMESVFKLTDLEVRFALNLNVLDPTGAPRVVGLKEALQIWLDHRRVVVVRRATTRL 375

Query: 381 QAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLR 440
           + ++ R+E+L G ++AYLN+DE+I IIR ED PK  ++  FSLT+ Q +AILN+RLRSLR
Sbjct: 376 EHVEDRLEVLSGFMVAYLNLDEVIRIIRFEDHPKDELIKTFSLTDRQAEAILNMRLRSLR 435

Query: 441 KLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFC 500
           KLEE +I+ E   L  E++++++L+     QW ++  E+ +VK+ F  +T+LG+RRTTF 
Sbjct: 436 KLEEMEIRDEQSRLEGERDELNALIADESLQWKKVDSEVADVKKRFGPNTELGKRRTTFA 495

Query: 501 EVSRADKATL-QQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHT 559
           +   AD A + ++A+I +EPIT+V+S  GW+R+LK H+ D++ +  K+GD    +L A T
Sbjct: 496 DAPAADLADMVEEALIPREPITIVLSRMGWVRALKGHTDDVTGIKHKDGDETAFSLKAET 555

Query: 560 TDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSS 619
           TD+IL+L+TDG+ YTL A  L  GRG GE ++LLID++ + + V  F Y    KLL+ S+
Sbjct: 556 TDKILMLTTDGRVYTLDASKLPGGRGFGEPVRLLIDMDESAEPVALFKYSPDRKLLLAST 615

Query: 620 KGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIP 679
            G+ F+V E E+ A  R G+  L V    K  + + +TGD +AV+GEN+KLL+F+ D+IP
Sbjct: 616 SGHGFVVAEKELPAIKRAGRQVLNVIDGHKAMMALPMTGDRIAVLGENKKLLVFAADEIP 675

Query: 680 EMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSL 739
           EM RGKGVRL   K G ++D+  F   EGL  +D AGR +     D   + GKR   G L
Sbjct: 676 EMVRGKGVRLLGGKAGEVADITVFNAEEGLVRVDPAGRRH--LVEDWRYYEGKRAQAGKL 733

Query: 740 VPKGF 744
            P+GF
Sbjct: 734 APRGF 738


>gi|330994747|ref|ZP_08318669.1| DNA topoisomerase 4 subunit A [Gluconacetobacter sp. SXCC-1]
 gi|329758008|gb|EGG74530.1| DNA topoisomerase 4 subunit A [Gluconacetobacter sp. SXCC-1]
          Length = 736

 Score =  791 bits (2043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/727 (52%), Positives = 524/727 (72%), Gaps = 7/727 (0%)

Query: 16  NVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKS 75
           +++   L  AL ERYLAYA+STI  R++PD+RDG KPVHRR+++AM ++ LD  A FKK 
Sbjct: 7   HIEDTKLADALSERYLAYAMSTIMSRSLPDVRDGLKPVHRRMVYAMQQLKLDPTAGFKKC 66

Query: 76  ARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEAR 135
           AR+VG+VIGK HPHGD SVY++LVRLAQ F  RYPL+ GQGNFG+IDGD+AAA RYTE+R
Sbjct: 67  ARVVGDVIGKYHPHGDASVYEALVRLAQDFAVRYPLVEGQGNFGSIDGDNAAAMRYTESR 126

Query: 136 MTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHN 195
           +T VA+ +L+G+DED+VDFR TY+ E+ EPVV P+ FPNLLANG +GIAVGMATSIP HN
Sbjct: 127 LTAVAKALLEGIDEDSVDFRPTYDGEEHEPVVLPAAFPNLLANGAAGIAVGMATSIPPHN 186

Query: 196 VQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRAR 255
           V EIC AALALI  P  +  +LL ++ GPDFPTGG IVE R++I+ +Y  GRG FR+R++
Sbjct: 187 VGEICAAALALIRKPATTTAELLAHMPGPDFPTGGSIVEDRDAILRAYETGRGSFRIRSK 246

Query: 256 WCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFP 315
           W VE+   G+W IVVTEIPYQVQKSRLIE++A+L+  K++PLL DIRDES  D+R+VL P
Sbjct: 247 WDVEQGRFGTWQIVVTEIPYQVQKSRLIEQVADLMEQKKLPLLADIRDESTTDIRLVLEP 306

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           K+R ++P +LME++F  + +E+RF LNMNVL   +VP V  L  +L+ WL HR +VL RR
Sbjct: 307 KSRGIEPAVLMETLFRATQLESRFGLNMNVLGADQVPGVRSLKEVLQAWLDHRHDVLLRR 366

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
           S+ R+QA+DRR+EIL G L  YLN+DE+I I+R ED  K  +++ F LTE Q D++LN+R
Sbjct: 367 SANRLQAVDRRLEILNGFLAVYLNLDEVIRIVREEDDAKSALIAAFDLTELQADSVLNMR 426

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LRSLR+LEE +I++E   L AEK+ +  LL +  Q+W  IA EI+++++ F   T LG+R
Sbjct: 427 LRSLRRLEEMEIRNEHARLSAEKQALHDLLENEGQRWKHIAGEIKDIQKTFGGGT-LGKR 485

Query: 496 RTTFCEVSRADKATLQQAM-IEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIA 554
           R+   +     +  ++ A+ +E++P+TV++S +GWIR+++ H  D  AL FKEGD L +A
Sbjct: 486 RSLLADAPV--EIDVEAALPVERDPLTVILSQKGWIRTVRGHGQDPQALKFKEGDDLGMA 543

Query: 555 LHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKL 614
           +  H+ DR+ + +TDG+A+TL   +L  GRG G+ ++LLIDL++++DI+T F  D   + 
Sbjct: 544 VECHSNDRLCVFATDGRAFTLRVADLPRGRGDGQPLRLLIDLSNDEDIITMFPLDDARRR 603

Query: 615 LVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
           L+ SS G   IV ES + A  R G+  L +   E   + V   GDHV V+G+NR++L+F 
Sbjct: 604 LLASSTGRGMIVAESAMTAEKRTGRQVLNLKDRESALICVPAEGDHVLVLGQNRRMLVFP 663

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
           +DQ+PEM+RG GV LQ YKDGG+ D + F    G+ W D A     R+  DL  ++GKR 
Sbjct: 664 LDQLPEMARGLGVILQKYKDGGLKDAVVFTADAGVAWPDPA---RVRAFADLKDYVGKRA 720

Query: 735 GVGSLVP 741
            +G   P
Sbjct: 721 EMGKPAP 727


>gi|254293712|ref|YP_003059735.1| DNA topoisomerase IV subunit A [Hirschia baltica ATCC 49814]
 gi|254042243|gb|ACT59038.1| DNA topoisomerase IV, A subunit [Hirschia baltica ATCC 49814]
          Length = 750

 Score =  791 bits (2043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/731 (52%), Positives = 519/731 (70%), Gaps = 8/731 (1%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIG 84
           AL +RYLAYALSTI  RA+PD+RDG KPVHRR+++AM  + L+   AFKKSAR+VG+VIG
Sbjct: 22  ALSKRYLAYALSTITSRALPDVRDGLKPVHRRLMYAMRLLKLNPELAFKKSARVVGDVIG 81

Query: 85  KLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELIL 144
           K HPHGD S+YD+LVRLAQ F  RYPL+ GQGNFGNIDGDSAAA RYTE+R+T  A+L+L
Sbjct: 82  KYHPHGDASIYDALVRLAQDFNVRYPLVDGQGNFGNIDGDSAAAMRYTESRLTPAAQLLL 141

Query: 145 QGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAAL 204
           +G+DE+AVDF++TY+  D EPVV  S FPNLL NG+SGIAVGMATSIP HN  E  +A +
Sbjct: 142 EGLDENAVDFKETYDGGDKEPVVLASGFPNLLCNGSSGIAVGMATSIPPHNAAETIDACI 201

Query: 205 ALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRG 264
            LI+N   +   L++ + GPDFPTGG IVE  +SI+++Y  GRGGFR+R +W  E++ RG
Sbjct: 202 HLIENKSATTADLVKIMPGPDFPTGGEIVEDEDSILKAYETGRGGFRMRCKWEKEDLPRG 261

Query: 265 SWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDL 324
            W IVVTEIPYQVQKS+LIE++AELI  K+ PLL+D+ DESAED+R+VL P+N+ +DPD+
Sbjct: 262 LWQIVVTEIPYQVQKSKLIERLAELIETKKAPLLDDVMDESAEDIRVVLVPRNKLVDPDV 321

Query: 325 LMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAID 384
           LM S++ +SD+E+RF LNMNVL    VP+VM L  +L+ +LAHR+EV+ RR+  R+  I+
Sbjct: 322 LMASLYKMSDLESRFSLNMNVLDHN-VPRVMGLKQVLQCYLAHRQEVIVRRAQHRLDKIE 380

Query: 385 RRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEE 444
            R+ IL+G L AYLNIDE+I IIR ED PK  ++  F L+E Q DAILN+RLR+LRKLEE
Sbjct: 381 ARLHILEGYLKAYLNIDEVIRIIRYEDHPKEELMKAFKLSEIQTDAILNMRLRALRKLEE 440

Query: 445 YQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSR 504
            +I+ E D L  E++K+  L+ S  +QW ++  +++  +E+F   +DLGRRR+ F     
Sbjct: 441 IEIQGEHDKLTQERDKLVQLIGSEARQWTEVKRQLKIAREVFDPESDLGRRRSKFGVAVE 500

Query: 505 ADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRIL 564
            D     +AMI KEPITV++S  GWIR+LK H+  +  L FK+GD L   L   TTD+++
Sbjct: 501 IDADAALEAMIPKEPITVILSKMGWIRALKGHNQAMDKLKFKDGDELAFTLECQTTDKVV 560

Query: 565 LLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAF 624
           LL++ GKA+T  A  L SGRGHGE I+L IDL  +++I+      +  + +V S+ G  F
Sbjct: 561 LLASGGKAFTFAADKLPSGRGHGEPIRLSIDLPEDEEIIATITPKTGYRRVVASTAGYGF 620

Query: 625 IVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRG 684
           +V E E+++  R GK               +V GD VAV+G+N+K+L F ++++PEM+RG
Sbjct: 621 VVNEEELVSQKRGGKVIQNPPDGATFAFCPRVEGDMVAVIGDNKKILFFPLEELPEMARG 680

Query: 685 KGVRLQSYKDGG-----ISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSL 739
           KGV+LQ+YK  G     + D+  F   +G  W D+ GR  N S N+   WLGKR   G L
Sbjct: 681 KGVKLQNYKQSGLINEQLMDICTFDSEDGFFWKDTGGR--NISLNEWRDWLGKRAAAGKL 738

Query: 740 VPKGFPRSGKF 750
            PKGF R+GKF
Sbjct: 739 APKGFNRTGKF 749


>gi|56695629|ref|YP_165980.1| DNA topoisomerase IV subunit A [Ruegeria pomeroyi DSS-3]
 gi|56677366|gb|AAV94032.1| DNA topoisomerase IV, A subunit [Ruegeria pomeroyi DSS-3]
          Length = 782

 Score =  790 bits (2040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/783 (50%), Positives = 531/783 (67%), Gaps = 40/783 (5%)

Query: 4   DNISNSNTLVEENVKAVS--LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAM 61
           D I + N   +     VS  LR A+ ERYL YALSTI  RA+PD RDG KPVHRRI++AM
Sbjct: 3   DTIDDPNMKQDGGGHQVSEPLRRAIGERYLTYALSTIMHRALPDARDGLKPVHRRILYAM 62

Query: 62  SEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNI 121
            E+ L     F+KSA+I G+V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNI
Sbjct: 63  RELRLSSSGGFRKSAKISGDVMGNYHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNI 122

Query: 122 DGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTS 181
           DGD+ AA RYTEARMT VAE +L G++EDAVDFRD Y+   +EPVV P++FPNLLANG+S
Sbjct: 123 DGDNPAASRYTEARMTIVAEALLDGLNEDAVDFRDNYDGTLTEPVVLPAQFPNLLANGSS 182

Query: 182 GIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVE 241
           GIAVGMAT+IP HN+ E+C+A L LI  P+   + LL Y+ GPDFPTGGIIVE  ESI +
Sbjct: 183 GIAVGMATNIPPHNIAELCDACLHLIKTPDARDDTLLNYVPGPDFPTGGIIVEPPESIAQ 242

Query: 242 SYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDI 301
           +YR GRG FR+R ++ VE++GRG W IVVTEIPYQVQKS+LIEK+AE+I  K++P+L D+
Sbjct: 243 AYRTGRGSFRLRCKYEVEDLGRGQWQIVVTEIPYQVQKSKLIEKLAEVIQTKKVPILADV 302

Query: 302 RDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGIL 361
           RDESA+D+R++L P+ +++DP++LM  ++  SD+E RF LNMNVL  G  P+V  +  +L
Sbjct: 303 RDESADDIRLILEPRTKNVDPEVLMGMLYRNSDLEVRFSLNMNVLIDGVTPKVCSMKEVL 362

Query: 362 KEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMV--- 418
           + +L HR+EVL RRS  R+  ID R+E+L+G +IA+LN+D +I IIR ++ PK  ++   
Sbjct: 363 RAFLDHRQEVLLRRSRHRLGKIDHRLEVLEGFIIAFLNLDRVIDIIRYDEDPKAALMREE 422

Query: 419 -------------------SRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKE 459
                                  L+E Q +AILN+RLRSLR+LEE ++  E D L+AE+ 
Sbjct: 423 WGIDHPRALNEADYVSPAPGEGELSEVQAEAILNMRLRSLRRLEEMELIRERDALMAERA 482

Query: 460 KIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEP 519
           +I+ LL     QW +I+ +++E K+ F K    G RRT F E    ++  L +AMIE+EP
Sbjct: 483 EIEDLLADPALQWARISDQLKETKKTFGKDFPGGARRTRFAEAGEVEEVPL-EAMIEREP 541

Query: 520 ITVVISNRGWIRSLKSHSVDLS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAG 578
           ITVV S  GW+R++  H +DL+  L FK+GD  +   HA TTD++L+ +++G+ YT+ A 
Sbjct: 542 ITVVCSQMGWVRAMTGH-IDLTRELKFKDGDGPRFIFHAETTDKLLVFASNGRFYTIGAA 600

Query: 579 NLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKG 638
           NL  GRG GE ++L++DL +  +IV   ++    KLLV S+ GN F+V E+E++A TR G
Sbjct: 601 NLPGGRGMGEPLRLMVDLPNEAEIVDILIHQPERKLLVASTAGNGFVVPETEVVAQTRTG 660

Query: 639 KTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYK----- 693
           K  L V  +E+  + V V GDHVAVV +N K L+F +D++PEM RGKGVRLQ Y      
Sbjct: 661 KQVLNVRDDERALICVPVAGDHVAVVSQNGKFLVFPLDEMPEMGRGKGVRLQKYNMARGK 720

Query: 694 ------DGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRS 747
                 DGG+SDV  F   EGL W  S G    R E DL  WL KR  VG   P GFPRS
Sbjct: 721 QGALELDGGLSDVTTFTWAEGLKW--SMGGDKTRHETDLSQWLAKRASVGKRPPYGFPRS 778

Query: 748 GKF 750
            KF
Sbjct: 779 YKF 781


>gi|126739698|ref|ZP_01755390.1| DNA topoisomerase IV subunit A [Roseobacter sp. SK209-2-6]
 gi|126719344|gb|EBA16054.1| DNA topoisomerase IV subunit A [Roseobacter sp. SK209-2-6]
          Length = 781

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/763 (52%), Positives = 524/763 (68%), Gaps = 38/763 (4%)

Query: 22  LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGE 81
           LR A+ ERYL YALSTI  RA+PD RDG KPVHRRI++AM+ + L     F KSA+I G+
Sbjct: 22  LRRAIGERYLTYALSTIMHRALPDARDGLKPVHRRILYAMNRLRLSSNGGFLKSAKISGD 81

Query: 82  VIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAE 141
            +G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEARMT VAE
Sbjct: 82  TMGDFHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDGDNPAASRYTEARMTFVAE 141

Query: 142 LILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICE 201
            +L+G+ EDAVDFRD Y+   +EP V P+ FPN+LANG +GIAVGMAT+IP HN+ E+ +
Sbjct: 142 AMLEGLSEDAVDFRDNYDGRLTEPAVLPATFPNILANGAAGIAVGMATNIPPHNIAELID 201

Query: 202 AALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEV 261
           A + LI  P+   + LL Y+ GPDFPTGGIIVE +E+I ++Y  GRG FR+RA+  VE++
Sbjct: 202 ACVHLIKTPDARDDTLLNYVPGPDFPTGGIIVEPKENIAKAYSTGRGSFRLRAKHEVEDL 261

Query: 262 GRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLD 321
           GRG W IVVTEIPYQVQKS+LIEKIAELI  K++P+L D+RDESAED+RI+L PK++++D
Sbjct: 262 GRGQWQIVVTEIPYQVQKSKLIEKIAELIQTKKVPILADVRDESAEDIRIILEPKSKNVD 321

Query: 322 PDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQ 381
           PD+LM  +F  SD+ETRF LNMNVL  G  P+V  +  +L+ +L HRR+VL RRS  RM 
Sbjct: 322 PDVLMNMMFRNSDLETRFSLNMNVLIDGVTPKVCSMKEVLRAFLDHRRDVLQRRSRHRMA 381

Query: 382 AIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSR---------FS---------- 422
            ID R+E+L+G +IA+LN+D +I IIR ++ PK  ++           FS          
Sbjct: 382 KIDHRLEVLEGFIIAFLNLDRVIDIIRYDEDPKAALMREDWGQDHPRAFSEAEYVSPAKG 441

Query: 423 ---LTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEI 479
              L+E Q +AILN+RLRSLRKLEE ++  E D L  E+  +  LL S + QW +I  ++
Sbjct: 442 TGELSEVQAEAILNMRLRSLRKLEEIELTRERDALREERAGLVELLGSEELQWTRITEQL 501

Query: 480 REVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVD 539
           RE K+ F K  + G RRT F E    ++  L +AMI+KEPITVV S  GW+R++  H +D
Sbjct: 502 RETKKQFGKDYEGGARRTLFAEAGEVEEVPL-EAMIDKEPITVVCSQMGWVRAMTGH-ID 559

Query: 540 LS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNH 598
           LS  L FK+GD  +   HA TTDR+L+  ++G+ YTL A NL  GRG GE ++L++DL +
Sbjct: 560 LSRELKFKDGDGPRFIFHAETTDRLLVFGSNGRFYTLSAANLPGGRGMGEPVRLMVDLPN 619

Query: 599 NQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG 658
             +IV   +++   +LLV S  GN FI  E EI+A TR GK  L V  +++ K+ + V G
Sbjct: 620 EAEIVDLLIHNPEGRLLVASDAGNGFICAEKEIVAQTRSGKQVLNVKDDDRAKICIPVQG 679

Query: 659 DHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYK-----------DGGISDVICFKICE 707
           DHVAVV EN K L+FS++++PE+SRGKGVRLQ Y            DGG+SDV  F   +
Sbjct: 680 DHVAVVSENGKFLVFSVEEMPELSRGKGVRLQKYNMARGKQGSLELDGGLSDVTTFNWDD 739

Query: 708 GLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           GLTW    G++  R E DL  WLGKR GVG   P GFPR+ KF
Sbjct: 740 GLTWEMGGGKT--RHETDLGQWLGKRAGVGKRPPYGFPRNYKF 780


>gi|304321405|ref|YP_003855048.1| DNA topoisomerase IV subunit A [Parvularcula bermudensis HTCC2503]
 gi|303300307|gb|ADM09906.1| DNA topoisomerase IV subunit A [Parvularcula bermudensis HTCC2503]
          Length = 754

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/752 (50%), Positives = 526/752 (69%), Gaps = 13/752 (1%)

Query: 4   DNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSE 63
           D  +   T++EE +       AL  RYLAYALSTI  RA+PD+RDG KPVHRRI++AM +
Sbjct: 10  DRPAGPETIIEEPMGE-----ALSRRYLAYALSTITARALPDIRDGLKPVHRRILYAMRQ 64

Query: 64  MGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG 123
           M L  G +++KSA++ G+V+G  HPHGDQ++YD++VRL Q F  R PLI GQGNFGNIDG
Sbjct: 65  MRLGSGGSYRKSAKVAGQVMGDYHPHGDQAIYDAMVRLVQDFSVRIPLIDGQGNFGNIDG 124

Query: 124 DSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGI 183
           D+AAA RYTE R+T+ AEL+L+G+D D VDFR+TY+ E  EPVV P+ FP+LLANG+SGI
Sbjct: 125 DNAAAMRYTECRLTEAAELLLEGIDNDTVDFRETYDGEGREPVVLPAAFPHLLANGSSGI 184

Query: 184 AVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESY 243
           AVGMAT+IP HNV E+ +A L LI  P    E LL Y+ GPD PTGG+ +ES++ + E+Y
Sbjct: 185 AVGMATNIPPHNVAELIDACLHLIKTPNARTETLLNYVKGPDLPTGGVCIESKDDLAEAY 244

Query: 244 RLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRD 303
             GRGGFR+RARW  E++GRG + IVVTEIPYQVQKS+L+E+IA+LI  K++P+L D+RD
Sbjct: 245 ATGRGGFRIRARWETEDLGRGRYQIVVTEIPYQVQKSKLVERIADLIQTKKLPVLTDVRD 304

Query: 304 ESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKE 363
           ESAED+R+VL PK  SLDP+ +M +IF L+D+ETR  LN+NV+     P V  L   L+ 
Sbjct: 305 ESAEDIRLVLEPKAGSLDPETVMAAIFKLTDLETRLSLNLNVIGADGAPGVFGLRDCLQA 364

Query: 364 WLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSL 423
           +L HRR+VL R + +R+  I  R+EIL G LIAYLN+DE+I IIR ED PK  +++ F L
Sbjct: 365 FLDHRRDVLLRGTRYRLDKIAHRLEILDGFLIAYLNLDEVIRIIRYEDDPKAELMATFDL 424

Query: 424 TENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVK 483
           +E Q +AILN+RLRSLRKLEE ++K E  +L AE++ + +LL S   QW +IA +++E +
Sbjct: 425 SEIQTEAILNMRLRSLRKLEEMELKREHKDLKAEQKDLQALLKSEDIQWERIAGQLKETR 484

Query: 484 EIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSAL 543
           + F   +DLGRRRT   +    ++  L + +IEKEP+TVVIS +GW+R+LK H  D +++
Sbjct: 485 KSFDPRSDLGRRRTALSDAPITEEVDLDE-LIEKEPVTVVISEKGWVRALKGHVEDKASI 543

Query: 544 HFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIV 603
            +K+GD  +  L A TTD+++L+ST+G+ + L   +L  GRGHGE  +L++DL +  D++
Sbjct: 544 KYKDGDQGRFVLPAMTTDKVILVSTNGRFFALDVKDLPGGRGHGEPFRLMVDLTNEHDLI 603

Query: 604 TAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG----- 658
             F+Y     LL+ SS G+   V E +++A TRKGK  L V++  + ++   +T      
Sbjct: 604 DVFLYQGDRTLLLASSAGHGLFVPEEDVLATTRKGKQVLNVAAGAEAQVCRLLTAAPGPN 663

Query: 659 DHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRS 718
           D++A +G NRKLLIF    +P M +GKGV LQ   +G + D  CF   EGLTW D AGR 
Sbjct: 664 DYLATIGSNRKLLIFPAGDVPVMVKGKGVVLQKITNGTLVDAKCFSPEEGLTWTDRAGR- 722

Query: 719 YNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
             +S  +   W+GKR   G L PKGFPR+ +F
Sbjct: 723 -QQSAEEWKEWVGKRAQAGKLPPKGFPRANRF 753


>gi|310817029|ref|YP_003964993.1| DNA topoisomerase IV subunit A [Ketogulonicigenium vulgare Y25]
 gi|308755764|gb|ADO43693.1| DNA topoisomerase IV subunit A [Ketogulonicigenium vulgare Y25]
          Length = 769

 Score =  789 bits (2038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/755 (51%), Positives = 530/755 (70%), Gaps = 28/755 (3%)

Query: 21  SLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVG 80
           +LR A+ +RYL YALSTI  RA+PD RDG KPVHRRI++AM E+ L  G  F+KSA+I G
Sbjct: 17  TLRRAIGDRYLTYALSTIMHRALPDARDGLKPVHRRILYAMRELRLASGGGFRKSAKIAG 76

Query: 81  EVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVA 140
           +V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGDS AA RYTEARMT  A
Sbjct: 77  DVMGNFHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDGDSPAASRYTEARMTAAA 136

Query: 141 ELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEIC 200
           E +L G+DE+AVD+R  Y+    EPVV P+ FPNLLANG+SGIAVGMAT+IP HN+ E+ 
Sbjct: 137 EALLAGLDENAVDYRGNYDGTQEEPVVLPAAFPNLLANGSSGIAVGMATNIPPHNLDEVI 196

Query: 201 EAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEE 260
            A L LI  P    + LL +I GPDFPTGG+IVE  E+I ++YR GRG FR+RA+W +E+
Sbjct: 197 SACLHLIRAPSADDDSLLAFIPGPDFPTGGVIVEDPENIRQAYRTGRGAFRLRAKWEIED 256

Query: 261 VGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSL 320
           +GRG W I+VTEIPYQVQKS+LIE++AELI  K++P L D+RDESA+DVRIV+ P+ R++
Sbjct: 257 LGRGQWQIIVTEIPYQVQKSKLIERLAELIALKKVPALADVRDESADDVRIVIEPRVRTI 316

Query: 321 DPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRM 380
           +P++LM  +F  S++E RF +NMNVL  G  P+V  L  +L+ +L HRREVL RR++ R+
Sbjct: 317 EPEMLMGMLFKNSELEIRFNMNMNVLIDGVTPKVCSLKEVLRAFLDHRREVLQRRTTHRL 376

Query: 381 QAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVM----------------------- 417
           + ID R+E+L G + AYLN+D +I IIR ++ PK  +                       
Sbjct: 377 EKIDHRLEVLAGFITAYLNLDRVIDIIRYDEDPKAALQAEDWGLKIPRAADESRYVSPLG 436

Query: 418 --VSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQI 475
             V+   LTE Q DAILN+RLRSLR+LEE ++ +E D L AE+  + +L+   K QW++I
Sbjct: 437 RPVAAGGLTEVQADAILNMRLRSLRRLEEIELVNERDALQAERAGLHALMGDEKLQWSRI 496

Query: 476 ACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKS 535
           + E+++V++ F K++  G RRT F E        L +AMIE+EP+TV+ S+ GWIR++K 
Sbjct: 497 SDELKDVRKQFGKTSKGGARRTAFGEGKEVADVPL-EAMIEREPVTVICSDMGWIRAMKG 555

Query: 536 HSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLID 595
           H      + FK+GD  + A HA TTDR+L  +++G+ YT+ A NL  GRG GE ++L++D
Sbjct: 556 HIALDQEMKFKDGDKARFAFHAETTDRLLAFASNGRFYTVLAANLPGGRGTGEPLRLMVD 615

Query: 596 LNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVK 655
           L ++  IV   ++    KL++ SS G+ FIV E ++IA TR GK  L +S      +V  
Sbjct: 616 LPNDAQIVDLLIHRPGQKLILASSAGDGFIVAEDDVIAQTRAGKQVLNLSEGASALIVKP 675

Query: 656 VTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSA 715
           V GDHVA VG+NRK+L+F++D++PEM+RGKGV+LQ +KDGG+SD++   + +GL+W +S 
Sbjct: 676 VQGDHVACVGDNRKMLVFALDELPEMARGKGVKLQKFKDGGLSDLVTLTLAQGLSWKESG 735

Query: 716 GRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           GR+  RSE DL  WLGKR G G + P+GFPR  +F
Sbjct: 736 GRT--RSEPDLSEWLGKRAGTGRMAPRGFPRDNRF 768


>gi|254511118|ref|ZP_05123185.1| DNA topoisomerase IV, A subunit [Rhodobacteraceae bacterium KLH11]
 gi|221534829|gb|EEE37817.1| DNA topoisomerase IV, A subunit [Rhodobacteraceae bacterium KLH11]
          Length = 782

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/783 (50%), Positives = 528/783 (67%), Gaps = 40/783 (5%)

Query: 4   DNISNSNTLVEENVKAVS--LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAM 61
           D I + N    +N   ++  LR A+ ERYL YALSTI  RA+PD RDG KPVHRRI++AM
Sbjct: 3   DTIDDPNMEAPDNGGEIAEPLRRAIGERYLTYALSTIMHRALPDARDGLKPVHRRILYAM 62

Query: 62  SEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNI 121
            E+ L     F+KSA+I G+V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNI
Sbjct: 63  RELRLSATGGFRKSAKISGDVMGNYHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNI 122

Query: 122 DGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTS 181
           DGD+ AA RYTEARMT VAE +L+G++EDAVDFRD Y+   +EPVV P++FPNLLANG+S
Sbjct: 123 DGDNPAASRYTEARMTIVAEALLEGLNEDAVDFRDNYDGTLTEPVVLPAQFPNLLANGSS 182

Query: 182 GIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVE 241
           GIAVGMAT+IP HN+ E+C+A L LI  P+   + LL Y+ GPDFPTGG+IVE  E+I +
Sbjct: 183 GIAVGMATNIPPHNISELCDACLHLIKTPDARDDTLLNYVPGPDFPTGGVIVEPPENIAQ 242

Query: 242 SYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDI 301
           +YR GRG FR+R ++ VE++GRG W IVVTEIPYQVQKS+LIEKIAELI  K+IP+L D+
Sbjct: 243 AYRTGRGSFRLRCKFEVEDLGRGQWQIVVTEIPYQVQKSKLIEKIAELIQTKKIPILADV 302

Query: 302 RDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGIL 361
           RDESA+D+R++L P+++++DP++LM  ++  SD+E RF LNMNVL  G  P+V  +  +L
Sbjct: 303 RDESADDIRLILEPRSKNVDPEVLMGMLYRNSDLEVRFSLNMNVLIDGVTPKVCSMKEVL 362

Query: 362 KEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMV--- 418
           + +L HR+EVL RRS  RM  ID R+E+L+G ++A+LN+D +I IIR +D PK  ++   
Sbjct: 363 RAFLDHRQEVLLRRSRHRMAKIDHRLEVLEGFIVAFLNLDRVIDIIRYDDDPKAALMRED 422

Query: 419 -------------------SRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKE 459
                                  L+E QVDAILN+RLRSLR+LEE ++  E D L+ E+ 
Sbjct: 423 WGIDHVRATSEADYVSPKPGEGELSEVQVDAILNMRLRSLRRLEEMELVRERDELMLERA 482

Query: 460 KIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEP 519
            ++ LL     QW +IA ++RE K+ F K  + G RRT F E  + ++  L +AMI++EP
Sbjct: 483 NLEDLLADPALQWAKIAEQLRETKKTFGKDYEGGARRTQFAEAGQVEEVPL-EAMIDREP 541

Query: 520 ITVVISNRGWIRSLKSHSVDLS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAG 578
           ITVV S  GWIR++  H +DL   L FK+GD  +   HA TTDR+L+ +++G+ YT+ A 
Sbjct: 542 ITVVCSQMGWIRAMTGH-IDLKRELKFKDGDGPRFIFHAETTDRLLVFASNGRFYTVSAA 600

Query: 579 NLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKG 638
           NL  GRG GE ++L++DL +   I+   ++    KLLV S  GN F+V E +++A TR G
Sbjct: 601 NLPGGRGMGEPLRLMVDLPNEAQIIDILIHKPGRKLLVASDAGNGFMVPEDDVLAQTRNG 660

Query: 639 KTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYK----- 693
           K  L V   E   +   V GDHVAVV +N K L+F  +++PEM+RGKGVRLQ Y      
Sbjct: 661 KQVLNVKGGETAMICKPVDGDHVAVVSQNGKFLVFPTNELPEMTRGKGVRLQKYNMARGR 720

Query: 694 ------DGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRS 747
                 DGG+SD+  F   EGL W  S G    R E D+  WL KR GVG   P GFPR 
Sbjct: 721 QGTLELDGGLSDITTFNWEEGLKW--SMGGDKTRHEADMTQWLAKRAGVGKKAPYGFPRD 778

Query: 748 GKF 750
            KF
Sbjct: 779 YKF 781


>gi|288958669|ref|YP_003449010.1| topoisomerase IV subunit A [Azospirillum sp. B510]
 gi|288910977|dbj|BAI72466.1| topoisomerase IV subunit A [Azospirillum sp. B510]
          Length = 741

 Score =  788 bits (2036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/729 (53%), Positives = 533/729 (73%), Gaps = 7/729 (0%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIG 84
           AL ERYL+YALSTI  R++PD+RDG KPVHRR++ AMS++ L+     KKSAR+VG+VIG
Sbjct: 18  ALGERYLSYALSTIMSRSLPDVRDGLKPVHRRLLFAMSQLRLEPTTPPKKSARVVGDVIG 77

Query: 85  KLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELIL 144
           K HPHGD SVYD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTEAR+T+VA+ +L
Sbjct: 78  KFHPHGDSSVYDALVRLAQDFSVRYPLVDGQGNFGNIDGDNAAAMRYTEARLTEVAKALL 137

Query: 145 QGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAAL 204
           +G+DEDAVDFR TY+ +  EP V P+ FPNLLANG+SGIAVGMAT+IP HNV EIC+A  
Sbjct: 138 EGIDEDAVDFRPTYDGDGEEPAVLPANFPNLLANGSSGIAVGMATNIPPHNVGEICDALR 197

Query: 205 ALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRG 264
            LI + +  IE L+ ++ GPDFPTGG++VESR+++VE+YR GRG FR+RARW VE++ +G
Sbjct: 198 HLIKHRDAPIETLVGFMPGPDFPTGGVLVESRQNVVEAYRTGRGAFRLRARWEVEKLAQG 257

Query: 265 SWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDL 324
           +W IVVTE+PYQVQK+RL+EKIAEL++AK++ LL+D+RDESAEDVR+VL PK+R++DP++
Sbjct: 258 TWQIVVTEMPYQVQKARLVEKIAELLLAKKLILLDDVRDESAEDVRLVLVPKSRNVDPEV 317

Query: 325 LMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAID 384
           LM S+F  +D+E RF LNMNVL    VP+VM L  +L+ +L HR EVL RRS+ R+  ID
Sbjct: 318 LMASLFQATDLEIRFSLNMNVLGADHVPRVMNLREVLQAFLDHRHEVLVRRSNHRLTQID 377

Query: 385 RRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEE 444
            R+E+L G L AYLN+DE+I IIR ED+PK  ++  F+LT+ Q DAILN+RLR+LRKLEE
Sbjct: 378 HRLEVLGGYLAAYLNLDEVIRIIREEDEPKQELIRAFTLTDVQADAILNMRLRNLRKLEE 437

Query: 445 YQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSR 504
            +I+ E + L  EK  +  LL     +W +IA  + E+K+ F     LG+RRT   +   
Sbjct: 438 MEIRREHEALTGEKNGLLELLGDEALRWKRIAEGVAEIKKKFGTGA-LGKRRTDVADAPA 496

Query: 505 ADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSA--LHFKEGDSLKIALHAHTTDR 562
             +  L  A++E+EP+TV+ S +GWIR+++ H  D  A  + +K+GD         TTD+
Sbjct: 497 VIEVPL-DALVEREPVTVICSAKGWIRTVRGHLTDAEAEDVKYKDGDERGFVERCETTDK 555

Query: 563 ILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGN 622
           +L+ +++GK +T+    L  GRG GE ++L+IDL ++ DIV  F +     LLVVS  G 
Sbjct: 556 LLVFASNGKFFTIGVDKLPRGRGFGEPVRLMIDLGNDVDIVDLFRHQPGRTLLVVSEDGR 615

Query: 623 AFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMS 682
            F VEE+E++A TR GK  L +   +  ++   V+GD VA++G NRK+L+F +DQ+P M+
Sbjct: 616 GFRVEEAEVLAQTRSGKQVLNLEDGKSARICQPVSGDTVAIIGNNRKMLVFPLDQVPVMT 675

Query: 683 RGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPK 742
           RGKGV+LQ YKD  ++DV  F + EGL+W  +  R++N +  DL GW+G R G G + P 
Sbjct: 676 RGKGVQLQKYKDASVADVKTFTLAEGLSW-KNGERNFNVT--DLTGWMGDRAGQGKMPPN 732

Query: 743 GFPRSGKFL 751
           GFP++ +F+
Sbjct: 733 GFPKNNRFM 741


>gi|91206120|ref|YP_538475.1| DNA topoisomerase IV subunit A [Rickettsia bellii RML369-C]
 gi|123084545|sp|Q1RGX8|PARC_RICBR RecName: Full=DNA topoisomerase 4 subunit A; AltName:
           Full=Topoisomerase IV subunit A
 gi|91069664|gb|ABE05386.1| Topoisomerase IV subunit A [Rickettsia bellii RML369-C]
          Length = 736

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/737 (51%), Positives = 537/737 (72%), Gaps = 4/737 (0%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           E  ++ +    AL ERYLAYALSTI  R++PD+RDG KPVHRR+++AM ++ L+  + +K
Sbjct: 3   EAKIENIDFGSALSERYLAYALSTIMSRSLPDVRDGLKPVHRRLLYAMLQLRLEPNSGYK 62

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K AR+VG+VIGK HPHGD +VYD+LVRLAQ F  RYPLI GQGNFG+IDGD+AAA RYTE
Sbjct: 63  KCARVVGDVIGKYHPHGDVAVYDTLVRLAQHFSLRYPLIDGQGNFGSIDGDNAAAMRYTE 122

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           +RMT++  L+++ +D+D VDFR TY++ D EPV+ P+ FPNLLANG+ GIAVGMAT+IP 
Sbjct: 123 SRMTEICTLLMEDIDKDTVDFRSTYDDSDLEPVIMPASFPNLLANGSEGIAVGMATNIPP 182

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN+ E+C+A + LID+P+  I  ++ +I GPDFPTGGII++  + I  +Y  GRG FRVR
Sbjct: 183 HNLHELCDALMHLIDHPKAEISDIMNFIKGPDFPTGGIIIDKSDVITSAYMTGRGSFRVR 242

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           ARW  EE+  G + IVVTEIPYQVQKS+LIE+IA L+  K+IPL+ +IRDES + +R+V+
Sbjct: 243 ARWEKEELNYGVYQIVVTEIPYQVQKSKLIEQIAILLKDKKIPLVSNIRDESTDIIRLVI 302

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            P++RS DP ++MES+F L+++E+R  LNMNV+    VP+VM +  +L+E+L+HR+ ++ 
Sbjct: 303 EPRDRSCDPQIVMESLFKLTNLESRIQLNMNVIGSNNVPKVMNILEVLQEFLSHRQNIIT 362

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS++ +  I  R+EIL+GL IAYLN+DEII IIR ED+PK +M+ RF LTE QV+AILN
Sbjct: 363 RRSTYLLNKIKHRLEILEGLRIAYLNLDEIIKIIREEDEPKAIMMQRFQLTEIQVEAILN 422

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
            RLRSLRKLEE +I +E  NL  ++  ++ +LN+ K+ W  +  EI+ V+  F  +T +G
Sbjct: 423 TRLRSLRKLEEQEIITEHSNLQKQQAILEEILNNPKELWKVVKKEIKAVQAKFGLNTTIG 482

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
            RRT+F +V+  ++     A I KEPIT++ S  GW+RSLK H+ DLS++ +KEGD+ K 
Sbjct: 483 ARRTSFEQVTLTNQVVDITAFITKEPITIICSKMGWVRSLKGHNNDLSSIKYKEGDAEKF 542

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
            L A+TTD+IL++S++G+ +TL A N+  G+G GE+I+LL+D+ +N DI    VY     
Sbjct: 543 ILEAYTTDKILIISSEGRFFTLLADNISKGKGTGESIKLLVDIGNN-DITEILVYKPDHL 601

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
           LL+ SS G  F+V  +E++A T+ GK  + V         + V GD VA +GE+RKLL+F
Sbjct: 602 LLLASSIGKGFVVNSNEVMAQTKSGKQIMNVPDGHTCIACLPVNGDSVACIGESRKLLVF 661

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
           +ID+IPEM +G+GV LQ +K+  + D+  F   +GL+W +S G+   + E +++ +LGKR
Sbjct: 662 NIDEIPEMKKGQGVTLQKFKNAKLLDIKIFNREDGLSW-NSGGKV--KLEKNIIAFLGKR 718

Query: 734 GGVGSLVPKGFPRSGKF 750
           G  G L P GFP++ +F
Sbjct: 719 GSTGKLPPMGFPKNNRF 735


>gi|157826447|ref|YP_001495511.1| DNA topoisomerase IV subunit A [Rickettsia bellii OSU 85-389]
 gi|157801751|gb|ABV78474.1| DNA topoisomerase IV subunit A [Rickettsia bellii OSU 85-389]
          Length = 736

 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/737 (51%), Positives = 537/737 (72%), Gaps = 4/737 (0%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           E  ++ +    AL ERYLAYALSTI  R++PD+RDG KPVHRR+++AM ++ L+  + +K
Sbjct: 3   EAKIENIDFGSALSERYLAYALSTIMSRSLPDVRDGLKPVHRRLLYAMLQLRLEPNSGYK 62

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K AR+VG+VIGK HPHGD +VYD+LVRLAQ F  RYPLI GQGNFG+IDGD+AAA RYTE
Sbjct: 63  KCARVVGDVIGKYHPHGDVAVYDTLVRLAQHFSLRYPLIDGQGNFGSIDGDNAAAMRYTE 122

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           +RMT++  L+++ +D+D VDFR TY++ D EPV+ P+ FPNLLANG+ GIAVGMAT+IP 
Sbjct: 123 SRMTEICTLLMEDIDKDTVDFRPTYDDSDLEPVIMPASFPNLLANGSEGIAVGMATNIPP 182

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN+ E+C+A + LID+P+  I  ++ +I GPDFPTGGII++  + I  +Y  GRG FRVR
Sbjct: 183 HNLHELCDALMHLIDHPKAEISDIMNFIKGPDFPTGGIIIDKSDVITSAYMTGRGSFRVR 242

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           ARW  EE+  G + IVVTEIPYQVQKS+LIE+IA L+  K+IPL+ +IRDES + +R+V+
Sbjct: 243 ARWEKEELNYGVYQIVVTEIPYQVQKSKLIEQIAILLKDKKIPLVSNIRDESTDIIRLVI 302

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            P++RS DP ++MES+F L+++E+R  LNMNV+    VP+VM +  +L+E+L+HR+ ++ 
Sbjct: 303 EPRDRSCDPQIVMESLFKLTNLESRIQLNMNVIGSNNVPKVMNILEVLQEFLSHRQNIIT 362

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS++ +  I  R+EIL+GL IAYLN+DEII IIR ED+PK +M+ RF LTE QV+AILN
Sbjct: 363 RRSTYLLNKIKHRLEILEGLRIAYLNLDEIIKIIREEDEPKAIMMQRFQLTEIQVEAILN 422

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
            RLRSLRKLEE +I +E  NL  ++  ++ +LN+ K+ W  +  EI+ V+  F  +T +G
Sbjct: 423 TRLRSLRKLEEQEIITEHSNLQKQQAILEEILNNPKELWKVVKKEIKAVQAKFGLNTTIG 482

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
            RRT+F +V+  ++     A I KEPIT++ S  GW+RSLK H+ DLS++ +KEGD+ K 
Sbjct: 483 ARRTSFEQVTLTNQVVDITAFITKEPITIICSKMGWVRSLKGHNNDLSSIKYKEGDAEKF 542

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
            L A+TTD+IL++S++G+ +TL A N+  G+G GE+I+LL+D+ +N DI    VY     
Sbjct: 543 ILEAYTTDKILIISSEGRFFTLLADNISKGKGTGESIKLLVDIGNN-DITEILVYKPDHL 601

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
           LL+ SS G  F+V  +E++A T+ GK  + V         + V GD VA +GE+RKLL+F
Sbjct: 602 LLLASSIGKGFVVNSNEVMAQTKSGKQIMNVPDGHTCIACLPVNGDSVACIGESRKLLVF 661

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
           +ID+IPEM +G+GV LQ +K+  + D+  F   +GL+W +S G+   + E +++ +LGKR
Sbjct: 662 NIDEIPEMKKGQGVTLQKFKNAKLLDIKIFNREDGLSW-NSGGKV--KLEKNIIAFLGKR 718

Query: 734 GGVGSLVPKGFPRSGKF 750
           G  G L P GFP++ +F
Sbjct: 719 GSTGKLPPMGFPKNNRF 735


>gi|260432786|ref|ZP_05786757.1| DNA topoisomerase IV, A subunit [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416614|gb|EEX09873.1| DNA topoisomerase IV, A subunit [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 782

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/766 (51%), Positives = 518/766 (67%), Gaps = 38/766 (4%)

Query: 19  AVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARI 78
           A  LR A+ ERYL YALSTI  RA+PD RDG KPVHRRI++AM E+ L     F+KSA+I
Sbjct: 20  AEPLRRAIGERYLTYALSTIMHRALPDARDGLKPVHRRILYAMRELRLSSSGGFRKSAKI 79

Query: 79  VGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQ 138
            G+V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEARMT 
Sbjct: 80  SGDVMGNYHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDGDNPAASRYTEARMTI 139

Query: 139 VAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQE 198
           VAE +L+G+DEDAVDFRD Y+    EPVV P+ FPNLLANG SGIAVGMAT+IP HN+ E
Sbjct: 140 VAEALLEGLDEDAVDFRDNYDGTLREPVVLPATFPNLLANGASGIAVGMATNIPPHNIAE 199

Query: 199 ICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCV 258
           +C+A L LI  P+   + LL Y+ GPDFPTGG+IVE  ESI ++YR GRG FR+R ++ +
Sbjct: 200 LCDACLHLIKTPDARDDTLLNYVPGPDFPTGGVIVEPPESIAQAYRTGRGSFRLRCKYEI 259

Query: 259 EEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNR 318
           E++GRG W IVVTEIPYQVQKS+LIEK+AELI  K+IP+L D+RDESA+D+R++L P+++
Sbjct: 260 EDLGRGQWQIVVTEIPYQVQKSKLIEKLAELIQTKKIPILGDVRDESADDIRLILEPRSK 319

Query: 319 SLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSF 378
           ++DP++LM  ++  SD+E RF LNMNVL  G  P+V  +  +L+ +L HR+EVL RRS  
Sbjct: 320 NVDPEVLMNMLYRNSDLELRFSLNMNVLIDGVTPKVCSMKEVLRAFLDHRQEVLLRRSRH 379

Query: 379 RMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMV-------------------- 418
           RM  ID R+E+L+G ++A+LN+D +I IIR +D PK  ++                    
Sbjct: 380 RMAKIDHRLEVLEGFIVAFLNLDRVIDIIRYDDDPKAALMRENWGIDHVRATSEADYVSP 439

Query: 419 --SRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIA 476
                 L+E QVDAILN+RLRSLR+LEE ++  E D L+ E+  ++ LL     QW  IA
Sbjct: 440 KPGEGELSEVQVDAILNMRLRSLRRLEEMELVRERDALMEERAGLEDLLADEGLQWASIA 499

Query: 477 CEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSH 536
            +++E K+ F K  + G RRT F E    ++  L +AMI++EPITVV S  GWIR++  H
Sbjct: 500 EQLKETKKKFGKDYEGGARRTRFAEAGAVEEVPL-EAMIDREPITVVCSQMGWIRAMTGH 558

Query: 537 SVDLS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLID 595
            +DL+  L FK+GD  +   HA TTDR+L+ +++G+ YT+ A NL  GRG GE ++L++D
Sbjct: 559 -IDLNRELKFKDGDGPRFIFHAETTDRLLIFASNGRVYTVSAANLPGGRGMGEPLRLMVD 617

Query: 596 LNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVK 655
           L +   IV   ++    KLLV S  GN FIV E E++A TR GK  L V  +E+  +   
Sbjct: 618 LPNEAQIVDILIHKPGRKLLVASDAGNGFIVPEDEVLAQTRNGKQVLNVKDDERAVICKP 677

Query: 656 VTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYK-----------DGGISDVICFK 704
           V GDHVAVV +N K L+F + ++PEM+RGKGVRLQ Y            DGG+SD+  F 
Sbjct: 678 VAGDHVAVVSQNGKFLVFPVSELPEMTRGKGVRLQKYNMARGRQGTLELDGGLSDLTTFN 737

Query: 705 ICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
             EGL W  S G    R E D+  WL KR  VG   P GFPR  KF
Sbjct: 738 WEEGLKW--SMGGDKTRHEPDMTPWLAKRASVGKKPPYGFPRDYKF 781


>gi|259416258|ref|ZP_05740178.1| DNA topoisomerase IV, A subunit [Silicibacter sp. TrichCH4B]
 gi|259347697|gb|EEW59474.1| DNA topoisomerase IV, A subunit [Silicibacter sp. TrichCH4B]
          Length = 782

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/763 (51%), Positives = 522/763 (68%), Gaps = 38/763 (4%)

Query: 22  LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGE 81
           LR A+ ERYL YALSTI  RA+PD RDG KPVHRRI++AM+ + L     F KSA+I G+
Sbjct: 23  LRRAIGERYLTYALSTIMHRALPDARDGLKPVHRRILYAMNRLRLSSSGGFLKSAKISGD 82

Query: 82  VIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAE 141
            +G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEARMT +AE
Sbjct: 83  TMGDFHPHGDAAIYDAMARLAQDFAVRYPLVDGQGNFGNIDGDNPAASRYTEARMTFIAE 142

Query: 142 LILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICE 201
            +L+G+ EDAVDFRD Y+    EP V P+ FPN+LANG+SGIAVGMAT+IP HN+ E+ +
Sbjct: 143 AMLEGLGEDAVDFRDNYDGRLQEPSVLPATFPNILANGSSGIAVGMATNIPPHNISELID 202

Query: 202 AALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEV 261
           A + LI  P  + + LL+Y+ GPDFPTGG IVE +E+I ++YR GRG FR+RA+  +E++
Sbjct: 203 ACIHLIKAPNAADDTLLQYVPGPDFPTGGTIVEPKENIAQAYRTGRGSFRLRAKHEIEDL 262

Query: 262 GRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLD 321
           GRG W +VVTEIPYQVQKS+LIEKIAELI  K++P+L D+RDESAED+RI+L PK++++D
Sbjct: 263 GRGQWQVVVTEIPYQVQKSKLIEKIAELIQTKKVPILADVRDESAEDIRIILEPKSKNVD 322

Query: 322 PDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQ 381
           P++LM  ++  SD+E RF LNMNVL  G  P+V  +  +L+ +L HRR+VL RRS  RM 
Sbjct: 323 PEVLMGLMYRNSDLEVRFSLNMNVLIDGVTPKVCSMKEVLRAFLDHRRDVLQRRSRHRMA 382

Query: 382 AIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSR---------FS---------- 422
            ID R+E+L G +IA+LN+D +I IIR +D PK  ++           F+          
Sbjct: 383 KIDHRLEVLDGFIIAFLNLDRVIDIIRYDDDPKAALMRENWDREHPRAFTEAEYVTPAAG 442

Query: 423 ---LTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEI 479
              L+E Q +AILN+RLRSLRKLEE ++  E D L  E+  +  LL+S   QW +I  ++
Sbjct: 443 DGELSEVQAEAILNMRLRSLRKLEEIELTRERDALREERAGLAELLDSEDLQWKKITEQL 502

Query: 480 REVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVD 539
           RE K+ F K  + G RRT F E    +   L +AMI++EPITVV S  GWIR++  H +D
Sbjct: 503 RETKKQFGKDYEGGSRRTQFAEAGEVEDVPL-EAMIDREPITVVCSQMGWIRAMTGH-ID 560

Query: 540 LS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNH 598
           L+  L FK+GD  +   HA TTDR+L+  ++G+ YTL A NL  GRG GE ++L++DL +
Sbjct: 561 LNRELKFKDGDGPRFIFHAETTDRLLVFGSNGRFYTLSAANLPGGRGMGEPLRLMVDLPN 620

Query: 599 NQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG 658
             +IV  F+++   +LLV S  GN F+  E EI+A TR GK  L V  +E+ K+ + V+G
Sbjct: 621 EVEIVDLFIHNPEGRLLVASDAGNGFVCAEKEIVAQTRGGKQVLNVKDDERAKICIPVSG 680

Query: 659 DHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYK-----------DGGISDVICFKICE 707
           DHVAVV EN K L+FSI+++PE++RGKGVRLQ Y            DGG++DV  F   E
Sbjct: 681 DHVAVVSENGKFLVFSIEEMPELTRGKGVRLQKYNMARGRQGSLELDGGLADVTTFNWDE 740

Query: 708 GLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           GL W    G++  R E DL  WLGKR GVG   P GFP+  KF
Sbjct: 741 GLQWEMGGGKT--RHETDLSQWLGKRAGVGKRPPYGFPKDYKF 781


>gi|126734750|ref|ZP_01750496.1| DNA topoisomerase IV subunit A [Roseobacter sp. CCS2]
 gi|126715305|gb|EBA12170.1| DNA topoisomerase IV subunit A [Roseobacter sp. CCS2]
          Length = 780

 Score =  783 bits (2021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/781 (49%), Positives = 535/781 (68%), Gaps = 43/781 (5%)

Query: 8   NSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLD 67
           +S+T +  N    +LR A+ +RYL YALSTI  RA+PD RDG KPVHRRI++AMS + L 
Sbjct: 4   DSDTGLGPNDVTETLRRAIGDRYLTYALSTIMHRALPDARDGLKPVHRRILYAMSRLRLS 63

Query: 68  FGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAA 127
               F KSA+I G+ +G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ A
Sbjct: 64  PSGGFLKSAKISGDTMGDFHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDGDNPA 123

Query: 128 AYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGM 187
           A RYTEARMT  AE +L+G+ ED+VDFRD Y+   +EP V P+ FPNLLANG+SGIAVGM
Sbjct: 124 ASRYTEARMTAAAEALLEGLSEDSVDFRDNYDGRLTEPAVLPATFPNLLANGSSGIAVGM 183

Query: 188 ATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGR 247
           AT+IP HN+ E+ +A L LI  P+   + LL YI GPDFPTGG IVE  E+I E+YR GR
Sbjct: 184 ATNIPPHNLHELIDACLHLIKTPDARDDTLLNYIPGPDFPTGGTIVEPAENIAEAYRTGR 243

Query: 248 GGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAE 307
           G FR+RA+W VE++GRG+W IVVTEIPYQVQKS+LIEK+AE+I  K++PLL D+RDESA+
Sbjct: 244 GSFRLRAKWEVEDLGRGTWQIVVTEIPYQVQKSKLIEKLAEVIQLKKVPLLADVRDESAD 303

Query: 308 DVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAH 367
           D+R+VL P+ +++DP+++M  +F  SD+ETRF LNMNVL  G  P+V  L  +L+ +L H
Sbjct: 304 DIRVVLEPRAKTVDPEVMMGMLFRNSDLETRFSLNMNVLIDGLTPKVCSLKEVLRAFLEH 363

Query: 368 RREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMV--------- 418
           RR+VL RRS +R++ ID R+E+L+G +IA+L++D +I IIR +D PK  ++         
Sbjct: 364 RRDVLVRRSKYRLEKIDHRLEVLEGFIIAFLHLDRVIDIIRYDDDPKKALMIEDWAQDHV 423

Query: 419 -----------------SRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKI 461
                               SL+E Q +AILN+RLRSLR+LEE ++ +E D L+ E+  I
Sbjct: 424 RATSEADYRSPIVPGADPEVSLSEVQAEAILNMRLRSLRRLEELELIAERDALMEERAGI 483

Query: 462 DSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPIT 521
           + LL S   QW +IA ++RE ++IF + ++ G RRT F E +   +  L +AMIE+EPIT
Sbjct: 484 EDLLESDDLQWAKIAEQLRETRKIFGRDSEGGARRTQFAEAAEVVEVPL-EAMIEREPIT 542

Query: 522 VVISNRGWIRSLKSHSVDLS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNL 580
           VV S  GW+R++  H +DL+  L FK+GD  +   HA TTD++L+   +G+ YT+ A NL
Sbjct: 543 VVCSQMGWVRAMTGH-IDLTRELKFKDGDGPRFIFHAETTDKLLVFGANGRFYTVGAANL 601

Query: 581 LSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKT 640
             GRG GE ++L+IDL ++ +IV   ++    KLLV S++GN F+V E E++A TR GK 
Sbjct: 602 PGGRGMGEPLRLMIDLPNDVEIVDFLIHKPGEKLLVASAEGNGFVVPEEEVVAQTRSGKQ 661

Query: 641 FLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYK------- 693
            L V  +   K+  +V GDHVAVV EN K L+F + ++PEM+RGKGVR+Q YK       
Sbjct: 662 VLNV-KDTIAKVCHRVVGDHVAVVSENAKFLVFEVGELPEMNRGKGVRIQKYKKASGRQG 720

Query: 694 ----DGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGK 749
               DGG+SD+  F   +GL+W    G++  R+E D+  W G R GVG   P GFP++ +
Sbjct: 721 MLELDGGLSDITTFTWDDGLSWAMGGGKT--RTEPDMTDWKGARAGVGKRPPYGFPKNNR 778

Query: 750 F 750
           F
Sbjct: 779 F 779


>gi|296284413|ref|ZP_06862411.1| DNA topoisomerase IV subunit A [Citromicrobium bathyomarinum JL354]
          Length = 764

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/742 (50%), Positives = 531/742 (71%), Gaps = 18/742 (2%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIG 84
           AL ERYL YALSTI  R++PDLRDG KPVHRR++ AM ++ L   +A+KKSAR+VGEV+G
Sbjct: 25  ALSERYLVYALSTITARSLPDLRDGLKPVHRRLLWAMRQLRLSPDSAYKKSARVVGEVLG 84

Query: 85  KLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELIL 144
           K HPHGD +VYD++VRLAQPF  RYPL+ GQGNFGNIDGD+AAA RYTEAR+T+ A  ++
Sbjct: 85  KYHPHGDTAVYDAMVRLAQPFALRYPLVEGQGNFGNIDGDNAAAARYTEARLTRTAISLM 144

Query: 145 QGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAAL 204
            G+DE  VDF  TYN E+ EPV+FP  FPNLLANG SGIAVGMAT+IPSHNV E+ EA L
Sbjct: 145 AGLDEGTVDFVPTYNNEEEEPVIFPGLFPNLLANGASGIAVGMATNIPSHNVDEVIEATL 204

Query: 205 ALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW-------- 256
            +I+NP +   +L++ + GPD  TGG+IV+S E+I  +Y  GRG FR+RAR+        
Sbjct: 205 EVIENPAVEHARLMQIMQGPDLATGGLIVDSPETISAAYETGRGSFRIRARFHAAEAESA 264

Query: 257 -----CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRI 311
                 +E +G G W ++++EIPYQV K +LIE+IA++I  K++P+LED+RDES E +RI
Sbjct: 265 ADRDAGIERLGGGQWQLIISEIPYQVPKGKLIEQIAQVIADKKVPILEDVRDESDEQIRI 324

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           VL P++R++DP+LL ES++ L+D+ETRF LNMNVL   R P VM L  +L+ W+A + ++
Sbjct: 325 VLVPRSRNVDPELLKESLYRLTDLETRFGLNMNVLDATRTPMVMGLKELLQNWIASQIDI 384

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           L RR+  R+  I  R+E+L+G +IA+LN+D +I IIR ED+PKPVM++ F LT+ Q +AI
Sbjct: 385 LQRRTRHRLAKIADRLELLEGYIIAFLNLDRVIEIIRTEDEPKPVMMAEFGLTDRQTEAI 444

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           LN+RLRSLRKLEE Q++ E D+LL E++++  LL S  +Q  ++  ++  +++ + K T 
Sbjct: 445 LNMRLRSLRKLEEMQLRQEKDDLLKEQDELQKLLESPVRQRTRLKRDLNALRKEYGKDTA 504

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSA-LHFKEGDS 550
           LG RRTT  E     + ++  AMIEKEP TV++S RGWIR+ K H+ DLS    FKEGD 
Sbjct: 505 LGARRTTIDEAEPTVEFSM-DAMIEKEPTTVILSARGWIRAAKGHA-DLSQEWKFKEGDE 562

Query: 551 LKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDS 610
           L  A HA TTD++L+ + DG+ YTL A  L   RG GE ++ ++D++++  IV A+ +  
Sbjct: 563 LAFAFHAQTTDKLLIATDDGRFYTLGADKLPGARGFGEPVRTMVDIDNSAHIVFAWAHKP 622

Query: 611 TCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKV--TGDHVAVVGENR 668
             +LL+ S+ G  F+++  +++A TRKG+  + +  + K+  V  +    DHVAVVG+NR
Sbjct: 623 GERLLLASTLGKGFVIKSDDLLAETRKGRAVMTLKGDAKLARVAHIGEGHDHVAVVGDNR 682

Query: 669 KLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLG 728
           KL++F+++++PEMSRG+GV+LQ Y+DGG++DV  F++ EGL+W         R+E ++  
Sbjct: 683 KLVVFNLEEMPEMSRGQGVQLQRYRDGGMADVTTFRLEEGLSWQMGGTGERTRTEMEMWQ 742

Query: 729 WLGKRGGVGSLVPKGFPRSGKF 750
           W   RGG G + P+GFPR  +F
Sbjct: 743 WKVARGGAGRMPPQGFPRDNRF 764


>gi|315499941|ref|YP_004088744.1| DNA topoisomerase iv, a subunit [Asticcacaulis excentricus CB 48]
 gi|315417953|gb|ADU14593.1| DNA topoisomerase IV, A subunit [Asticcacaulis excentricus CB 48]
          Length = 738

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/720 (52%), Positives = 510/720 (70%), Gaps = 8/720 (1%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIG 84
           AL  RYLAYALSTI  RA+PD+RDG KPVHRR+++AM  M L+  AA +KSA++VGEV+G
Sbjct: 21  ALSRRYLAYALSTIMHRALPDVRDGLKPVHRRVLYAMHNMRLNPQAAARKSAKVVGEVMG 80

Query: 85  KLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELIL 144
             HPHGDQS+YD+LVR+AQ F QRYP++ GQGNFGNIDGDSAAA RYTE +MT  A L+L
Sbjct: 81  NFHPHGDQSIYDALVRMAQWFAQRYPMVDGQGNFGNIDGDSAAAMRYTECKMTTAAMLLL 140

Query: 145 QGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAAL 204
            G+DE+AVDFR TY+ +D EPVV P+ FPNLLANG +GIAVGMATSIP HNV E+ +A  
Sbjct: 141 DGIDENAVDFRPTYDGQDEEPVVLPAAFPNLLANGATGIAVGMATSIPPHNVAELIDACK 200

Query: 205 ALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRG 264
            LI  P      L+  I GPDFPTGGI VE RE+I E+Y  GRG  RVRAR+ VE++GRG
Sbjct: 201 LLIAEPNTDTNGLMAIIPGPDFPTGGICVERREAIYEAYETGRGSVRVRARYEVEDLGRG 260

Query: 265 SWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDL 324
           +W I+V+EIPYQVQKSRLIE++A+LI AK+ PLL D+RDES E+VR++L PK R++DP++
Sbjct: 261 AWRILVSEIPYQVQKSRLIEQLADLIEAKKAPLLGDVRDESDEEVRLILEPKTRNIDPEV 320

Query: 325 LMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAID 384
           LMES+F +SD+ETRF  NMNVL     P+VM L  IL  +L HRREVL R+S +R+  I+
Sbjct: 321 LMESLFKISDLETRFAFNMNVLDKTGTPRVMGLKTILTSFLDHRREVLIRQSQWRLDKIE 380

Query: 385 RRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEE 444
           +R+ +L GL+IA+LN+DE+I IIR ++ PK  +++RF LTE QVD IL+ RLR L +LEE
Sbjct: 381 KRLHVLDGLMIAFLNLDEVIRIIREDETPKQTLMARFELTEVQVDYILDTRLRQLARLEE 440

Query: 445 YQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSR 504
             IK E D L  E++ + SLL S K+QW +I  ++ EV++       L  RRTTF E  +
Sbjct: 441 MAIKGEHDKLSKERDGLLSLLGSEKKQWKRIDEQLTEVRKQL-----LSARRTTFAEAPQ 495

Query: 505 ADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRIL 564
             +    ++ + KE +TV++S RGWIR+ K    D S L FKEGD+L   +  + TD++L
Sbjct: 496 GVEVAAIESYLPKEALTVILSERGWIRATKGRVDDPSELKFKEGDNLGFLVPGYNTDKLL 555

Query: 565 LLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAF 624
           ++++DG+ +TL    L SGRGHGE +QL++++  N  IV  F++    K L+VS  G  F
Sbjct: 556 IMTSDGRFFTLGCDKLPSGRGHGEPLQLMLEMEENTRIVNVFMFTPGAKRLMVSKNGYGF 615

Query: 625 IVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRG 684
           ++ E + + N + GK+ L     E   + + VTGDHV ++GEN K+L++ + ++PEM+RG
Sbjct: 616 VMNEEDAVGNKKAGKSVLNADGTEAF-VALPVTGDHVVILGENNKVLVYPVSELPEMARG 674

Query: 685 KGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGF 744
           KGV+LQ YKDGG+ D+  F     + W D +G++  R   D   ++GKR  VG + P+G 
Sbjct: 675 KGVKLQGYKDGGVKDIAIFDQAGPVQWFDGSGKA--RDFKDWKDFVGKRASVGKMAPRGL 732


>gi|157964133|ref|YP_001498957.1| DNA topoisomerase IV subunit A [Rickettsia massiliae MTU5]
 gi|157843909|gb|ABV84410.1| Topoisomerase IV subunit A [Rickettsia massiliae MTU5]
          Length = 737

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/739 (50%), Positives = 533/739 (72%), Gaps = 4/739 (0%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           E  ++ +    AL ERYLAYALSTI  R++PD+RDG KPVHRR+++AM ++ L+  + +K
Sbjct: 3   EAKIENIDFGNALSERYLAYALSTIMSRSLPDVRDGLKPVHRRLLYAMLQLRLEPNSGYK 62

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K AR+VG+VIGK HPHGD +VYD+LVRLAQ F+ RYPLI GQGNFG+IDGD+AAA RYTE
Sbjct: 63  KCARVVGDVIGKYHPHGDVAVYDTLVRLAQHFLLRYPLIDGQGNFGSIDGDNAAAMRYTE 122

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           +RMT +  L+++ +D+D VDFR TY++ D EPV+ P+ FPNLLANG+ GIAVGMAT+IP 
Sbjct: 123 SRMTDICTLLMEDIDKDTVDFRPTYDDADLEPVIMPAGFPNLLANGSEGIAVGMATNIPP 182

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN+ E+C+A + LID+P+  I  ++ +I GPDFPTGGII++  E I  +Y  GRG  RVR
Sbjct: 183 HNLHELCDALIHLIDHPKAEINDIMNFIKGPDFPTGGIIIDKAEVINAAYTTGRGSLRVR 242

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           +RW  EE+  G++ IVVTEIPYQVQKS+LIE+IA L+  K+IPL+ +IRDES + +R+V+
Sbjct: 243 SRWEKEELSYGTYQIVVTEIPYQVQKSKLIEQIAILLKDKKIPLVSNIRDESTDIIRLVI 302

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            P++R  DP ++MES+F L+++E+R  LNMNV+    VP+VM +  IL+E+L HR+ ++ 
Sbjct: 303 EPRDRGCDPQIVMESLFKLTNLESRIQLNMNVIGSNNVPRVMNILEILQEFLDHRQNIVT 362

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS++ +  I  R+EILKGL IAYLN+DEII IIR ED+PK +M+ RF LTE QV+AI N
Sbjct: 363 RRSTYLLNKIKHRLEILKGLRIAYLNLDEIIKIIREEDEPKAIMMERFKLTEIQVEAIFN 422

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
            RLRSLRKLEE +I +E  NL  ++  ++ +LN+ K+ W  +  EIR V+  F  +T +G
Sbjct: 423 TRLRSLRKLEEQEIINEHSNLQKQQAILEEILNNPKELWKVVKKEIRTVQTKFGLNTVIG 482

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
            RRT+F EV+  ++     A I KEPIT++ S  GW+RSLK H+ DLS + +KEGD+ K 
Sbjct: 483 ARRTSFEEVTLTNQVVDITAFITKEPITIICSKMGWVRSLKGHNTDLSTIKYKEGDAEKF 542

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
            L A+TTD+IL++S++G+ +TL A N+  G+G GE+I+LL+D+ +N DI    VY     
Sbjct: 543 ILEAYTTDKILIVSSEGRFFTLLADNISKGKGTGESIKLLVDIGNN-DITNILVYKPDQL 601

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
           LL+ SS G  F+V  +E++A T+ GK  + V         + V GD +A +GE+RKLL+F
Sbjct: 602 LLLASSVGKGFLVNSNEVMAQTKTGKQIMNVPDGHVCIACLPVNGDSIACIGESRKLLVF 661

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
           +ID+IPEM +G+GV LQ +K+  + D+  F   +GL W ++ G+   + E +++ +LGKR
Sbjct: 662 NIDEIPEMKKGQGVTLQKFKNAKLLDIKIFNKEDGLGW-NNNGKV--KLEKNIVAFLGKR 718

Query: 734 GGVGSLVPKGFPRSGKFLS 752
           G  G L P GFP++ +F S
Sbjct: 719 GSTGKLPPMGFPKNNRFSS 737


>gi|254464900|ref|ZP_05078311.1| DNA topoisomerase IV, A subunit [Rhodobacterales bacterium Y4I]
 gi|206685808|gb|EDZ46290.1| DNA topoisomerase IV, A subunit [Rhodobacterales bacterium Y4I]
          Length = 782

 Score =  778 bits (2008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/763 (51%), Positives = 522/763 (68%), Gaps = 38/763 (4%)

Query: 22  LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGE 81
           LR A+ ERYL YALSTI  RA+PD RDG KPVHRRI++AM+ + L     F KSA+I G+
Sbjct: 23  LRRAIGERYLTYALSTIMHRALPDARDGLKPVHRRILYAMNRLRLSSTGGFLKSAKISGD 82

Query: 82  VIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAE 141
            +G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEARMT VAE
Sbjct: 83  TMGDFHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDGDNPAASRYTEARMTFVAE 142

Query: 142 LILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICE 201
            +L G++E+AVDFRD Y+   +EP V P+ FPN+LANG +GIAVGMAT+IP HN+ E+ +
Sbjct: 143 AMLDGLNENAVDFRDNYDGRLTEPAVLPATFPNILANGAAGIAVGMATNIPPHNIAELID 202

Query: 202 AALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEV 261
           A L LI  P+   + LL Y+ GPDFPTGGIIVE +E+I ++Y  GRG FR+R +  VE++
Sbjct: 203 ACLHLIKTPDARDDTLLNYVPGPDFPTGGIIVEPKENIAKAYSTGRGSFRLRCKHEVEDL 262

Query: 262 GRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLD 321
           GRG W IVVTEIPYQVQKS+LIEKIAELI  K++P+L D+RDESA+D+RIVL PK++++D
Sbjct: 263 GRGQWQIVVTEIPYQVQKSKLIEKIAELIQTKKVPILADVRDESADDIRIVLEPKSKNVD 322

Query: 322 PDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQ 381
           P++LM  +F  SD+E RF LNMNVL  G  P+V  +  +L+ +L HRR+VL RRS  RM+
Sbjct: 323 PEVLMNMMFRNSDLEIRFSLNMNVLIDGVTPKVCSMKEVLRAFLDHRRDVLQRRSRHRME 382

Query: 382 AIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSR--------------------- 420
            ID R+E+L+G +IA+LN+D +I IIR ++ PK  ++                       
Sbjct: 383 KIDHRLEVLEGFIIAFLNLDRVIDIIRYDEDPKAALIREDWSKDHPRALTEADYITPARG 442

Query: 421 -FSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEI 479
              LTE Q +AILN+RLRSLRKLEE ++  E D L  E+  +  LL S + QW++I+ ++
Sbjct: 443 VGELTEVQAEAILNMRLRSLRKLEEIELTRERDALREERAGLVELLASEELQWSRISEQL 502

Query: 480 REVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVD 539
           +E K+ F K  + G RRT F E   A+   L +AMI++EPITVV S  GWIR++  H +D
Sbjct: 503 KETKKQFGKDYEGGARRTLFAEAGEAEDVPL-EAMIDREPITVVCSQMGWIRAMTGH-ID 560

Query: 540 LS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNH 598
           LS  L FK+GD+ +   HA TTD++L+  ++G+ YTL A NL  GRG GE ++L++DL +
Sbjct: 561 LSRELKFKDGDAPRFIFHAETTDKLLVFGSNGRFYTLSAANLPGGRGMGEPLRLMVDLPN 620

Query: 599 NQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG 658
             +IV   +++   +LLV S  GN FI  E EI+A TR GK  L V  +E+ K+ + V G
Sbjct: 621 EAEIVDLLIHNPEGRLLVASDAGNGFICAEKEIVAQTRSGKQVLNVKDDERAKVCIPVEG 680

Query: 659 DHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYK-----------DGGISDVICFKICE 707
           DHVAVV EN K L+F+++++PE++RGKGVRLQ Y            DGG+SD+  F+  E
Sbjct: 681 DHVAVVSENGKFLVFAVEEMPELTRGKGVRLQKYNMARGKQGSLELDGGLSDITTFRWDE 740

Query: 708 GLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           GL W    G++  R   DL  WLGKR  VG   P GFPRS KF
Sbjct: 741 GLKWEMGGGKT--RHAADLSEWLGKRASVGKRPPHGFPRSYKF 781


>gi|157825225|ref|YP_001492945.1| DNA topoisomerase IV subunit A [Rickettsia akari str. Hartford]
 gi|157799183|gb|ABV74437.1| DNA topoisomerase IV subunit A [Rickettsia akari str. Hartford]
          Length = 737

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/739 (50%), Positives = 534/739 (72%), Gaps = 4/739 (0%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           E  ++ +    AL ERYLAYALSTI  R++PD+RDG KPVHRR+++AM ++ L+  + +K
Sbjct: 3   EAKIENIDFGNALSERYLAYALSTIMSRSLPDVRDGLKPVHRRLLYAMLQLKLEPNSGYK 62

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K AR+VG+VIGK HPHGD +VYD+LVRLAQ F  RYPLI GQGNFG+IDGD+AAA RYTE
Sbjct: 63  KCARVVGDVIGKYHPHGDVAVYDTLVRLAQHFSLRYPLIDGQGNFGSIDGDNAAAMRYTE 122

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           +RMT++  L++  +D+D VDFR TY++ D EP++ P+ FPNLLANG+ GIAVGMAT+IP 
Sbjct: 123 SRMTEICTLLMVDIDKDTVDFRPTYDDSDLEPIIMPASFPNLLANGSEGIAVGMATNIPP 182

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN+ E+C+A + LID+P   I  ++ +I GPDFPTGGII++  E I  +Y  GRG FRVR
Sbjct: 183 HNLHELCDALIHLIDHPNAEINDIMNFIKGPDFPTGGIIIDKAEVINAAYNTGRGSFRVR 242

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           +RW  E +  G++ IVVTEIPYQVQKS+LIE++A L+  K+IPL+ +IRDES + +R+V+
Sbjct: 243 SRWEKEALSYGTYQIVVTEIPYQVQKSKLIEQVAILLKDKKIPLVSNIRDESTDIIRLVI 302

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            P++RS DP ++MES+F L+++E+R  LNMNV+    VP+VM +  +L+E+LAHR+ ++ 
Sbjct: 303 EPRDRSCDPQIVMESLFKLTNLESRIQLNMNVIGSNNVPRVMNILEVLQEFLAHRQNIVT 362

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS++ +  I  R+EIL GL IAYLN+DEII IIR ED+PK +M+ RF LTE QV+AILN
Sbjct: 363 RRSTYLVNKIKHRLEILAGLRIAYLNLDEIIKIIREEDEPKAIMMERFKLTEIQVEAILN 422

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
            RLRSLRKLEE++I +E  NL  ++  ++ +LN+ K+ W  +  EI+ V+  F  +T +G
Sbjct: 423 TRLRSLRKLEEHEIINEHSNLQKQQAILEEILNNPKELWKIVKKEIKAVQMQFGLNTVIG 482

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
            RRT+F EV+  ++     A + KEPIT++ S  GW+RSLK H+ DLS + +KEGD+ K 
Sbjct: 483 DRRTSFEEVTLTNQVVDITAFVTKEPITIICSKMGWVRSLKGHNTDLSNIKYKEGDAEKF 542

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
            L A+TTD+IL++S++G+ +TL A N+  G+G GE+I+LL+D+ +N DI    V+     
Sbjct: 543 ILEAYTTDKILIVSSEGRFFTLLADNIPKGKGTGESIKLLVDIGNN-DITNILVHKPDQL 601

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
           LL+ SS G  F+V  +E+IA T+ GK  + V         + V GD VA +GE+RKLL+F
Sbjct: 602 LLLASSVGKGFLVNSNEVIAQTKTGKQVMNVPDGHACIACLHVAGDAVACIGESRKLLVF 661

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
           ++D+IPEM +G+GV LQ +K+  + D+  F   +GL W ++ G+   + E +++ +LG+R
Sbjct: 662 NVDEIPEMKKGQGVTLQKFKNAKLLDIKIFNKEDGLCW-NNNGKV--KLEKNIIAFLGQR 718

Query: 734 GGVGSLVPKGFPRSGKFLS 752
           G  G L P GFP++ +F S
Sbjct: 719 GSTGKLPPMGFPKNNRFSS 737


>gi|94498683|ref|ZP_01305234.1| DNA topoisomerase IV, A subunit [Sphingomonas sp. SKA58]
 gi|94421846|gb|EAT06896.1| DNA topoisomerase IV, A subunit [Sphingomonas sp. SKA58]
          Length = 787

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/746 (51%), Positives = 519/746 (69%), Gaps = 22/746 (2%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA------------- 71
           AL +RYL YALSTI  R++PDLRDG KPVHRR++ AM  + ++ G A             
Sbjct: 44  ALSQRYLVYALSTITARSLPDLRDGLKPVHRRLLWAMRLLRMEPGGASADVLTANPARNT 103

Query: 72  --FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAY 129
             +KK AR+VG+VIGK HPHGD SVYD++VRLAQ F  R PL+ GQGNFGNIDGD+AAA 
Sbjct: 104 TAYKKCARVVGDVIGKYHPHGDASVYDAMVRLAQDFSLRTPLVDGQGNFGNIDGDNAAAM 163

Query: 130 RYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMAT 189
           RYTEAR+TQ A  ++ G+DE  VDFR TYN ED EP VFP  FPNLLANG SGIAVGMAT
Sbjct: 164 RYTEARLTQAAADLMAGLDEGTVDFRPTYNGEDEEPEVFPGLFPNLLANGASGIAVGMAT 223

Query: 190 SIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGG 249
           SIP HNV E+ +AA  LID+P+     L++ + GPDFPTGG++V+S   I E+Y  GRG 
Sbjct: 224 SIPPHNVAELIDAANLLIDDPDADHGALMQIVRGPDFPTGGVLVDSPSIIAEAYATGRGA 283

Query: 250 FRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDV 309
           FR RARW  E+ GRG+W  VVTEIPYQVQKS+LIE+IA LI  K++P+L D+RDES  D+
Sbjct: 284 FRTRARWHKEDHGRGTWIAVVTEIPYQVQKSKLIEQIAALINDKKLPILADVRDESDADI 343

Query: 310 RIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRR 369
           RIV+ P+ R++D  +LM+S+F L+D+E RFPLN+NVL     P+V+ L  +L EWL H+ 
Sbjct: 344 RIVIEPRARTVDDQVLMDSLFRLTDLENRFPLNLNVLDSTHTPRVLGLKPLLVEWLRHQI 403

Query: 370 EVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVD 429
           +VL RR+  R+  I  RVE+L G +IAYLN+D +I IIR ED+PK VM+  F LT+ Q +
Sbjct: 404 DVLVRRARHRLDKIAARVELLDGYIIAYLNLDRVIEIIRTEDEPKEVMMVEFGLTDRQAE 463

Query: 430 AILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKS 489
           AILN+RLRSLRKLEE +++ E D LL E+++++ L+ S  +Q  ++  ++  +++ +   
Sbjct: 464 AILNMRLRSLRKLEEMELRREHDELLKERDELEKLVESPARQRTRLKKDLAALRKRYGPE 523

Query: 490 TDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSA---LHFK 546
           TDLGRRRT   E + A +  L +AMIE+EPITV++S RGWIR++  H  DL+A   L FK
Sbjct: 524 TDLGRRRTLVEEAAPAREIPL-EAMIEREPITVILSERGWIRAMSGHR-DLAAADTLKFK 581

Query: 547 EGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAF 606
           EGD  + A HA+TTD++LL ++ G+ +TL +  L  GRG G+ ++ L+D+++   IV   
Sbjct: 582 EGDGPQFAFHAYTTDKLLLATSTGRVFTLSSDKLPGGRGFGDPVRSLVDMDNEGAIVALM 641

Query: 607 VYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVT--GDHVAVV 664
              +   LL+ SS G  FI   ++I+A TRKGK  + V +  ++ +V  VT   D +AV+
Sbjct: 642 PARAGGDLLLASSDGRGFIAAMADIMAETRKGKQVVNVRAGARLAVVHPVTADADSIAVI 701

Query: 665 GENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSEN 724
           GENRKLL+F+I ++P M+RG+GV+LQ Y+DGG+SD I F++ +GLTW         R+E 
Sbjct: 702 GENRKLLVFAISEMPRMARGQGVQLQRYRDGGLSDAIAFRLADGLTWAMGGDSGRTRNET 761

Query: 725 DLLGWLGKRGGVGSLVPKGFPRSGKF 750
           D+  W   RG  G + P GFPR  +F
Sbjct: 762 DMTPWKVARGAAGRMPPNGFPRDNRF 787


>gi|99082272|ref|YP_614426.1| DNA topoisomerase IV subunit A [Ruegeria sp. TM1040]
 gi|99038552|gb|ABF65164.1| DNA topoisomerase IV subunit A [Ruegeria sp. TM1040]
          Length = 782

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/763 (51%), Positives = 519/763 (68%), Gaps = 38/763 (4%)

Query: 22  LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGE 81
           LR A+ ERYL YALSTI  RA+PD RDG KPVHRRI++AMS + L     F KSA+I G+
Sbjct: 23  LRRAIGERYLTYALSTIMHRALPDARDGLKPVHRRILYAMSRLRLSSSGGFLKSAKISGD 82

Query: 82  VIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAE 141
            +G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEARMT +AE
Sbjct: 83  TMGDFHPHGDAAIYDAMARLAQDFAVRYPLVDGQGNFGNIDGDNPAASRYTEARMTFIAE 142

Query: 142 LILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICE 201
            +L+G+ EDAVDFRD Y+    EP V P+ FPN+LANG SGIAVGMAT+IP HN+ E+ +
Sbjct: 143 AMLEGLGEDAVDFRDNYDGRLQEPSVLPATFPNILANGASGIAVGMATNIPPHNISELID 202

Query: 202 AALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEV 261
           A + LI  P  + + LL+Y+ GPDFPTGG IVE +E+I ++YR GRG FR+RA+  +E++
Sbjct: 203 ACVHLIKAPNAADDTLLQYVPGPDFPTGGTIVEPKENIAQAYRTGRGSFRLRAKHEIEDL 262

Query: 262 GRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLD 321
           GRG W +VVTEIPYQVQKS+LIEKIAELI  K++P+L D+RDESAED+RI+L PK++++D
Sbjct: 263 GRGQWQVVVTEIPYQVQKSKLIEKIAELIQTKKVPILADVRDESAEDIRIILEPKSKNVD 322

Query: 322 PDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQ 381
           P++LM  +   SD+E RF LNMNVL  G  P+V  +  +L+ +L HRR+VL RRS  RM 
Sbjct: 323 PEVLMGLMHRNSDLEVRFSLNMNVLIDGVTPKVCSMKEVLRAFLDHRRDVLQRRSRHRMA 382

Query: 382 AIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSR---------FS---------- 422
            ID R+E+L G +IA+LN+D +I IIR ++ PK  ++           F+          
Sbjct: 383 KIDHRLEVLDGFIIAFLNLDRVIDIIRYDEDPKAALMRENWDREHPRAFTEAEYVTPAAG 442

Query: 423 ---LTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEI 479
              L+E Q +AILN+RLRSLRKLEE ++  E D L  E+  +  LL S + QW +I  ++
Sbjct: 443 DGELSEVQAEAILNMRLRSLRKLEEIELTRERDALREERAGLVELLGSEELQWKKITEQL 502

Query: 480 REVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVD 539
           RE K+ F K+ + G RRT F E    +   L +AMI++EPITVV S  GWIR++  H +D
Sbjct: 503 RETKKQFGKNYEGGARRTQFAEAGEIEDVPL-EAMIDREPITVVCSQMGWIRAMTGH-ID 560

Query: 540 LS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNH 598
           LS  L FK+GD  +   HA TTDR+L+  ++G+ YTL A NL  GRG GE ++L++DL +
Sbjct: 561 LSRELKFKDGDGPRFIFHAETTDRLLVFGSNGRFYTLSAANLPGGRGMGEPVRLMVDLPN 620

Query: 599 NQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG 658
             +IV  F+++   +LLV S  GN F+  E +I+A TR GK  L V  +E+ K+ + V G
Sbjct: 621 EVEIVDLFIHNPEGRLLVASDAGNGFVCAEKDIVAQTRGGKQVLNVKDDERAKICIPVAG 680

Query: 659 DHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYK-----------DGGISDVICFKICE 707
           DHVAVV EN K L+F+I+++PE++RGKGVRLQ Y            DGG++DV  F   E
Sbjct: 681 DHVAVVSENGKFLVFAIEEMPELTRGKGVRLQKYNMARGRQGALELDGGLADVTTFNWDE 740

Query: 708 GLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           GL W    G+   R E DL  WLGKR G+G   P GFP+  KF
Sbjct: 741 GLHWEMGGGKI--RHETDLTQWLGKRAGIGKRPPYGFPKDYKF 781


>gi|114764505|ref|ZP_01443730.1| DNA topoisomerase IV subunit A [Pelagibaca bermudensis HTCC2601]
 gi|114543072|gb|EAU46091.1| DNA topoisomerase IV subunit A [Roseovarius sp. HTCC2601]
          Length = 807

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/795 (49%), Positives = 528/795 (66%), Gaps = 67/795 (8%)

Query: 19  AVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARI 78
           A  LR A+ +RYL YALSTI  RA+PD RDG KPVHRRI++AM  + L     F KSA+I
Sbjct: 16  AEPLRRAIGDRYLTYALSTIMNRALPDARDGLKPVHRRILYAMRRLRLSSNGGFLKSAKI 75

Query: 79  VGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQ 138
            G+ +G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEARMT 
Sbjct: 76  SGDTMGDFHPHGDAAIYDAMARLAQDFTIRYPLVDGQGNFGNIDGDNPAASRYTEARMTI 135

Query: 139 VAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQE 198
           +AE +L G+DE++VDFR  Y+    EP V P+ +PNLLANG+SGIAVGMAT+IP HN+ E
Sbjct: 136 MAEALLDGLDENSVDFRPNYDGRLEEPSVLPASYPNLLANGSSGIAVGMATNIPPHNIGE 195

Query: 199 ICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCV 258
           + +A L LI  P    + LL+Y+ GPDFPTGG+IVE R++I ++YR GRG  R+RA+W V
Sbjct: 196 LIDACLHLIKAPGAGDDTLLQYVPGPDFPTGGVIVEPRDNIAQAYRTGRGSIRLRAKWEV 255

Query: 259 EEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNR 318
           E++GRG W  VVTEIPYQVQKS+L+E++AELI  K++P+L DIRDESAED+R+VL PK++
Sbjct: 256 EDLGRGQWQAVVTEIPYQVQKSKLVERLAELIQTKKVPILADIRDESAEDIRMVLEPKSK 315

Query: 319 SLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSF 378
           ++DPDLLM  +F  SD+ETRF LNMNVL  G  P+V  L  +L+ +L  RR+VL RR+  
Sbjct: 316 NVDPDLLMNMLFKNSDLETRFSLNMNVLIDGVTPKVCSLKEVLRAFLDFRRDVLCRRARH 375

Query: 379 RMQAIDRRVEILKGLLIAYLNIDEII----------AIIRNEDKPKPVMVS--------- 419
           RM  ID R+E+L+GL+IA+LN+D +I          A +  ED  KP   +         
Sbjct: 376 RMAKIDNRLEVLEGLIIAFLNLDRVIDIIRYDDDPKAALMYEDWSKPHQATIARATDERD 435

Query: 420 --------------------------------------RFS-----LTENQVDAILNLRL 436
                                                 RF      L++ Q +AILN+RL
Sbjct: 436 YRSPLAGIDVKALELRPDPEAEARGVLADEGTPTQIPQRFGGRSEGLSDVQAEAILNMRL 495

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           RSLR+LEE ++ +E D L+ E+  ++ LL S   QW +++ ++REVK+ F+K  D G R 
Sbjct: 496 RSLRRLEELELVNERDKLMEERAGLEDLLASEDLQWKRVSEQLREVKKAFAKDLDRGARL 555

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLS-ALHFKEGDSLKIAL 555
           TTF E   A+   L+ AMIE+EPITVV S  GWIR++  H +DL+  L FK+GD  +   
Sbjct: 556 TTFAEAGEAEDVPLE-AMIEREPITVVCSQMGWIRAMTGH-IDLNRELKFKDGDGPRFIF 613

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
           HA TTD++L++ ++G+ YTL A NL  GRG GE ++L++DL +  +I    V+    KLL
Sbjct: 614 HAETTDKLLVVGSNGRFYTLSAANLPGGRGMGEPVRLMVDLPNEAEIHDLLVHTPGRKLL 673

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSI 675
           V SS G+ FIV E++++A TR GK  L V    K ++   VTGD VAVVGENRK+L+F +
Sbjct: 674 VASSAGDGFIVPENDVLAQTRSGKQVLNVKDGVKTQVCKPVTGDAVAVVGENRKVLVFML 733

Query: 676 DQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGG 735
           D++PEM RGKGVRLQ YKDGG+SD   F + +GL+W D AGR+  R+E  L  W+GKR G
Sbjct: 734 DELPEMGRGKGVRLQKYKDGGLSDATTFTLADGLSWKDPAGRT--RTEAALDEWIGKRAG 791

Query: 736 VGSLVPKGFPRSGKF 750
            G + P+GFPR   F
Sbjct: 792 SGRMAPRGFPRDNTF 806


>gi|260429086|ref|ZP_05783063.1| DNA topoisomerase IV, A subunit [Citreicella sp. SE45]
 gi|260419709|gb|EEX12962.1| DNA topoisomerase IV, A subunit [Citreicella sp. SE45]
          Length = 807

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/811 (48%), Positives = 534/811 (65%), Gaps = 68/811 (8%)

Query: 3   VDNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMS 62
           +++I +   +   NV A  LR A+ ERYL YALSTI  RA+PD RDG KPVHRRI++AM 
Sbjct: 1   MNDIVDDPNMNPRNV-AEPLRRAIGERYLTYALSTIMNRALPDARDGLKPVHRRILYAMR 59

Query: 63  EMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNID 122
            + L     F KSA+I G+ +G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNID
Sbjct: 60  RLRLSSSGGFLKSAKISGDTMGDFHPHGDAAIYDAMARLAQDFTIRYPLVDGQGNFGNID 119

Query: 123 GDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSG 182
           GD+ AA RYTEARMT +AE +L+G+DED+VDFR  Y+    EP V P+ +PNLLANG SG
Sbjct: 120 GDNPAASRYTEARMTIMAEALLEGLDEDSVDFRPNYDGRLEEPTVLPASYPNLLANGASG 179

Query: 183 IAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVES 242
           IAVGMAT+IP HN+ E+ +A L LI  P+   E LL Y+ GPDFPTGG+IVE RE+I E+
Sbjct: 180 IAVGMATNIPPHNIGELIDACLHLIKTPDARDETLLNYVPGPDFPTGGVIVEPRENIAEA 239

Query: 243 YRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIR 302
           YR GRG  R+RA+W VE++GRG W  VVTEIPYQVQKS+L+E++AELI  K++P+L DIR
Sbjct: 240 YRTGRGSIRLRAKWEVEDLGRGMWQAVVTEIPYQVQKSKLVERLAELIQTKKVPILADIR 299

Query: 303 DESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILK 362
           DESAEDVR+VL PK +++DPD+LM  +F  SD+E RF LNMNVL  G  P+V  L  +L+
Sbjct: 300 DESAEDVRMVLEPKTKNVDPDVLMNMLFRNSDLEIRFSLNMNVLIDGLTPKVCSLKEVLR 359

Query: 363 EWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVM----- 417
            +L  RR+VL RRS  RM  ID R+E+L+GL+IA+LN+D +I IIR +D PK  +     
Sbjct: 360 AFLDFRRDVLCRRSRHRMAKIDNRLEVLEGLIIAFLNLDRVIDIIRYDDDPKAALMYEDW 419

Query: 418 -------VSRFSLTENQVDAILNLRLRSL------------------------------- 439
                  +SR +   + V  +L + +++L                               
Sbjct: 420 SKPHQATISRATDDSDYVSPLLGVDVKALELRPDPEAVARGVLADEGGPGTIPQRFGGRS 479

Query: 440 -------------------RKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIR 480
                              R+LEE ++ +E D L+ E+  ++ LL S + QW +I+ ++R
Sbjct: 480 EGLSDVQAEAILNMRLRSLRRLEELELVNERDKLMEERAGLEDLLASDELQWKRISEQLR 539

Query: 481 EVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDL 540
           EVK+ F+K  D G R T+F E   A++  L +AMIE+EPITVV S  GWIR++  H +DL
Sbjct: 540 EVKKSFAKDLDRGARLTSFAEAGEAEEVPL-EAMIEREPITVVCSQMGWIRAMTGH-IDL 597

Query: 541 S-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHN 599
           +  L FK+GD  +   HA TTD++L+  T+G+ YTL A +L  GRG GE ++L++DL + 
Sbjct: 598 NRELKFKDGDGPRFVFHAETTDKLLVFGTNGRFYTLAAASLPGGRGMGEPLRLMVDLPNE 657

Query: 600 QDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGD 659
            +I+  F++    +LLV SS G+ F+V E+E++A TR GK  L V    K K+   V+GD
Sbjct: 658 AEILDIFIHQPDRRLLVASSAGDGFVVPEAEVLAQTRAGKQVLNVKDGVKAKVCKPVSGD 717

Query: 660 HVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSY 719
            VAVVGENRK+L+F  D++PEM RGKGVRLQ YKDGG+SDV  F + +GL+W D AGR+ 
Sbjct: 718 AVAVVGENRKVLVFMADELPEMGRGKGVRLQKYKDGGMSDVTTFTLTDGLSWRDPAGRT- 776

Query: 720 NRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
            R+E +L  W+GKR   G + P+GFPR   F
Sbjct: 777 -RTETNLEEWIGKRATSGRMAPRGFPRDNTF 806


>gi|163739412|ref|ZP_02146822.1| DNA topoisomerase IV, A subunit [Phaeobacter gallaeciensis BS107]
 gi|163740201|ref|ZP_02147595.1| DNA topoisomerase IV subunit A [Phaeobacter gallaeciensis 2.10]
 gi|161386059|gb|EDQ10434.1| DNA topoisomerase IV subunit A [Phaeobacter gallaeciensis 2.10]
 gi|161387165|gb|EDQ11524.1| DNA topoisomerase IV, A subunit [Phaeobacter gallaeciensis BS107]
          Length = 782

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/763 (50%), Positives = 523/763 (68%), Gaps = 38/763 (4%)

Query: 22  LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGE 81
           LR A+ ERYL YALSTI  RA+PD RDG KPVHRRI++AMS + L     F KSA+I G+
Sbjct: 23  LRRAIGERYLTYALSTIMHRALPDARDGLKPVHRRILYAMSRLRLTSTGGFLKSAKISGD 82

Query: 82  VIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAE 141
            +G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEARMT VAE
Sbjct: 83  TMGDFHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDGDNPAASRYTEARMTFVAE 142

Query: 142 LILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICE 201
            +L+G+ E+AVDFRD Y+   +EP V P+ FPN+LANG +GIAVGMAT+IP HN+ E+ +
Sbjct: 143 AMLEGLSENAVDFRDNYDGRLTEPAVLPATFPNILANGAAGIAVGMATNIPPHNIGELID 202

Query: 202 AALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEV 261
           A L LI  P+   + LL Y+ GPDFPTGGIIVE +E+I ++Y  GRG FR+R    VE++
Sbjct: 203 ACLHLIKTPDARDDTLLNYVPGPDFPTGGIIVEPKENIAKAYNTGRGSFRLRCTHEVEDL 262

Query: 262 GRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLD 321
           GRG W IV+TEIPYQVQKS+LIEKIAELI  K+IP+L D+RDESAED+RIVL PK++++D
Sbjct: 263 GRGQWQIVITEIPYQVQKSKLIEKIAELIQTKKIPILADVRDESAEDIRIVLEPKSKNVD 322

Query: 322 PDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQ 381
           P++LM  +F  SD+E RF LNMNVL  G  P+V  +  +L+ +L HRR+VL RRS  RM 
Sbjct: 323 PEVLMNMMFRNSDLEIRFSLNMNVLIDGVTPKVCSMKEVLRAFLDHRRDVLQRRSQHRMD 382

Query: 382 AIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVM----------------------VS 419
            ID R+E+L+G +IA+LN+D +I IIR +D PK  +                      + 
Sbjct: 383 KIDHRLEVLEGFIIAFLNLDRVIDIIRYDDDPKAALMRENWSLDHPRAYTEADYVSPAIG 442

Query: 420 RFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEI 479
              LTE Q +AILN+RLRSLR+LEE ++  E D L  E+  +  LL S   QW++IA ++
Sbjct: 443 AGELTEVQAEAILNMRLRSLRRLEEIELVRERDALREERAGLVELLASEDLQWSRIAEQL 502

Query: 480 REVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVD 539
           ++ K+ F K+ + G RRT F E    ++  L +AMI++EPITVV S  GWIR++  H +D
Sbjct: 503 KDTKKQFGKTYEGGPRRTRFAEAGEVEEVPL-EAMIDREPITVVCSQMGWIRAMTGH-ID 560

Query: 540 LS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNH 598
           L   L FK+GD  +   HA TTDR+L+ +++G+ YT+ A NL  GRG GE ++L++DL +
Sbjct: 561 LGRELKFKDGDGPRFIFHAETTDRLLVFASNGRFYTISASNLPGGRGMGEPLRLMVDLPN 620

Query: 599 NQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG 658
             +IV   +++   +LLV S  GN FI  E +I+A TR GK  L V  +++ K+ ++VTG
Sbjct: 621 EVEIVDILIHNPEGRLLVASDAGNGFICAEKDIVAQTRSGKQVLNVKDDDRAKICIRVTG 680

Query: 659 DHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYK-----------DGGISDVICFKICE 707
           DHVAVV EN K L+F+++++PE++RGKGVRLQ Y            DGG+SDV  F   +
Sbjct: 681 DHVAVVSENGKFLVFAVEEMPELTRGKGVRLQKYNMARGKQGSLELDGGLSDVTTFNWDD 740

Query: 708 GLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           G++W    G++  R E DL  WLGKR G+G   P GFPR+ KF
Sbjct: 741 GISWEMGGGKT--RHETDLGQWLGKRAGIGKRPPYGFPRNYKF 781


>gi|86135755|ref|ZP_01054334.1| DNA topoisomerase IV, A subunit [Roseobacter sp. MED193]
 gi|85826629|gb|EAQ46825.1| DNA topoisomerase IV, A subunit [Roseobacter sp. MED193]
          Length = 781

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/763 (50%), Positives = 522/763 (68%), Gaps = 38/763 (4%)

Query: 22  LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGE 81
           LR A+ ERYL YALSTI  RA+PD RDG KPVHRRI++AM+ + L     F KSA+I G+
Sbjct: 22  LRRAIGERYLTYALSTIMHRALPDARDGLKPVHRRILYAMNRLRLSSTGGFLKSAKISGD 81

Query: 82  VIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAE 141
            +G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEARMT +AE
Sbjct: 82  TMGDFHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDGDNPAASRYTEARMTFIAE 141

Query: 142 LILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICE 201
            +L+G++ED+VDFRD Y+   +EP V P+ FPN+LANG +GIAVGMAT+IP HN+ E+ +
Sbjct: 142 AMLEGLNEDSVDFRDNYDGRLTEPAVLPATFPNILANGAAGIAVGMATNIPPHNIAELID 201

Query: 202 AALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEV 261
           A + LI +P    + LL+Y+ GPDFPTGGIIVE R++I ++YR GRG FR+R    VE++
Sbjct: 202 ACIHLIKSPGADDDTLLKYVPGPDFPTGGIIVEPRDNIAKAYRTGRGSFRLRCTHEVEDL 261

Query: 262 GRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLD 321
           GRG W IVVTEIPYQVQKS+LIEKIAELI  K++P+L DIRDESAED+RIVL PK++++D
Sbjct: 262 GRGQWQIVVTEIPYQVQKSKLIEKIAELIQTKKVPILADIRDESAEDIRIVLEPKSKNVD 321

Query: 322 PDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQ 381
           PD+LM  +F  SD+E RF LNMNVL  G  P+V  +  +L+ +L HRR+VL RRS +RM 
Sbjct: 322 PDVLMNMMFRNSDLELRFSLNMNVLIDGVTPKVCSMKEVLRAFLDHRRDVLRRRSEYRMG 381

Query: 382 AIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMV----------------------S 419
            ID R+E+L G +IA+LN+D +I IIR ++ PK  ++                       
Sbjct: 382 KIDHRLEVLDGFIIAFLNLDRVIDIIRYDEDPKSALMRENWGLDHPRAYEESDYVTPAPG 441

Query: 420 RFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEI 479
              L+E Q +AILN+RLRSLR+LEE ++  E D L  E+  +  LL S   QW++I  ++
Sbjct: 442 EGELSEVQAEAILNMRLRSLRRLEEVELTKERDALREERAGLVELLGSDDLQWSKITEQL 501

Query: 480 REVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVD 539
           R  K+ F K    G RR+ F E    ++  L +AMI++EPITVV S  GWIR++  H +D
Sbjct: 502 RATKKQFGKDYVGGARRSRFAEAGEVEEVPL-EAMIDREPITVVCSQMGWIRAMTGH-ID 559

Query: 540 LS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNH 598
           L+  L FK+GD  +   HA TTDR+L+  ++G+ YT+ A NL  GRG GE ++L++DL +
Sbjct: 560 LNRELKFKDGDGARFIFHAETTDRLLVFGSNGRFYTVSAANLPGGRGMGEPLRLMVDLPN 619

Query: 599 NQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG 658
             +IV   +++   KLLV SS GN FI  E +I+A TR GK  L V  +++ ++ + VTG
Sbjct: 620 EVEIVDILIHNPEGKLLVASSAGNGFICAEKDIVAQTRTGKQVLNVKDDDRAQICIPVTG 679

Query: 659 DHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYK-----------DGGISDVICFKICE 707
           DHVA+V EN K L+FS++++PE++RGKGVRLQ Y            DGG+SD+  F   E
Sbjct: 680 DHVAIVSENGKFLVFSVEEMPELTRGKGVRLQKYNMARGKQGSLELDGGLSDITTFNWDE 739

Query: 708 GLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           G++W    G++  R E DL  WLGKR G+G   P GFPR+ KF
Sbjct: 740 GISWEMGGGKT--RHETDLSQWLGKRAGIGKRPPYGFPRNYKF 780


>gi|229586309|ref|YP_002844810.1| DNA topoisomerase IV subunit A [Rickettsia africae ESF-5]
 gi|228021359|gb|ACP53067.1| Topoisomerase IV subunit A [Rickettsia africae ESF-5]
          Length = 738

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/739 (50%), Positives = 531/739 (71%), Gaps = 4/739 (0%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           E  V+ +    AL ERYLAYALSTI  R++PD+RDG KPVHRR+++AM ++ L+  + +K
Sbjct: 3   EAKVENIDFGNALSERYLAYALSTIMSRSLPDVRDGLKPVHRRLLYAMLQLRLEPNSGYK 62

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K AR+VG+VIGK HPHGD +VYD+LVRLAQ F  RYPLI GQGNFG+IDGD+AAA RYTE
Sbjct: 63  KCARVVGDVIGKYHPHGDVAVYDTLVRLAQHFSLRYPLIDGQGNFGSIDGDNAAAMRYTE 122

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           +RMT +  L+++ +D+D VDFR TY+  D EPV+ P+ FPNLLANG+ GIAVGMAT+IP 
Sbjct: 123 SRMTDICTLLMEDIDKDTVDFRPTYDGADLEPVIMPASFPNLLANGSEGIAVGMATNIPP 182

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN+ E+C+A + LI++P+  I  ++ ++ GPDFPTGGII++  E I  +Y  GRG  RVR
Sbjct: 183 HNLHELCDALIHLINHPKAEINDIINFVKGPDFPTGGIIIDKAEVINAAYTTGRGSLRVR 242

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           +RW  EE+  G++ IVVTEIPYQVQKS+LIE+IA L+  K+IPL+ +IRDES + +R+V+
Sbjct: 243 SRWEKEELSYGTYQIVVTEIPYQVQKSKLIEQIAILLKDKKIPLVSNIRDESTDIIRLVI 302

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            P++R  DP ++MES+F L+++E+R  LNMNV+    VP+VM +  IL+E+L HR+ ++ 
Sbjct: 303 EPRDRGCDPQIVMESLFKLTNLESRIQLNMNVIGSNNVPRVMNILEILQEFLYHRQNIVT 362

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS++ +  I  R+EILKGL IAYLN+DEII IIR ED PK +M+ RF LTE QV+AILN
Sbjct: 363 RRSTYLLNKIKHRLEILKGLRIAYLNLDEIIKIIREEDAPKAIMMERFKLTEIQVEAILN 422

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
            RLRSLRKLEE +I +E  NL  ++  ++ +LN+ K+ W  +  EI+ V+  F  +T +G
Sbjct: 423 TRLRSLRKLEEQEIINEHSNLQKQQAILEEILNNPKELWKIVKKEIKTVQTKFGLNTVIG 482

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
            RRT+F EV+  ++     A I KEPIT++ S  GW+RSLK H+ DLS + +KEGD+ K 
Sbjct: 483 ARRTSFEEVTLTNQVVDITAFITKEPITIICSKMGWVRSLKGHNTDLSTIKYKEGDAEKF 542

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
            L A+TTD+IL++S++G+ +TL A N+  G+G GE+I+LL+D+ +N DI    VY     
Sbjct: 543 ILEAYTTDKILIVSSEGRFFTLLADNISKGKGTGESIKLLVDIGNN-DITNILVYKPDQL 601

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
           LL+ SS G  F+V  +E++A T+ GK  + V         + V GD +A +GE+RKLL+F
Sbjct: 602 LLLASSVGKGFLVNSNEVMAQTKTGKQIMNVPDGHVCIACLPVNGDSIACIGESRKLLVF 661

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
           +ID+IPEM +G+GV LQ +K+  + D+  F   +GL W ++ G+   + E +++ +LGKR
Sbjct: 662 NIDEIPEMKKGQGVTLQKFKNAKLLDIKIFNKEDGLGW-NNNGKV--KLEKNIVAFLGKR 718

Query: 734 GGVGSLVPKGFPRSGKFLS 752
           G  G L P GFP++ +F S
Sbjct: 719 GSTGKLPPMGFPKNNRFSS 737


>gi|241761963|ref|ZP_04760048.1| DNA topoisomerase IV, A subunit [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|241373643|gb|EER63215.1| DNA topoisomerase IV, A subunit [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 748

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/741 (52%), Positives = 525/741 (70%), Gaps = 7/741 (0%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           EN+   +   AL ERYLAYALSTI  R++PD+RDG KPV RR++ AM  + LD  +A+KK
Sbjct: 9   ENISETAFDKALSERYLAYALSTITSRSLPDIRDGLKPVQRRLLWAMRLLKLDPASAYKK 68

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEA 134
            AR+VG+VIGK HPHGDQSVYD++VRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTEA
Sbjct: 69  CARVVGDVIGKYHPHGDQSVYDAMVRLAQDFALRYPLVDGQGNFGNIDGDNAAAMRYTEA 128

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           R+T  A  +++G++E AVDFR TYN E+ EP  F   FPNLLANG+SGIAVGMATSIP H
Sbjct: 129 RLTTAAYDLMEGMEEGAVDFRPTYNSEEEEPEFFSGLFPNLLANGSSGIAVGMATSIPPH 188

Query: 195 NVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
           NV E+ +A   LID+PE   ++LL ++ GPDFPTGG IV+S ++I  +Y  GRG FRVRA
Sbjct: 189 NVAELIDAICHLIDHPEAETKELLRFVKGPDFPTGGQIVDSVDTIRHAYETGRGSFRVRA 248

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLF 314
           R+ VE++GRG W IV+ EIP+Q+ KSRLIE+IA LI  K++P+L DIRDES E++RIVL 
Sbjct: 249 RYEVEDIGRGGWIIVIHEIPWQIPKSRLIEEIAALINEKKLPILSDIRDESDENIRIVLE 308

Query: 315 PKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFR 374
           PK+R++DP LLM+ +F L+ +ETR  LNMNVL     P V+PL  +LKEWLAH+  +L R
Sbjct: 309 PKSRTVDPQLLMDGLFHLTSLETRISLNMNVLDSHHTPAVLPLHTVLKEWLAHQFAMLQR 368

Query: 375 RSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNL 434
           R   R+Q ID RVE+L+G L AYLN+D +I IIRNED PK VM++ F L++ Q +AILN+
Sbjct: 369 RCRHRLQRIDDRVELLEGYLAAYLNLDRVIEIIRNEDDPKSVMIAEFKLSDRQAEAILNM 428

Query: 435 RLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGR 494
           RLR+L++LEE +I +E D+L  E+  + +L+ S   Q  ++  ++  +++ +S  + LG 
Sbjct: 429 RLRALKRLEEAEITAERDSLKEERAGLQALIESDALQSKKLKSDLSALRKRYSLKSKLGA 488

Query: 495 RRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLS---ALHFKEGDSL 551
           R+T   E + A KA    AMIE+EP+TVV+S RGWIR LK H VDL    A+ FKEGD  
Sbjct: 489 RQTLIEEQTPA-KAIPLDAMIEREPMTVVLSKRGWIRGLKGH-VDLKSTEAMRFKEGDEA 546

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
               HA+TTDR+L+ + DG+ YTL A  L  GRG GE ++L++D++++  I+     +  
Sbjct: 547 DFICHAYTTDRLLIATEDGRFYTLLADRLPGGRGFGEPVRLMLDISNDTKIMALLPLNPE 606

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKL--VVKVTGDHVAVVGENRK 669
            KLLVVSS G  FI + + ++A TRKGK  ++V  +E + +  V++   DH+A++GENRK
Sbjct: 607 GKLLVVSSSGRGFITQMTNLVAETRKGKQIVRVKKDEYLMVLKVIEEDHDHIALIGENRK 666

Query: 670 LLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGW 729
           LL F + QIPE+++G GV+LQ Y+ G +SD   F + EGL+W         R+E D+  W
Sbjct: 667 LLAFPLSQIPELAKGSGVQLQRYRGGHLSDATTFTLEEGLSWPMGGESGRIRTETDMKTW 726

Query: 730 LGKRGGVGSLVPKGFPRSGKF 750
           +  RG  G L P GFP++ +F
Sbjct: 727 VVARGASGRLPPVGFPKNNRF 747


>gi|67458499|ref|YP_246123.1| DNA topoisomerase IV subunit A [Rickettsia felis URRWXCal2]
 gi|75537034|sp|Q4UNA0|PARC_RICFE RecName: Full=DNA topoisomerase 4 subunit A; AltName:
           Full=Topoisomerase IV subunit A
 gi|67004032|gb|AAY60958.1| Topoisomerase IV subunit A [Rickettsia felis URRWXCal2]
          Length = 737

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/739 (50%), Positives = 536/739 (72%), Gaps = 4/739 (0%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           E  ++ +    AL ERYLAYALSTI  R++PD+RDG KPVHRR+++AM ++ L+  + +K
Sbjct: 3   EAKIENIDFGNALSERYLAYALSTIMSRSLPDVRDGLKPVHRRLLYAMLQLRLEPNSGYK 62

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K AR+VG+VIGK HPHGD +VYD+LVRLAQ F  RYPLI GQGNFG+IDGD+AAA RYTE
Sbjct: 63  KCARVVGDVIGKYHPHGDVAVYDTLVRLAQHFSLRYPLIDGQGNFGSIDGDNAAAMRYTE 122

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           +RMT++  L++  +++D VDFR TY++ D EPV+ P+ FPNLLANG+ GIAVGMAT+IP 
Sbjct: 123 SRMTEICTLLMVDIEKDTVDFRPTYDDSDLEPVIMPASFPNLLANGSEGIAVGMATNIPP 182

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN+ E+C+A + LID+P+  I  ++ +I GPDFPTGGII++  E I  +Y  GRG FR+R
Sbjct: 183 HNLHELCDALVHLIDHPKAEISDMMNFIKGPDFPTGGIIIDKAELINAAYSTGRGSFRMR 242

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           +RW  EE+  G++ IVVTEIPYQVQKS+LIE+IA L+  K+IPL+ +IRDES + +R+V+
Sbjct: 243 SRWEKEELSYGTYQIVVTEIPYQVQKSKLIEQIAILLKDKKIPLVSNIRDESTDIIRLVI 302

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            P++R  DP ++MES+F L+++E+R  LNMNV+    VP+VM +  +L+E+LAHR+ ++ 
Sbjct: 303 EPRDRGCDPQIVMESLFKLTNLESRIQLNMNVIGSNNVPRVMNILEVLQEFLAHRQNIVT 362

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS++ +  I  R+EIL+GL IAYLN+DEII IIR ED+PK +M+ RF LTE QV+AILN
Sbjct: 363 RRSTYLLNKIKHRLEILEGLRIAYLNLDEIIKIIREEDEPKAIMMERFKLTEIQVEAILN 422

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
            RLRSLRKLEE +I +E  NL  ++  ++ +LN+ K+ W  +  EI+ V+  F  +T +G
Sbjct: 423 TRLRSLRKLEEQEIINEHSNLQKQQAILEEILNNPKELWKIVKKEIKAVQTKFGLNTVIG 482

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
            RRT+F EV+  ++     A I KEPIT++ S  GW+RSLK H+ DLS + +KEGD+ K 
Sbjct: 483 ARRTSFEEVTLTNQVVDITAFITKEPITIICSKMGWVRSLKGHNTDLSTIKYKEGDAEKF 542

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
            + A+TTD+IL++S++G+ +TL A N+  G+G GE+I+LL+D+ +N DI    V+ S   
Sbjct: 543 IIEAYTTDKILIVSSEGRFFTLLADNISKGKGTGESIKLLVDIGNN-DITNILVHKSDQL 601

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
           LL+ SS G  F+V  +E++A T+ GK  + V         + V GD +A +GE+RKLL+F
Sbjct: 602 LLLASSIGKGFLVNSNEVMAQTKTGKQIMNVPDGHTCIACLPVNGDSIACIGESRKLLVF 661

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
           +ID+IPEM +G+GV LQ +K+  + D+  F   +GL+W ++ G+   + E +++ +LGKR
Sbjct: 662 NIDEIPEMKKGQGVTLQKFKNAKLLDIKIFNKEDGLSW-NNNGKV--KLEKNIIAFLGKR 718

Query: 734 GGVGSLVPKGFPRSGKFLS 752
           G  G L P GF ++ +F S
Sbjct: 719 GSTGKLPPMGFHKNNRFSS 737


>gi|260752502|ref|YP_003225395.1| DNA topoisomerase IV subunit A [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258551865|gb|ACV74811.1| DNA topoisomerase IV, A subunit [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 748

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/741 (52%), Positives = 525/741 (70%), Gaps = 7/741 (0%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           EN+   +   AL ERYLAYALSTI  R++PD+RDG KPV RR++ AM  + LD  +A+KK
Sbjct: 9   ENISETAFDKALSERYLAYALSTITSRSLPDIRDGLKPVQRRLLWAMRLLKLDPASAYKK 68

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEA 134
            AR+VG+VIGK HPHGDQSVYD++VRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTEA
Sbjct: 69  CARVVGDVIGKYHPHGDQSVYDAMVRLAQDFALRYPLVDGQGNFGNIDGDNAAAMRYTEA 128

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           R+T  A  +++G++E AVDFR TYN E+ EP  F   FPNLLANG+SGIAVGMATSIP H
Sbjct: 129 RLTTAAYDLMEGMEEGAVDFRPTYNSEEEEPEFFSGLFPNLLANGSSGIAVGMATSIPPH 188

Query: 195 NVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
           NV E+ +A   LID+PE   ++LL ++ GPDFPTGG IV+S ++I  +Y  GRG FRVRA
Sbjct: 189 NVAELIDAICHLIDHPEAETKELLRFVKGPDFPTGGQIVDSVDTIRHAYETGRGSFRVRA 248

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLF 314
           R+ VE++GRG W IV+ EIP+Q+ KSRLIE+IA LI  K++P+L DIRDES E++RIVL 
Sbjct: 249 RYEVEDIGRGGWIIVIHEIPWQIPKSRLIEEIAALINEKKLPILSDIRDESDENIRIVLE 308

Query: 315 PKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFR 374
           PK+R++DP LLM+ +F L+ +ETR  LNMNVL     P V+PL  +LKEWLAH+  +L R
Sbjct: 309 PKSRTVDPQLLMDGLFHLTSLETRISLNMNVLDSHHTPAVLPLHTVLKEWLAHQFAMLQR 368

Query: 375 RSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNL 434
           R   R+Q ID RVE+L+G L AYLN+D +I IIRNED PK VM++ F L++ Q +AILN+
Sbjct: 369 RCRHRLQRIDDRVELLEGYLAAYLNLDRVIEIIRNEDDPKSVMIAEFKLSDRQAEAILNM 428

Query: 435 RLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGR 494
           RLR+L++LEE +I +E D+L  E+  + +L+ S   Q  ++  ++  +++ +S  + LG 
Sbjct: 429 RLRALKRLEEAEITAERDSLKEERAGLQALIESDALQSKKLKSDLSALRKRYSLKSQLGA 488

Query: 495 RRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLS---ALHFKEGDSL 551
           R+T   E + A KA    AMIE+EP+TVV+S RGWIR LK H VDL    A+ FKEGD  
Sbjct: 489 RQTLIEEQTPA-KAIPLDAMIEREPMTVVLSKRGWIRGLKGH-VDLKSTEAMRFKEGDEA 546

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
               HA+TTDR+L+ + DG+ YTL A  L  GRG GE ++L++D++++  I+     +  
Sbjct: 547 DFICHAYTTDRLLIATEDGRFYTLLADRLPGGRGFGEPVRLMLDISNDTKIMALLPLNPE 606

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKL--VVKVTGDHVAVVGENRK 669
            KLLVVSS G  FI + + ++A TRKGK  ++V  +E + +  V++   DH+A++GENRK
Sbjct: 607 GKLLVVSSSGRGFITQMTNLVAETRKGKQIVRVKKDEYLMVLKVIEEGHDHIALIGENRK 666

Query: 670 LLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGW 729
           LL F + QIPE+++G GV+LQ Y+ G +SD   F + EGL+W         R+E D+  W
Sbjct: 667 LLAFPLSQIPELAKGSGVQLQRYRGGHLSDATTFTLEEGLSWPMGGESGRIRTETDMKTW 726

Query: 730 LGKRGGVGSLVPKGFPRSGKF 750
           +  RG  G L P GFP++ +F
Sbjct: 727 VVARGASGRLPPVGFPKNNRF 747


>gi|209545463|ref|YP_002277692.1| DNA topoisomerase IV subunit A [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209533140|gb|ACI53077.1| DNA topoisomerase IV, A subunit [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 743

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/734 (50%), Positives = 520/734 (70%), Gaps = 5/734 (0%)

Query: 16  NVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKS 75
           +++   L  AL ERYLAYA+STI  R++PD+RDG KPVHRR+I+AM ++ LD  + FKK 
Sbjct: 8   HIEETRLADALSERYLAYAMSTIMSRSLPDVRDGLKPVHRRMIYAMRQLRLDPTSGFKKC 67

Query: 76  ARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEAR 135
           AR+VG+VIGK HPHGD SVY++LVRLAQ F  RYPL+ GQGNFG+IDGD+AAA RYTEAR
Sbjct: 68  ARVVGDVIGKYHPHGDASVYEALVRLAQDFAVRYPLVEGQGNFGSIDGDNAAAMRYTEAR 127

Query: 136 MTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHN 195
           MT+VA  +L+G+D+D+VDFR TY+ E+ EPVV P+ FPNLLANG +GIAVGMATSIP HN
Sbjct: 128 MTEVARALLEGIDDDSVDFRPTYDGEEQEPVVLPAAFPNLLANGAAGIAVGMATSIPPHN 187

Query: 196 VQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRAR 255
           V EIC AA+ LI +P+ ++  L+E + GPDFPTGG+IVE R +++++Y  GRG  R+RAR
Sbjct: 188 VGEICSAAIRLIRSPDATVADLMEDMPGPDFPTGGLIVEDRATLLQAYETGRGSMRIRAR 247

Query: 256 WCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFP 315
           W VE+   G+W +VVTEIPYQVQKSRLIE+IA+L+  K++PLL DIRDES  D+R+VL P
Sbjct: 248 WSVEQGRFGTWQVVVTEIPYQVQKSRLIEQIADLMEQKKLPLLGDIRDESTTDIRLVLEP 307

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           K+R ++P++LME++F  + +E+RF LNMNVL   RVP V  L  +L  WL HR +VL RR
Sbjct: 308 KSRGVEPEVLMETLFRATALESRFALNMNVLGADRVPGVRSLREVLLAWLDHRHDVLQRR 367

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
           S  R+QA+DRR+EIL G L  YLN+DE+I IIR ED  K  +++ FSLTE Q ++ILN+R
Sbjct: 368 SRHRLQAVDRRLEILDGFLAVYLNLDEVIRIIREEDDAKAGLMATFSLTELQAESILNMR 427

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LRSLR+LEE +I+ E   L AE+  + +LL+S   +W +I  E++ +++ F     LG R
Sbjct: 428 LRSLRRLEELEIRKEHAALTAERGDLTALLDSEPLRWKKITEEVKAIRKAFGAGA-LGTR 486

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           R+      RA + +  +A +E+EP+T+++S +GW+++LK H +D +   FKEGD  ++A+
Sbjct: 487 RSELAAPPRAIELSAIEA-VEREPLTLILSAKGWVKTLKGHGIDPTTQKFKEGDGFRLAV 545

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
              +TDR+ + +TDG+A+TL A +L  GRG G+ I+LLI+L++++D+V  F      + L
Sbjct: 546 ECQSTDRLCVFATDGRAFTLRAADLPRGRGDGQPIRLLIELSNDEDLVAVFPVREGTRHL 605

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSI 675
           + SS G   ++ + +++A  R GK  L +   E  ++ + V GDHV V+G+NR++L+F +
Sbjct: 606 LASSAGRGLVIRDEDLVAEKRTGKQVLNLKDAESARICLPVEGDHVVVLGQNRRMLVFPV 665

Query: 676 DQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGG 735
            Q+PEM+RG GV LQ YK+GG+ D       +G  W D A     R   D   +LGKR  
Sbjct: 666 AQLPEMARGLGVALQKYKEGGLMDACLLSSTDGAAWPDPA---RIRPFADFRDYLGKRAD 722

Query: 736 VGSLVPKGFPRSGK 749
           VG   P    R  K
Sbjct: 723 VGRPAPAWATRKPK 736


>gi|56551950|ref|YP_162789.1| DNA topoisomerase IV subunit A [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|56543524|gb|AAV89678.1| DNA topoisomerase IV, A subunit [Zymomonas mobilis subsp. mobilis
           ZM4]
          Length = 748

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/741 (52%), Positives = 524/741 (70%), Gaps = 7/741 (0%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           EN+   +   AL ERYLAYALSTI  R++PD+RDG KPV RR++ AM  + LD  +A+KK
Sbjct: 9   ENISETAFDKALSERYLAYALSTITSRSLPDIRDGLKPVQRRLLWAMRLLKLDPASAYKK 68

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEA 134
            AR+VG+VIGK HPHGDQSVYD++VRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTEA
Sbjct: 69  CARVVGDVIGKYHPHGDQSVYDAMVRLAQDFALRYPLVDGQGNFGNIDGDNAAAMRYTEA 128

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           R+T  A  +++G++E AVDFR TYN E+ EP  F   FPNLLANG+SGIAVGMATSIP H
Sbjct: 129 RLTTAAYDLMEGMEEGAVDFRPTYNSEEEEPEFFSGLFPNLLANGSSGIAVGMATSIPPH 188

Query: 195 NVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
           NV E+ +A   LID+PE   ++LL ++ GPDFPTGG IV+S  +I  +Y  GRG FRVRA
Sbjct: 189 NVAELIDAICHLIDHPEAETKELLRFVKGPDFPTGGQIVDSVNTIRHAYETGRGSFRVRA 248

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLF 314
           R+ VE++GRG W IV+ EIP+Q+ KSRLIE+IA LI  K++P+L DIRDES E++RIVL 
Sbjct: 249 RYEVEDIGRGGWIIVINEIPWQIPKSRLIEEIAALINEKKLPILSDIRDESDENIRIVLE 308

Query: 315 PKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFR 374
           PK+R++DP LLM+ +F L+ +ETR  LNMNVL     P V+PL  +LKEWLAH+  +L R
Sbjct: 309 PKSRTVDPQLLMDGLFHLTSLETRISLNMNVLDSHHTPAVLPLHTVLKEWLAHQFAMLQR 368

Query: 375 RSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNL 434
           R   R+Q ID RVE+L+G L AYLN+D +I IIRNED PK VM++ F L++ Q +AILN+
Sbjct: 369 RCRHRLQRIDDRVELLEGYLAAYLNLDRVIEIIRNEDDPKSVMIAEFKLSDRQAEAILNM 428

Query: 435 RLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGR 494
           RLR+L++LEE +I +E D+L  E+  + +L+ S   Q  ++  ++  +++ +S  + LG 
Sbjct: 429 RLRALKRLEEAEITAERDSLKEERAGLQALIESDALQSKKLKSDLSALRKRYSLKSKLGA 488

Query: 495 RRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLS---ALHFKEGDSL 551
           R+T   E + A KA    AMIE+EP+TVV+S RGWIR LK H VDL    A+ FKEGD  
Sbjct: 489 RQTLIEEQTPA-KAIPLDAMIEREPMTVVLSKRGWIRGLKGH-VDLKSTEAMRFKEGDEA 546

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
               HA+TTDR+L+ + DG+ YTL A  L  GRG GE ++L++D++++  I+     +  
Sbjct: 547 DFICHAYTTDRLLIATEDGRFYTLLADRLPGGRGFGEPVRLMLDISNDTKIMALLPLNPE 606

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKL--VVKVTGDHVAVVGENRK 669
            KLLVVSS G  FI + + ++A TRKGK  ++V  +E + +  V++   DH+A++GENRK
Sbjct: 607 GKLLVVSSSGRGFITQMTNLVAETRKGKQIVRVKKDEYLMVLKVIEEDHDHIALIGENRK 666

Query: 670 LLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGW 729
           LL F + QIPE+++G GV+LQ Y+ G +SD   F + EGL+W         R+E D+  W
Sbjct: 667 LLAFPLSQIPELAKGSGVQLQRYRGGHLSDATTFTLEEGLSWPMGGESGRIRTETDMKTW 726

Query: 730 LGKRGGVGSLVPKGFPRSGKF 750
           +  RG  G L P GFP++ +F
Sbjct: 727 VVARGASGRLPPVGFPKNNRF 747


>gi|162148787|ref|YP_001603248.1| DNA topoisomerase IV subunit A [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161787364|emb|CAP56959.1| putative DNA topoisomerase 4 subunit A [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 743

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/734 (50%), Positives = 520/734 (70%), Gaps = 5/734 (0%)

Query: 16  NVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKS 75
           +++   L  AL ERYLAYA+STI  R++PD+RDG KPVHRR+I+AM ++ LD  + FKK 
Sbjct: 8   HIEETRLADALSERYLAYAMSTIMSRSLPDVRDGLKPVHRRMIYAMRQLRLDPTSGFKKC 67

Query: 76  ARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEAR 135
           AR+VG+VIGK HPHGD SVY++LVRLAQ F  RYPL+ GQGNFG+IDGD+AAA RYTEAR
Sbjct: 68  ARVVGDVIGKYHPHGDASVYEALVRLAQDFAVRYPLVEGQGNFGSIDGDNAAAMRYTEAR 127

Query: 136 MTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHN 195
           MT+VA  +L+G+D+D+VDFR TY+ E+ EPVV  + FPNLLANG +GIAVGMATSIP HN
Sbjct: 128 MTEVARALLEGIDDDSVDFRPTYDGEEQEPVVLSAAFPNLLANGAAGIAVGMATSIPPHN 187

Query: 196 VQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRAR 255
           V EIC AA+ LI +P+ ++  L+E + GPDFPTGG+IVE R +++++Y  GRG  R+RAR
Sbjct: 188 VGEICSAAIRLIRSPDATVADLMEDMPGPDFPTGGLIVEDRTTLLQAYETGRGSMRIRAR 247

Query: 256 WCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFP 315
           W VE+   G+W +VVTEIPYQVQKSRLIE+IA+L+  K++PLL DIRDES  D+R+VL P
Sbjct: 248 WSVEQGRFGTWQVVVTEIPYQVQKSRLIEQIADLMEQKKLPLLGDIRDESTTDIRLVLEP 307

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           K+R ++P++LME++F  + +E+RF LNMNVL   RVP V  L  +L+ WL HR +VL RR
Sbjct: 308 KSRGVEPEVLMETLFRATALESRFALNMNVLGADRVPGVRSLREVLRAWLDHRHDVLQRR 367

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
           S  R+QA+DRR+EIL G L  YLN+DE+I IIR ED  K  +++ FSLTE Q ++ILN+R
Sbjct: 368 SRHRLQAVDRRLEILDGFLAVYLNLDEVIRIIREEDDAKAGLMATFSLTELQAESILNMR 427

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LRSLR+LEE +I+ E   L AE+  + +LL S   +W +I  E++ +++ F     LG R
Sbjct: 428 LRSLRRLEELEIRKEHAALTAERGDLTALLGSEPLRWKKITEEVKAIRKAFGAGA-LGTR 486

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           R+      RA + +  +A +E+EP+T+++S +GW+++LK H +D +A  FKEGD  ++A+
Sbjct: 487 RSELAAPPRAIELSAIEA-VEREPLTLILSAKGWVKTLKGHGIDPTAQKFKEGDGFRLAV 545

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
              +TDR+ + +TDG+A+TL A +L  GRG G+ I+LLI+L++++D+V  F      + L
Sbjct: 546 ECQSTDRLCVFATDGRAFTLRAADLPRGRGDGQPIRLLIELSNDEDLVAVFPVREGTRHL 605

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSI 675
           + SS G   ++ + +++A  R GK  L +   E  ++ + V GDHV V+G+NR++L+F +
Sbjct: 606 LASSAGRGLVIRDEDLVAEKRTGKQVLNLKDAESARICLPVEGDHVVVLGQNRRMLVFPV 665

Query: 676 DQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGG 735
            Q+PEM+RG GV LQ YK+GG+ D       +G  W D A     R   D   +LGKR  
Sbjct: 666 AQLPEMARGLGVALQKYKEGGLMDACLLSSTDGAAWPDPA---RIRPFADFRDYLGKRAD 722

Query: 736 VGSLVPKGFPRSGK 749
           VG   P    R  K
Sbjct: 723 VGRPAPAWATRKPK 736


>gi|239946992|ref|ZP_04698745.1| DNA topoisomerase IV, A subunit [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921268|gb|EER21292.1| DNA topoisomerase IV, A subunit [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 738

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/740 (50%), Positives = 535/740 (72%), Gaps = 5/740 (0%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           E  ++ +    AL ERYLAYALSTI  R++PD+RDG KPVHRR+++AM ++ L+  + +K
Sbjct: 3   EAKIENIDFGNALSERYLAYALSTIMSRSLPDVRDGLKPVHRRLLYAMLQLRLEPNSGYK 62

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K AR+VG+VIGK HPHGD +VYD+LVRLAQ F  RYPLI GQGNFG+IDGD+AAA RYTE
Sbjct: 63  KCARVVGDVIGKYHPHGDVAVYDTLVRLAQHFSLRYPLIDGQGNFGSIDGDNAAAMRYTE 122

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           +RMT++  L++  +D+D VDFR TY++ D EPV+ P+ FPNLLANG+ GIAVGMAT+IP 
Sbjct: 123 SRMTEICTLLMIDIDKDTVDFRPTYDDSDLEPVIMPASFPNLLANGSEGIAVGMATNIPP 182

Query: 194 HNVQEICEAALALIDN-PEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRV 252
           HN+ E+C+A + LID+ P+  I  ++ +I GPDFPTGGII++  E I  +Y  GRG  RV
Sbjct: 183 HNLHELCDALVHLIDHHPKAEINDIMNFIKGPDFPTGGIIIDKAEVINAAYTTGRGSLRV 242

Query: 253 RARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIV 312
           R+RW  EE+  G++ IVVTEIPYQVQKS+LIE+IA L+  K+IPL+ +IRDES + +R++
Sbjct: 243 RSRWEKEELSYGTYQIVVTEIPYQVQKSKLIEQIAILLKDKKIPLVSNIRDESTDIIRLI 302

Query: 313 LFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVL 372
           + P++RS DP ++MES+F L+++E+R  LNMNV+    VP+VM +  +L+E+LAHR+ ++
Sbjct: 303 IEPRDRSCDPQIVMESLFKLTNLESRIQLNMNVIGSNNVPRVMNILEVLQEFLAHRQNIV 362

Query: 373 FRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAIL 432
            RRS++ +  I  R+EIL+GL IAYLN+DEII IIR ED+PK +M+ RF LTE QV+AIL
Sbjct: 363 TRRSTYLLNKIKHRLEILEGLRIAYLNLDEIIKIIREEDEPKAIMMERFKLTEIQVEAIL 422

Query: 433 NLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDL 492
           N RLRSLRKLEE +I +E  NL  ++  ++ +LN+ K+ W  +  EI+ V+  F  +T +
Sbjct: 423 NTRLRSLRKLEEQEIINEHGNLQKQQAILEEILNNPKELWKVVKKEIKAVQTKFGLNTVI 482

Query: 493 GRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLK 552
           G RRT+F EV+  ++     A I KEPIT++ S  GW+RSLK H+ DLS + +KEGD+ K
Sbjct: 483 GARRTSFEEVTLTNQVVDITAFITKEPITIICSKMGWVRSLKGHNTDLSTIKYKEGDAEK 542

Query: 553 IALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTC 612
             L A+TTD+IL++S++G+ +TL A N+  G+G GE+I+LL+D+ +N DI    VY    
Sbjct: 543 FILEAYTTDKILIVSSEGRFFTLLADNISKGKGTGESIKLLVDIGNN-DITNILVYKPDQ 601

Query: 613 KLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLI 672
            LL+ SS G  F+V  +E++A T+ GK  + +         + V GD +A +GE+RKLL+
Sbjct: 602 LLLLASSVGKGFLVNSNEVMAQTKTGKQIMNIPDGHACIACLPVNGDSIACIGESRKLLV 661

Query: 673 FSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGK 732
           F+ID+IPEM +G+GV LQ +K+  + D+  F   +GL W ++ G+   + E +++ +LGK
Sbjct: 662 FNIDEIPEMKKGQGVTLQKFKNAKLLDIKIFNKEDGLGW-NNNGKV--KLEKNIVAFLGK 718

Query: 733 RGGVGSLVPKGFPRSGKFLS 752
           RG  G L P GFP++ +F S
Sbjct: 719 RGNTGKLPPMGFPKNNRFSS 738


>gi|254420694|ref|ZP_05034418.1| DNA topoisomerase IV, A subunit [Brevundimonas sp. BAL3]
 gi|196186871|gb|EDX81847.1| DNA topoisomerase IV, A subunit [Brevundimonas sp. BAL3]
          Length = 737

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/720 (52%), Positives = 503/720 (69%), Gaps = 7/720 (0%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIG 84
           AL  RYLAYALSTI  RA+PD+RDGFKPVHRRI++AM +M L+  AA +K A++VGEV+G
Sbjct: 21  ALSRRYLAYALSTITNRALPDVRDGFKPVHRRILYAMHQMRLNPQAAARKCAKVVGEVMG 80

Query: 85  KLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELIL 144
             HPHGD S+Y++LVRLAQ F QRYPL+ GQGNFGNIDGDSAAA RYTE ++T  A L+L
Sbjct: 81  GYHPHGDASIYEALVRLAQDFAQRYPLVDGQGNFGNIDGDSAAAMRYTECKLTPAAVLLL 140

Query: 145 QGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAAL 204
            G+D+D+VDFR TY+++D EPVV P+ FPNLLANG+SGIAVGMATSIP HNV E+ +A  
Sbjct: 141 DGIDQDSVDFRATYDDQDEEPVVLPAGFPNLLANGSSGIAVGMATSIPPHNVGELIDACQ 200

Query: 205 ALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRG 264
            L+D PE +  +L++ + GPDFPTGG+ VE   SI+++Y  GRGG R+RARW  E++GRG
Sbjct: 201 MLLDRPEATTAELVQLVPGPDFPTGGVAVEGHASILDAYETGRGGVRLRARWETEDLGRG 260

Query: 265 SWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDL 324
            W I+VTE+PYQVQKSRLIE +A+LI  K+ PLL D+RDESAED+R++L PKNR+++P++
Sbjct: 261 VWRIIVTEMPYQVQKSRLIEALADLIEHKKAPLLGDVRDESAEDIRLILEPKNRTIEPEM 320

Query: 325 LMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAID 384
           LMES+F LSD+E RFP+NMNVL     P+VM L   L+ +L HRREVL RRS +R+  ++
Sbjct: 321 LMESLFKLSDLEVRFPINMNVLDADGTPRVMGLKACLRAFLDHRREVLNRRSQWRIARVE 380

Query: 385 RRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEE 444
           +R+ +L+GL I +LNIDE+I I+R E++PK V+++RF LTE Q D IL+ RLR L +LEE
Sbjct: 381 KRLHLLEGLRIVFLNIDEVIRIVREEEQPKAVLIARFGLTEVQADFILDTRLRQLARLEE 440

Query: 445 YQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSR 504
             I+ E   L  E   + +L +S  +QW  I+ E+  V++       +  RRTT  +   
Sbjct: 441 MTIEKEFKALSEELAHLQALTSSEGKQWKAISKELEAVRKAL-----ISPRRTTIADAVD 495

Query: 505 ADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRIL 564
                  +A I +E ITV++S RGWIR+ K    D S L FKEGD L   + A+TTD++L
Sbjct: 496 TSAFVAPEAFIPREAITVILSERGWIRAAKGKVEDPSELKFKEGDQLAYLVPAYTTDKLL 555

Query: 565 LLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAF 624
           + ++DG+ +T+ A  L SGRGHGE ++L+IDL+   +I+    +    KLL+ S  G  F
Sbjct: 556 VGASDGRIFTIGADKLASGRGHGEPLRLMIDLDEKAEIINVLAHQPGGKLLIASKAGYGF 615

Query: 625 IVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRG 684
           I  E + +A  R GK  L       +++    T DHVA +GEN K LIF +D++PEM RG
Sbjct: 616 IAPEDDTLAQKRGGKQVLNGDMLAMLRIPQTPTADHVATIGENIKTLIFPLDELPEMGRG 675

Query: 685 KGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGF 744
           KGVRLQ++K GG++DV  F   +G  W D  GR   R+  D   WLGKR G G   P+G 
Sbjct: 676 KGVRLQNFKQGGLADVTVFNAEQGPEWADGGGR--RRNWPDWKDWLGKRAGAGRQGPRGL 733


>gi|87200806|ref|YP_498063.1| DNA topoisomerase IV subunit A [Novosphingobium aromaticivorans DSM
           12444]
 gi|87136487|gb|ABD27229.1| DNA topoisomerase IV subunit A [Novosphingobium aromaticivorans DSM
           12444]
          Length = 761

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/741 (51%), Positives = 516/741 (69%), Gaps = 16/741 (2%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIG 84
           AL ERYL YALSTI  R++PDLRDG KPVHRR++ AM ++ LD   AFKKSAR+VG+VIG
Sbjct: 22  ALSERYLVYALSTITARSLPDLRDGLKPVHRRLLWAMRQLKLDPAQAFKKSARVVGDVIG 81

Query: 85  KLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELIL 144
           K HPHGD SVYD++VRLAQ +  RYPL+ GQGNFGNIDGD+AAAYRYTEAR+T+ A  ++
Sbjct: 82  KYHPHGDASVYDAMVRLAQDWALRYPLVEGQGNFGNIDGDNAAAYRYTEARLTKTAIQLM 141

Query: 145 QGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAAL 204
            G+DE  VDF  TYN E+ EP +FP  FPNLLANG+SGIAVGMAT+IPSHNV EI +A L
Sbjct: 142 SGLDEGTVDFVPTYNGEEEEPEIFPGLFPNLLANGSSGIAVGMATNIPSHNVAEIIDATL 201

Query: 205 ALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWC------- 257
            LIDNP     +L+E   GPD PTGG+IV+S   I  +Y  GRG  RVR R+        
Sbjct: 202 LLIDNPHAEHAQLMEVFHGPDLPTGGVIVDSPAVISNAYETGRGAIRVRGRFSTGRDEAG 261

Query: 258 ------VEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRI 311
                 +E++G G W +VV+EIPY VQK +LIE+IA+LI  K++P+LEDIRDES E +R+
Sbjct: 262 NWEESGIEKLGGGQWQLVVSEIPYMVQKGKLIEQIAQLIADKKLPILEDIRDESDEQIRL 321

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           VL PK+R++DPDLL ES++ L+D+ETRF LN+NVL   R P V+ L  +L+EW+  + ++
Sbjct: 322 VLIPKSRNVDPDLLKESLYRLTDLETRFGLNLNVLDSRRTPGVLGLKLVLQEWVISQIDI 381

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           L RRS  R+  I  R+E+L+G +IAYLN+D II IIR ED+PKPVM++ F LT+ Q +AI
Sbjct: 382 LLRRSRHRLDKIASRLELLEGYIIAYLNLDRIIEIIRTEDEPKPVMMAEFELTDRQAEAI 441

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           LN+RLRSLRKLEE +++ E D LLAE+E++  LL+S  +Q  ++  ++  +++ +++ T 
Sbjct: 442 LNMRLRSLRKLEEMELRKERDALLAEQEELQKLLDSPARQRTRLKRDLAALRKDYAEDTA 501

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
           LGRRRTT  E +   + ++  AMIEKEP+TV++S +GWIR+ K H        FKEGD  
Sbjct: 502 LGRRRTTIAEAAPTREFSM-DAMIEKEPVTVILSAKGWIRAAKGHVPLDGDFKFKEGDGP 560

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
             ALH  TTD++L+   +G+ YTL A  L   RG GE I+ ++D++ +  IV+   Y   
Sbjct: 561 AFALHCQTTDKLLVAVDNGRFYTLGADKLPGARGFGEPIRTMVDIDPDAQIVSVLPYKPK 620

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG--DHVAVVGENRK 669
            +LL+ ++ G  F  E  E++A TRKG+  +      K+ +V ++    DHVAV+GENRK
Sbjct: 621 GQLLLAANTGRGFAAEMDELLAETRKGRGVVSTKPGVKLAVVREIAPEHDHVAVIGENRK 680

Query: 670 LLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGW 729
           L+IF++ ++P +++G+GV LQ YKDG +SDVI  ++ +GLTW         R E DLL W
Sbjct: 681 LVIFALSEVPLLAKGQGVTLQRYKDGEMSDVITLRLEDGLTWAMGGESGRTRVEKDLLPW 740

Query: 730 LGKRGGVGSLVPKGFPRSGKF 750
              RG  G L P GFPR  +F
Sbjct: 741 KVARGAAGRLPPNGFPRDNRF 761


>gi|255263069|ref|ZP_05342411.1| DNA topoisomerase IV, A subunit [Thalassiobium sp. R2A62]
 gi|255105404|gb|EET48078.1| DNA topoisomerase IV, A subunit [Thalassiobium sp. R2A62]
          Length = 771

 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/753 (52%), Positives = 530/753 (70%), Gaps = 28/753 (3%)

Query: 22  LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGE 81
           LR A+ ERYL YALSTI  RA+PD RDG KPVHRRI++AM E+ L     F+KSA+I G+
Sbjct: 22  LRRAIGERYLTYALSTIMHRALPDARDGLKPVHRRILYAMRELRLSATGGFRKSAKISGD 81

Query: 82  VIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAE 141
           V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEARMT  AE
Sbjct: 82  VMGNYHPHGDAAIYDAMARLAQDFAVRYPLVDGQGNFGNIDGDNPAASRYTEARMTAAAE 141

Query: 142 LILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICE 201
            +L+G++E+AVD+R+ Y+   +EPVV P+ FPNLLANG+SGIAVGMAT+IP HN+ E+ +
Sbjct: 142 ALLEGLNENAVDYRENYDGTLTEPVVLPATFPNLLANGSSGIAVGMATNIPPHNIPELVD 201

Query: 202 AALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEV 261
           A L LI  P    E L+E + GPDFPTGG+IVE +E+I+ +Y  GRG FR+R +W +E++
Sbjct: 202 ACLHLIKAPNARDETLIEMVPGPDFPTGGVIVEPKENILNAYATGRGSFRLRCKWEIEKL 261

Query: 262 GRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLD 321
            RG W IVVTEIPYQVQKS+LIEKIAE+I  K+IP+L D+RDESA+DVR+V+ PK++++D
Sbjct: 262 DRGQWQIVVTEIPYQVQKSKLIEKIAEVIQLKKIPILADVRDESADDVRMVIEPKSKNVD 321

Query: 322 PDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQ 381
           P++LM  ++  SD+E RF +NMNVL  G  P+V  L  +L+ +L HRREVL RRS  RM 
Sbjct: 322 PEVLMNMLYRNSDLEVRFSMNMNVLIDGLTPKVCSLKEVLRAFLDHRREVLIRRSQHRMA 381

Query: 382 AIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPK-----------------------PVMV 418
            ID R+E+L+G ++A+LN+D +I IIR +D PK                       P + 
Sbjct: 382 KIDHRLEVLEGFIVAFLNLDRVIDIIRYDDDPKAALIREDWSLTHKRAMDETDYLSPALR 441

Query: 419 SRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACE 478
               L+E Q +AILN+RLRSLR+LEE ++  E   L+ E+ +++ LL+S   QW++I+ +
Sbjct: 442 DEEGLSEVQAEAILNMRLRSLRRLEELELLREQSALMEERAELEDLLDSDDLQWSRISEQ 501

Query: 479 IREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSV 538
           +RE ++ F K+   G RRT F E +  +   + +AMIE+EPIT+V S  GW+R+L  H V
Sbjct: 502 LRETRKQFGKNYKGGARRTLFAEAAEVEDVPI-EAMIEREPITIVCSKMGWVRALSGH-V 559

Query: 539 DLS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLN 597
           DL+  L FK+GD  +   HA TTDR+L+  T+G+ YT+ A NL  GRG GE ++L++DL 
Sbjct: 560 DLARELKFKDGDEARFMFHAETTDRLLVFGTNGRFYTVSASNLPGGRGMGEPLRLMVDLP 619

Query: 598 HNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVT 657
           +  DIV  F++    KLLV SS G+ FIV E+++IA TR GK  L V      K+ + VT
Sbjct: 620 NEADIVDFFIHQPERKLLVASSAGDGFIVPEADVIAQTRTGKQVLNVKDGVMAKVCITVT 679

Query: 658 GDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGR 717
           GDHVA VGENRK+L+F I+++PEM RGKGVRLQ YKDGG+SDV  F +  GL+W D AGR
Sbjct: 680 GDHVACVGENRKVLVFPIEELPEMGRGKGVRLQKYKDGGLSDVATFTMAGGLSWQDPAGR 739

Query: 718 SYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           +  R+E +L  W GKR   G + P+GFPR  +F
Sbjct: 740 T--RTETELAEWAGKRASAGRMAPRGFPRDNRF 770


>gi|165932663|ref|YP_001649452.1| DNA topoisomerase IV subunit A [Rickettsia rickettsii str. Iowa]
 gi|165907750|gb|ABY72046.1| topoisomerase IV subunit A [Rickettsia rickettsii str. Iowa]
          Length = 738

 Score =  773 bits (1996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/739 (50%), Positives = 531/739 (71%), Gaps = 4/739 (0%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           E  ++ +    AL ERYLAYALSTI  R++PD+RDG KPVHRR+++AM ++ L+  + +K
Sbjct: 3   EAKIENIDFGNALSERYLAYALSTIMSRSLPDVRDGLKPVHRRLLYAMLQLRLEPNSGYK 62

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K AR+VG+VIGK HPHGD +VYD+LVRLAQ F  RYPLI GQGNFG+IDGD+AAA RYTE
Sbjct: 63  KCARVVGDVIGKYHPHGDVAVYDTLVRLAQHFSLRYPLIDGQGNFGSIDGDNAAAMRYTE 122

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           +RMT +  L+++ +D+D VDFR TY+  D EPV+ P+ FPNLLANG+ GIAVGMAT+IP 
Sbjct: 123 SRMTDICTLLMEDIDKDTVDFRPTYDGSDLEPVIMPASFPNLLANGSEGIAVGMATNIPP 182

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN+ E+C+A + LI+ P+  I  ++ ++ GPDFPTGGII++  E I  +Y  GRG  RVR
Sbjct: 183 HNLHELCDALIHLINYPKAEINDIMNFVKGPDFPTGGIIIDKAEVINAAYTTGRGSLRVR 242

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           +RW  EE+  G++ IVVTEIPYQVQKS+LIE+IA L+  K+IPL+ +IRDES + +R+V+
Sbjct: 243 SRWEKEELSYGTYQIVVTEIPYQVQKSKLIEQIAILLKDKKIPLVSNIRDESTDIIRLVI 302

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            P++R  DP ++MES+F L+++E+R  LNMNV+    VP+VM +  IL+E+L HR+ ++ 
Sbjct: 303 EPRDRGCDPQIVMESLFKLTNLESRIQLNMNVIGSNNVPRVMNILEILQEFLYHRQNIVT 362

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS++ +  I  R+EILKGL IAYLN+DEII IIR ED+PK +++ RF LTE QV+AILN
Sbjct: 363 RRSTYLLNKIKHRLEILKGLRIAYLNLDEIITIIREEDEPKAIIMERFKLTEIQVEAILN 422

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
            RLRSLRKLEE +I +E  NL  ++  ++ +LN+ K+ W  +  EI+ V+  F  +T +G
Sbjct: 423 TRLRSLRKLEEQEIINEHSNLQKQQAILEEILNNPKELWKIVKKEIKTVQTKFGLNTVIG 482

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
            RRT+F EV+  ++     A I KEPIT++ S  GW+RSLK H+ DLS + +KEGD+ K 
Sbjct: 483 ARRTSFEEVTFTNQVVDITAFITKEPITIICSKMGWVRSLKGHNTDLSTIKYKEGDAEKF 542

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
            L A+TTD+IL++S++G+ +TL A N+  G+G GE+I+LL+D+ +N DI    VY     
Sbjct: 543 ILEAYTTDKILIVSSEGRFFTLLADNISKGKGTGESIKLLVDIGNN-DITNILVYKPDQL 601

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
           LL+ SS G  F+V  +E++A T+ GK  + V         + V GD +A +GE+RKLL+F
Sbjct: 602 LLLASSVGKGFLVNSNEVMAQTKTGKQIMNVPDGHVCIACLPVNGDSIACIGESRKLLVF 661

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
           +ID+IPEM +G+GV LQ +K+  + D+  F   +GL W ++ G+   + E +++ +LGKR
Sbjct: 662 NIDEIPEMKKGQGVTLQKFKNAKLLDIKIFNKEDGLGW-NNNGKV--KLEKNIVAFLGKR 718

Query: 734 GGVGSLVPKGFPRSGKFLS 752
           G  G L P GFP++ +F S
Sbjct: 719 GSTGKLPPMGFPKNNRFSS 737


>gi|148553035|ref|YP_001260617.1| DNA topoisomerase IV subunit A [Sphingomonas wittichii RW1]
 gi|148498225|gb|ABQ66479.1| DNA topoisomerase IV subunit A [Sphingomonas wittichii RW1]
          Length = 750

 Score =  773 bits (1995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/744 (50%), Positives = 518/744 (69%), Gaps = 7/744 (0%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L E++V+      AL +RYL YALSTI  R++PD+RDG KPVHRR++ AM  + LD  + 
Sbjct: 7   LPEDSVRNTPFDSALSDRYLVYALSTITARSLPDVRDGLKPVHRRLLWAMRLLRLDPASG 66

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRY 131
           +KK AR+VG+VIGK HPHGDQSVYD++VRLAQ F  RYPL+ GQGNFGN+DGD+AAA RY
Sbjct: 67  YKKCARVVGDVIGKYHPHGDQSVYDAMVRLAQTFSLRYPLVDGQGNFGNVDGDNAAAMRY 126

Query: 132 TEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSI 191
           TEAR+T  A  ++ G+DE  VDFR TYN E+ EP +FP  FPNLLANG SGIAVGMATSI
Sbjct: 127 TEARLTAAAGELMAGLDEGTVDFRPTYNGEEEEPEIFPGLFPNLLANGASGIAVGMATSI 186

Query: 192 PSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFR 251
           P HNV E+ +AA+ LID PE    +LL+++ GPDFPTGG++V+S  +I E+Y  GRG FR
Sbjct: 187 PPHNVAELIDAAVLLIDKPEAETAELLDHVKGPDFPTGGVLVDSPATIAEAYATGRGAFR 246

Query: 252 VRARW-CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVR 310
           VRA+   V+E G G W +VV++IPYQVQKS+LIE+IAELI  K++P+L D+RDES E++R
Sbjct: 247 VRAKIEKVDEKG-GGWHLVVSQIPYQVQKSKLIEQIAELINDKKLPILADVRDESDEEIR 305

Query: 311 IVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRRE 370
           IVL P++R++D D+LMES+F L+++E R  LN+NVL   R P VM L   L  WL H+ E
Sbjct: 306 IVLEPRSRTVDADMLMESLFRLTELEVRVSLNLNVLDDTRTPLVMSLKQALAAWLKHQFE 365

Query: 371 VLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDA 430
           VL RRS  R+  I  R+E+L G LI YLN+D +I IIR ED+PKPVM++ F LT+ Q +A
Sbjct: 366 VLIRRSQHRLAKIADRIELLDGYLIVYLNLDRVIQIIREEDEPKPVMMAEFGLTDRQAEA 425

Query: 431 ILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKST 490
           ILN+RLRSLR+LEE ++  E   L AE +++++L+ S  +Q  ++  ++  ++E +   T
Sbjct: 426 ILNMRLRSLRRLEEMELTRERATLDAEGKELEALIASPARQRTRMKRDLAALRERYGPET 485

Query: 491 DLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSH--SVDLSALHFKEG 548
            LG RRT   E + A +  L +AM+E+EP+TV++S RGWIR++K H      +A+ FKEG
Sbjct: 486 ALGARRTLLSEAAPAREIPL-EAMVEREPVTVILSQRGWIRAMKGHLDEAAQAAVKFKEG 544

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           D    A+ A TTDRILL +  G+ YTLPA  L  GRG GE ++L  D++ +  +      
Sbjct: 545 DGPAHAIRAQTTDRILLATDQGRFYTLPADKLPGGRGFGEPVRLFADIDADARVAALLAA 604

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLV--VKVTGDHVAVVGE 666
               +LL+ S  G  F+V+ +++ A TRKGK  + +    ++K+V  V  T D+VA +G+
Sbjct: 605 KPGAELLLASGDGKGFVVDMADVTAETRKGKQVVNLREGGRLKVVHPVAPTDDYVAAIGD 664

Query: 667 NRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDL 726
           NRK++IF + ++P M+RG+GV +Q YKDGG+SD I F++ +GL+W         R+E DL
Sbjct: 665 NRKMVIFPLGELPRMARGQGVTIQRYKDGGLSDAISFRLDDGLSWTMGGDTGRTRTEADL 724

Query: 727 LGWLGKRGGVGSLVPKGFPRSGKF 750
             W   RG  G + P GFPR  +F
Sbjct: 725 TPWRAARGAAGRMPPVGFPRDNRF 748


>gi|307295585|ref|ZP_07575421.1| DNA topoisomerase IV, A subunit [Sphingobium chlorophenolicum L-1]
 gi|306878624|gb|EFN09844.1| DNA topoisomerase IV, A subunit [Sphingobium chlorophenolicum L-1]
          Length = 762

 Score =  773 bits (1995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/745 (50%), Positives = 516/745 (69%), Gaps = 20/745 (2%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA------------- 71
           AL +RYL YALSTI  R++PDLRDG KPVHRR++ AM  + ++ G A             
Sbjct: 19  ALSQRYLVYALSTITARSLPDLRDGLKPVHRRLLWAMRLLRMEPGGASPDVLVANPARNT 78

Query: 72  --FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAY 129
             +KK AR+VG+VIGK HPHGD SVYD++VRLAQ F  R PL+ GQGNFGNIDGD+AAA 
Sbjct: 79  TSYKKCARVVGDVIGKYHPHGDASVYDAMVRLAQDFSLRTPLVDGQGNFGNIDGDNAAAM 138

Query: 130 RYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMAT 189
           RYTEAR+TQ A  ++ G+DE  V+FR TYN ED EP VFP  FPNLLANG +GIAVGMAT
Sbjct: 139 RYTEARLTQAAADLMAGLDEGTVEFRPTYNGEDQEPEVFPGLFPNLLANGATGIAVGMAT 198

Query: 190 SIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGG 249
           SIP HNV E+ +AA  LIDNP+     L++ + GPDFPTGG++V+S   I E+Y  GRG 
Sbjct: 199 SIPPHNVSELIDAASLLIDNPDAEHADLMQVVRGPDFPTGGVLVDSASIISEAYATGRGS 258

Query: 250 FRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDV 309
           FR RARW  E+ GRG+W  VVT+IP+QVQKS+LIE+IA LI  +++P+L D+RDES E +
Sbjct: 259 FRTRARWHKEDGGRGTWVAVVTQIPFQVQKSKLIEQIAALINDRKLPILADVRDESDEQI 318

Query: 310 RIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRR 369
           RIV+ P+ R++DPDLLM+S+F L+D+E RFPLN+NVL   R P+V+ L  +L EWL H+ 
Sbjct: 319 RIVIEPRGRTVDPDLLMDSLFRLTDLENRFPLNLNVLDATRTPRVLGLKPVLIEWLKHQI 378

Query: 370 EVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVD 429
           +VL +R+  R+  I  R+E+L G +IAYLN+D +I IIR ED+PK VM++ F L + Q +
Sbjct: 379 DVLVKRAQHRLDKIAARLELLDGYIIAYLNLDRVIEIIRTEDEPKEVMMAEFGLNDRQAE 438

Query: 430 AILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKS 489
           AILN+RLRSLRKLEE +++ E   LL E++ +  L+ S  +Q  ++  ++ ++++ +S  
Sbjct: 439 AILNMRLRSLRKLEEMELRREHSELLKERDDLLKLVESPARQRTRLKKDLADLRKRYSPD 498

Query: 490 TDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSA--LHFKE 547
           +D GRRRT   E + A +  L +AMIEKEPITV++S RGWIR++  H    SA  L FKE
Sbjct: 499 SDFGRRRTLVEEAAPAREIPL-EAMIEKEPITVILSERGWIRAMSGHRDLASADTLKFKE 557

Query: 548 GDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFV 607
           GD   IA HA TTD++LL +  G+ +TL A  L  GRG G+ ++ L+D++    IV    
Sbjct: 558 GDGPMIAFHAQTTDKLLLATETGRIFTLGADKLPGGRGFGDPVRSLVDMDGTGQIVALMP 617

Query: 608 YDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLV--VKVTGDHVAVVG 665
             +  +LL+ SS G  F+   +++IA TRKGK  + V +  K+ +V  +    D VAVVG
Sbjct: 618 ARTGGELLLASSDGRGFVAAVADVIAETRKGKQVVNVRTGAKLSVVHPIAADADSVAVVG 677

Query: 666 ENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSEND 725
           ENRKLL+FS+ ++P M+RG+GV++Q Y+DGG+SD I F++ +GL+W    G    R+E D
Sbjct: 678 ENRKLLVFSLIEMPRMARGQGVQMQRYRDGGLSDAIAFRLSDGLSWAMGGGSGRVRTEAD 737

Query: 726 LLGWLGKRGGVGSLVPKGFPRSGKF 750
           +  W   RG  G + P GFPR  +F
Sbjct: 738 MTPWRVARGAAGRMPPTGFPRDNRF 762


>gi|103487589|ref|YP_617150.1| DNA topoisomerase IV subunit A [Sphingopyxis alaskensis RB2256]
 gi|98977666|gb|ABF53817.1| DNA topoisomerase IV subunit A [Sphingopyxis alaskensis RB2256]
          Length = 777

 Score =  773 bits (1995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/743 (49%), Positives = 517/743 (69%), Gaps = 18/743 (2%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIG 84
           AL +RYL YALSTI  R++PDLRDG KPVHRR++ AM  M LD    +KKSAR+VG+VIG
Sbjct: 35  ALSQRYLVYALSTITARSLPDLRDGLKPVHRRLLWAMRAMRLDPSQGYKKSARVVGDVIG 94

Query: 85  KLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELIL 144
           K HPHGD +VYD++VRLAQ F  RYPL+ GQGNFGNIDGD+AAAYRYTEAR+T+VA  ++
Sbjct: 95  KFHPHGDTAVYDAMVRLAQDFSLRYPLVDGQGNFGNIDGDNAAAYRYTEARLTRVAVDLM 154

Query: 145 QGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAAL 204
           QG+DE  VDFR TYN ED EP + P  FPNLLANG SGIAVGMAT+IP HN  E+ +AAL
Sbjct: 155 QGLDEGTVDFRPTYNGEDEEPEIMPGLFPNLLANGASGIAVGMATNIPPHNAAEVIDAAL 214

Query: 205 ALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWC------- 257
            LIDNP+  +  LL+++ GPDFPTGGI+ E+ E+I ++Y  GRG FRVRAR+        
Sbjct: 215 LLIDNPKAGLSDLLDHVKGPDFPTGGIVAENAETIAQAYESGRGSFRVRARFSIGKDADG 274

Query: 258 ------VEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRI 311
                 +E++  G+W +V++EIPY V K +LIE++A+LI  +++P+LED+RDESAED+RI
Sbjct: 275 KWEADGIEKLSGGTWQLVISEIPYGVAKGKLIEQVAQLIADRKLPILEDVRDESAEDLRI 334

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           VL PK+R++D ++L +S++ L+D+E+RF LN+NVL   R P+VM L  +L EWL H+  V
Sbjct: 335 VLVPKSRNVDAEVLKDSLYRLTDLESRFALNLNVLDATRTPKVMGLKQLLTEWLQHQIIV 394

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           L RR+  R+  ID R+E++ G +IA+LN+D II IIR ED+PKPVM++ F LT+ Q +AI
Sbjct: 395 LVRRAEHRIAKIDDRLELVAGYIIAFLNLDRIIEIIRTEDEPKPVMIAEFELTDRQAEAI 454

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           LN+RLRSLRKLEE ++K E  +L AE+E++  L+ S  +Q  ++  ++  ++ ++   T 
Sbjct: 455 LNMRLRSLRKLEEMELKREQTDLTAEREELAKLVESPARQRTRLRKDLERLRGVYGLDTS 514

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSV--DLSALHFKEGD 549
           LG RRTT  E +   +  L  AMIEKEP+TV++S RGWIR+ + H          FKEGD
Sbjct: 515 LGARRTTIAEAAPTREIPL-DAMIEKEPVTVILSKRGWIRAQRGHVAPDQWGEFKFKEGD 573

Query: 550 SLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYD 609
            L  A HA TTD++L+ ++DG+ +T+ A  L  GRG GE ++L++D++ +  IV      
Sbjct: 574 ELLFAAHAQTTDKLLIAASDGRFFTVGADKLPGGRGFGEPLRLMVDIDPDARIVAMVPAS 633

Query: 610 STCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVT--GDHVAVVGEN 667
           +  +LL+ S+ G+ FIV   ++ A TRKG+  + +     + +   +    D VAVVG+N
Sbjct: 634 AGGRLLLASTSGHGFIVNTDDVTAETRKGRNVVNLKPRAALVVARPIAPGDDSVAVVGDN 693

Query: 668 RKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLL 727
           RKL++F + ++P M RG+GV LQ Y+DGG+SD + F + EGL+W         R+E DL 
Sbjct: 694 RKLVVFPLAEVPVMGRGQGVMLQRYRDGGLSDAVSFVLAEGLSWAMGGDSGRTRTETDLA 753

Query: 728 GWLGKRGGVGSLVPKGFPRSGKF 750
            W   RG  G + P GFPR+ +F
Sbjct: 754 PWRVARGAAGRMPPTGFPRNNRF 776


>gi|167645708|ref|YP_001683371.1| DNA topoisomerase IV subunit A [Caulobacter sp. K31]
 gi|167348138|gb|ABZ70873.1| DNA topoisomerase IV, A subunit [Caulobacter sp. K31]
          Length = 759

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/735 (51%), Positives = 520/735 (70%), Gaps = 12/735 (1%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIG 84
           AL +RYLAYALSTI  RA+PD+RDG KPVHRR++HAM+ M L+     +K A++VGEV+G
Sbjct: 25  ALSKRYLAYALSTIGSRALPDVRDGLKPVHRRVLHAMNNMRLNPEGGARKCAKVVGEVMG 84

Query: 85  KLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELIL 144
             HPHGDQS+YD+LVRLAQ F QR PL+ GQGNFGNIDGDSAAA RYTE +MT  A L+L
Sbjct: 85  NFHPHGDQSIYDALVRLAQEFSQRVPLVDGQGNFGNIDGDSAAAMRYTECKMTAAAVLLL 144

Query: 145 QGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAAL 204
            G+DEDAVDF+ +Y+ +D EPVV PS FPNLLANG+SGIAVGMATSIP HN  E+ +A L
Sbjct: 145 DGIDEDAVDFKPSYDGQDEEPVVLPSGFPNLLANGSSGIAVGMATSIPPHNPAELIDACL 204

Query: 205 ALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRG 264
            L+  PE +  ++LE + GPDFPTGG+IVESRES++E+Y  GRGG R RA+W  E+ GRG
Sbjct: 205 LLLSKPEATTAEILERVPGPDFPTGGVIVESRESLLETYETGRGGVRTRAKWEKEDTGRG 264

Query: 265 SWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDL 324
           ++ IVVTEIPYQV+KS L+E++A+LI +K+  LL D+RDESAED+R+VL PK+++++P++
Sbjct: 265 TYQIVVTEIPYQVKKSDLVEQLADLIDSKKAALLGDVRDESAEDIRLVLEPKSKNVEPEV 324

Query: 325 LMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAID 384
           LMES+F LS +E+RFP+N+NVL     P VM +   L  +LAHRR+VL RR+  R+  I+
Sbjct: 325 LMESLFKLSALESRFPVNINVLDARGTPGVMGIKQALIAFLAHRRDVLTRRARNRLSKIE 384

Query: 385 RRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEE 444
            R+ IL GLLIAYLN+DE+I I+R ED+PK  +++ F+L++ Q DAILN RLR L KLEE
Sbjct: 385 ARLHILDGLLIAYLNLDEVIRIVRYEDEPKQKLMAAFALSDIQADAILNTRLRQLAKLEE 444

Query: 445 YQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKST----DLGRR----- 495
            +I+ E   L+ E++ I ++L S K+QW+ +   +R+V+ +  K        GR      
Sbjct: 445 MEIRREHAQLVEERDGILAMLASDKKQWDLVGTGLRQVRAVLLKIKHPLDKTGRATGVIG 504

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           R+ F +    D     +A+I +EPITV++S+RGWIR+ K    D S L FKEGD L   +
Sbjct: 505 RSVFEDAPVVDAEAALEALIVREPITVILSDRGWIRAAKGKVEDPSELKFKEGDKLGFLV 564

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
            A TTD++LL ++DG+ +T+   NL S RGHGE ++++I+L+    I+  F + +  K  
Sbjct: 565 PAETTDKLLLFTSDGRFFTIGCANLPSARGHGEPVRMMIELDDKVKIIDVFPFKAGRKRF 624

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSI 675
           + S +G  F++ E E +AN + GK  L V +       ++  GD +AVVG+N K+LIF +
Sbjct: 625 LASKQGYGFLMPEEEALANRKAGKQVLTVDA-AGAAFCLEAVGDQLAVVGDNGKILIFPL 683

Query: 676 DQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGG 735
           +++PEM RGKGV+LQSY++GG+ D I F    G  WID+AGR   R   +   W+GKR G
Sbjct: 684 EELPEMPRGKGVKLQSYREGGLRDAISFNADVGAFWIDTAGR--RRDWVEWRDWIGKRAG 741

Query: 736 VGSLVPKGFPRSGKF 750
            G L PKGFP S +F
Sbjct: 742 AGKLSPKGFPTSKRF 756


>gi|157827971|ref|YP_001494213.1| DNA topoisomerase IV subunit A [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|157800452|gb|ABV75705.1| DNA topoisomerase IV subunit A [Rickettsia rickettsii str. 'Sheila
           Smith']
          Length = 738

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/739 (50%), Positives = 530/739 (71%), Gaps = 4/739 (0%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           E  ++ +    AL ERYLAYALSTI  R++PD+RDG KPVHRR+++AM ++ L+  + +K
Sbjct: 3   EAKIENIDFGNALSERYLAYALSTIMSRSLPDVRDGLKPVHRRLLYAMLQLRLEPNSGYK 62

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K AR+VG+VIGK HPHGD +VYD+LVRLAQ F  RYPLI GQGNFG+IDGD+AAA RYTE
Sbjct: 63  KCARVVGDVIGKYHPHGDVAVYDTLVRLAQHFSLRYPLIDGQGNFGSIDGDNAAAMRYTE 122

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           +RMT +  L+++ +D+D VDFR TY+  D EPV+ P+ FPNLLANG+ GIAVGMAT+IP 
Sbjct: 123 SRMTDICTLLMEDIDKDTVDFRPTYDGSDLEPVIMPASFPNLLANGSEGIAVGMATNIPP 182

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN+ E+C+A + LI+ P+  I  ++ ++ GPDFPTGGII++  E I  +Y  GRG  RVR
Sbjct: 183 HNLHELCDALIHLINYPKAEINDIMNFVKGPDFPTGGIIIDKAEVINAAYTTGRGSLRVR 242

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           +RW  EE+  G++ IVVTEIPYQVQKS+LIE+IA L+  K+IPL+ +IRDES + +R+V+
Sbjct: 243 SRWEKEELSYGTYQIVVTEIPYQVQKSKLIEQIAILLKDKKIPLVSNIRDESTDIIRLVI 302

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            P++R  DP ++MES+F L+++E+R  LNMNV+    VP+VM +  IL+E+L HR+ ++ 
Sbjct: 303 EPRDRGCDPQIVMESLFKLTNLESRIQLNMNVIGSNNVPRVMNILEILQEFLYHRQNIVT 362

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS++ +  I  R+EILKGL IAYLN+DEII IIR ED+PK +++ RF LTE QV+AILN
Sbjct: 363 RRSTYLLNKIKHRLEILKGLRIAYLNLDEIITIIREEDEPKAIIMERFKLTEIQVEAILN 422

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
            RLRSLRKLEE +I +E  NL  ++  ++ +LN+ K+ W  +  EI+ V+  F  +T +G
Sbjct: 423 TRLRSLRKLEEQEIINEHSNLQKQQAILEEILNNPKELWKIVKKEIKTVQTKFGLNTVIG 482

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
            RRT+F EV   ++     A I KEPIT++ S  GW+RSLK H+ DLS + +KEGD+ K 
Sbjct: 483 ARRTSFEEVMFTNQVVDITAFITKEPITIICSKMGWVRSLKGHNTDLSTIKYKEGDAEKF 542

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
            L A+TTD+IL++S++G+ +TL A N+  G+G GE+I+LL+D+ +N DI    VY     
Sbjct: 543 ILEAYTTDKILIVSSEGRFFTLLADNISKGKGTGESIKLLVDIGNN-DITNILVYKPDQL 601

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
           LL+ SS G  F+V  +E++A T+ GK  + V         + V GD +A +GE+RKLL+F
Sbjct: 602 LLLASSVGKGFLVNSNEVMAQTKTGKQIMNVPDGHVCIACLPVNGDSIACIGESRKLLVF 661

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
           +ID+IPEM +G+GV LQ +K+  + D+  F   +GL W ++ G+   + E +++ +LGKR
Sbjct: 662 NIDEIPEMKKGQGVTLQKFKNAKLLDIKIFNKEDGLGW-NNNGKV--KLEKNIVAFLGKR 718

Query: 734 GGVGSLVPKGFPRSGKFLS 752
           G  G L P GFP++ +F S
Sbjct: 719 GSTGKLPPMGFPKNNRFSS 737


>gi|302383090|ref|YP_003818913.1| DNA topoisomerase IV subunit alpha [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302193718|gb|ADL01290.1| DNA topoisomerase IV, A subunit [Brevundimonas subvibrioides ATCC
           15264]
          Length = 733

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/720 (51%), Positives = 505/720 (70%), Gaps = 11/720 (1%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIG 84
           AL  RYLAYALSTI  RA+PD+RDGFKPVHRRI++AM +M L+  AA +K A++VGEV+G
Sbjct: 21  ALSRRYLAYALSTITNRALPDVRDGFKPVHRRILYAMHQMRLNPQAAARKCAKVVGEVMG 80

Query: 85  KLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELIL 144
             HPHGD S+YD+LVRLAQ F QRYPL+ GQGNFGNIDGD+AAA RYTE ++T  + L++
Sbjct: 81  GYHPHGDASIYDALVRLAQDFAQRYPLVDGQGNFGNIDGDNAAAMRYTECKLTAASVLLM 140

Query: 145 QGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAAL 204
           +G+D+D+VDFR TY+++D EP V P+ FPNLLANG+SGIAVGMATSIP HNV E+ +A L
Sbjct: 141 EGIDQDSVDFRPTYDDQDEEPTVLPAGFPNLLANGSSGIAVGMATSIPPHNVGELIDACL 200

Query: 205 ALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRG 264
           AL+D PE +  +L E + GPDFPTGG+ VE   SI+++Y  GRGG R+RARW  E + RG
Sbjct: 201 ALLDRPETTTAELAEIVPGPDFPTGGVAVEGHASILDAYETGRGGVRLRARWEREPLERG 260

Query: 265 SWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDL 324
            + IV+TE+PYQVQKS+LIE +AELI  K+ PLL D+RDESAED+R+V+ PK+R++D D 
Sbjct: 261 GYQIVITEVPYQVQKSKLIEALAELIEQKKAPLLGDVRDESAEDIRVVIDPKSRNIDADS 320

Query: 325 LMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAID 384
           LMES+F LSD+E RFP+NMNVL     P+VM L   L+ +L HRREVL RRS++R++ ++
Sbjct: 321 LMESLFRLSDLEVRFPINMNVLDATGTPRVMGLKACLQAFLDHRREVLNRRSAWRIERVE 380

Query: 385 RRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEE 444
           +R+ +L+GL I +LN+DE+I I+R E++PK V+++RF L+E Q D IL+ RLR L ++EE
Sbjct: 381 KRLHLLEGLRIVFLNLDEVIRIVREEEQPKAVLIARFGLSETQADFILDTRLRQLARIEE 440

Query: 445 YQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSR 504
             I++E   L  E   + SL +S  +QW +I  E+   ++       +  RRTT  E   
Sbjct: 441 MTIENEYKALSEELASLQSLTSSPAKQWKKIGQELAATRKAL-----ISPRRTTIAEAVD 495

Query: 505 ADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRIL 564
           A      +A I +E ITV++S RGWIR++K    D S L FKEGD+L   + A TTD++L
Sbjct: 496 ASAFVPAEAFIPREAITVILSERGWIRAVKGKVEDPSELKFKEGDALGFLVPAFTTDKLL 555

Query: 565 LLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAF 624
           + ++DG+ +T+ A  L SGRGHGE ++L+++L  +  IV    +    KLL+ S  G  F
Sbjct: 556 VAASDGRVFTVGADKLASGRGHGEPLRLMVELEESAGIVAVLAHQPGAKLLIASKAGYGF 615

Query: 625 IVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRG 684
           I  E E++A  R GK  L       +   ++VTGDHV  +GEN K LIF  D++PEM RG
Sbjct: 616 IAPEDELLAQKRGGKQVLN----GDLLAAIRVTGDHVVTIGENLKTLIFKADELPEMGRG 671

Query: 685 KGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGF 744
           KGV+LQS+K GG++D+  F    G  W+D  GR   R+  D   WLGKR G G + P+G 
Sbjct: 672 KGVKLQSFKQGGLTDIALFDGAHGPEWVDGGGR--RRNWPDWKDWLGKRAGAGRMGPRGL 729


>gi|15892020|ref|NP_359734.1| DNA topoisomerase IV subunit A [Rickettsia conorii str. Malish 7]
 gi|20139049|sp|Q92JH0|PARC_RICCN RecName: Full=DNA topoisomerase 4 subunit A; AltName:
           Full=Topoisomerase IV subunit A
 gi|15619136|gb|AAL02635.1| topoisomerase IV subunit A [Rickettsia conorii str. Malish 7]
          Length = 738

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/739 (50%), Positives = 531/739 (71%), Gaps = 4/739 (0%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           E  V+ +    AL ERYLAYALSTI  R++PD+RDG KPVHRR+++AM ++ L+  + +K
Sbjct: 3   EAKVENIDFGNALSERYLAYALSTIMSRSLPDVRDGLKPVHRRLLYAMLQLRLEPNSGYK 62

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K AR+VG+VIGK HPHGD +VYD+LVRLAQ F  RYPLI GQGNFG+IDGD+AAA RYTE
Sbjct: 63  KCARVVGDVIGKYHPHGDVAVYDTLVRLAQHFSLRYPLIDGQGNFGSIDGDNAAAMRYTE 122

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           +RMT +  L+++ +D+D VDFR TY+  D EPV+ P+ FPNLLANG+ GIAVGMAT+IP 
Sbjct: 123 SRMTDICTLLMEDIDKDTVDFRPTYDGSDLEPVIMPASFPNLLANGSEGIAVGMATNIPP 182

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN+ E+C+A + LI++P+  I  ++ ++ GPDFPTGGII++  E I  +Y  GRG  RVR
Sbjct: 183 HNLHELCDALIHLINHPKAEINDIINFVKGPDFPTGGIIIDKAEVINAAYTTGRGSLRVR 242

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           +RW  EE+  G++ IVVTEIPYQVQKS+LIE+IA L+  K+IPL+ +IRDES + +R+V+
Sbjct: 243 SRWEKEELSYGTYQIVVTEIPYQVQKSKLIEQIAILLKDKKIPLVSNIRDESTDIIRLVI 302

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            P++R  DP ++MES+F L+++E+R  LNMNV+    VP+VM +  IL+E+L HR+ ++ 
Sbjct: 303 EPRDRGCDPQIVMESLFKLTNLESRIQLNMNVIGSNNVPRVMNILEILQEFLYHRQNIVT 362

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS++ +  I  R+EILKGL IAYLN+DEII IIR ED+PK +M+  F LTE QV+AILN
Sbjct: 363 RRSTYLLNKIKHRLEILKGLRIAYLNLDEIIKIIREEDEPKAIMMEWFKLTEIQVEAILN 422

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
            RLRSLRKLEE +I +E  NL  ++  ++ +LN+ K+ W  +  EI+ V+  F  +T +G
Sbjct: 423 TRLRSLRKLEEQEIINEHSNLQKQQAILEEILNNPKELWKIVKKEIKTVQTKFGLNTVIG 482

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
            RRT+F EV+  ++     A I KEPIT++ S  GW+RSLK H+ DLS + +KEGD+ K 
Sbjct: 483 ARRTSFEEVTLTNQVVDITAFITKEPITIICSKMGWVRSLKGHNTDLSTIKYKEGDAEKF 542

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
            L A+TTD+IL++S++G+ +TL A N+  G+G GE+I+LL+D+ +N DI    VY     
Sbjct: 543 ILEAYTTDKILIVSSEGRFFTLLADNISKGKGTGESIKLLVDIGNN-DITNILVYKPDQL 601

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
           LL+ SS G  F+V  +E++A T+ GK  + V         + V GD +A +GE+RKLL+F
Sbjct: 602 LLLASSVGKGFLVNSNEVMAQTKTGKQIMNVPDGHVCIACLPVNGDSIACIGESRKLLVF 661

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
           +ID+IPEM +G+GV LQ +K+  + D+  F   +GL W ++ G+   + E +++ +LGKR
Sbjct: 662 NIDEIPEMKKGQGVTLQKFKNAKLLDIKIFNKEDGLGW-NNNGKV--KLEKNIVAFLGKR 718

Query: 734 GGVGSLVPKGFPRSGKFLS 752
           G  G L P GFP++ +F S
Sbjct: 719 GSTGKLPPMGFPKNNRFSS 737


>gi|238650533|ref|YP_002916385.1| DNA topoisomerase IV subunit A [Rickettsia peacockii str. Rustic]
 gi|238624631|gb|ACR47337.1| DNA topoisomerase IV subunit A [Rickettsia peacockii str. Rustic]
          Length = 738

 Score =  771 bits (1991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/739 (50%), Positives = 531/739 (71%), Gaps = 4/739 (0%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           E+ ++ +    AL ERYLAYALSTI  R++PD+RDG KPVHRR+++AM ++ L+  + +K
Sbjct: 3   EDKIENIDFGNALSERYLAYALSTIMSRSLPDVRDGLKPVHRRLLYAMLQLRLEPNSGYK 62

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K AR+VG+VIGK HPHGD +VYD+LVRLAQ F  RYPLI GQGNFG+IDGD+AAA RYTE
Sbjct: 63  KCARVVGDVIGKYHPHGDVAVYDTLVRLAQHFSLRYPLIDGQGNFGSIDGDNAAAMRYTE 122

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           +RMT +  L+++ +D+D VDFR TY+  D EPV+ P+ FPNLLANG+ GIAVGMAT+I  
Sbjct: 123 SRMTDICTLLMEDIDKDTVDFRPTYDGSDLEPVIMPASFPNLLANGSEGIAVGMATNILP 182

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN+ E+C+A + LI++P+  I  ++ ++ GPDFPTGGII++  E I  +Y  GRG  RVR
Sbjct: 183 HNLHELCDALIHLINHPKAEINDIMNFVKGPDFPTGGIIIDKAEVINAAYTTGRGSLRVR 242

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           +RW  EE+  G++ IVVTEIPYQVQKS+LIE+IA L+  K+IPL+ +IRDES + +R+V+
Sbjct: 243 SRWEKEELSYGTYQIVVTEIPYQVQKSKLIEQIAILLKDKKIPLVSNIRDESTDIIRLVI 302

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            P +R  DP ++MES+F L+++E+R  LNMNV+    VP+VM +  IL+E+L HR+ ++ 
Sbjct: 303 EPTDRGCDPQIVMESLFKLTNLESRIQLNMNVIGSNNVPRVMNILEILQEFLYHRQNIVT 362

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS++ +  I  R+EILKGL IAYLN+DEII IIR ED+PK +M+ RF LTE QV+AILN
Sbjct: 363 RRSTYLLNKIKHRLEILKGLRIAYLNLDEIIKIIREEDEPKAIMMERFKLTEIQVEAILN 422

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
            RLRSLRKLEE +I +E  NL  ++  ++ +LN+ K+ W  +  EI+ V+  F  +T +G
Sbjct: 423 TRLRSLRKLEEQEIINEHSNLQKQQAILEEILNNPKELWKIVKKEIKTVQTKFGLNTVIG 482

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
            RRT+F EV+  ++     A I KEPIT++ S  GW+RSLK H+ DLS + +KEGD+ K 
Sbjct: 483 ARRTSFEEVTFTNQVVDITAFITKEPITIICSKMGWVRSLKGHNTDLSTIKYKEGDAEKF 542

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
            L A+TTD+IL++S++G+ +TL A N+  G+G GE+I+LL+D+ +N DI    VY     
Sbjct: 543 ILEAYTTDKILIVSSEGRFFTLLADNISKGKGTGESIKLLVDIGNN-DITNILVYKPDQL 601

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
           LL+ SS G  F+V  +E++A T+ GK  + V         + V GD +A +GE+RKLL+F
Sbjct: 602 LLLASSVGKGFLVNSNEVMAQTKTGKQIMNVPDGHVCIACLPVNGDSIACIGESRKLLVF 661

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
           +ID+IPEM +G+GV LQ +K+  + D+  F   +GL W ++ G+   + E +++ +LGKR
Sbjct: 662 NIDEIPEMKKGQGVTLQKFKNAKLLDIKIFNKEDGLGW-NNNGKV--KLEKNIVAFLGKR 718

Query: 734 GGVGSLVPKGFPRSGKFLS 752
           G  G L P GFP++ +F S
Sbjct: 719 GSTGKLPPMGFPKNNRFSS 737


>gi|34580944|ref|ZP_00142424.1| topoisomerase IV subunit A [Rickettsia sibirica 246]
 gi|28262329|gb|EAA25833.1| topoisomerase IV subunit A [Rickettsia sibirica 246]
          Length = 738

 Score =  771 bits (1991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/739 (50%), Positives = 530/739 (71%), Gaps = 4/739 (0%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           E  V+ +    AL ERYLAYALSTI  R++PD+RDG KPVHRR+++AM ++ L+  + +K
Sbjct: 3   EAKVENIDFGNALSERYLAYALSTIMSRSLPDVRDGLKPVHRRLLYAMLQLRLEPNSGYK 62

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K AR+VG+VIGK HPHGD +VYD+LVRLAQ F  RYPLI GQGNFG+IDGD+AAA RYTE
Sbjct: 63  KCARVVGDVIGKYHPHGDVAVYDTLVRLAQHFSLRYPLIDGQGNFGSIDGDNAAAMRYTE 122

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           +RMT +  L+++ +D+D VDFR TY+  D EPV+ P+ FPNLLANG+ GIAVGMAT+IP 
Sbjct: 123 SRMTDICTLLMKDIDKDTVDFRPTYDGSDLEPVIMPASFPNLLANGSEGIAVGMATNIPP 182

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN+ E+C+A + LI++P   I  ++ ++ GPDFPTGGII++  E I  +Y  GRG  RVR
Sbjct: 183 HNLHELCDALIHLINHPTAEINDIINFVKGPDFPTGGIIIDKAEVINAAYTTGRGSLRVR 242

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           +RW  EE+  G++ IVVTEIPYQVQKS+LIE+IA L+  K+IPL+ +IRDES + +R+V+
Sbjct: 243 SRWEKEELSYGTYQIVVTEIPYQVQKSKLIEQIAILLKDKKIPLVSNIRDESTDIIRLVI 302

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            P++R  DP ++MES+F L+++E+R  LNMNV+    VP+VM +  IL+E+L HR+ ++ 
Sbjct: 303 EPRDRGCDPQIVMESLFKLTNLESRIQLNMNVIGSNNVPRVMNILEILQEFLYHRQNIVT 362

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS++ +  I  R+EILKGL IAYLN+DEII IIR ED+PK +M+ RF LTE QV+AILN
Sbjct: 363 RRSTYLLNKIKHRLEILKGLRIAYLNLDEIIKIIREEDEPKAIMMERFKLTEIQVEAILN 422

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
            RLR LRKLEE +I +E  NL  ++  ++ +LN+ K+ W  +  EI+ V+  F  +T +G
Sbjct: 423 TRLRLLRKLEEQEIINEHSNLQKQQAILEEILNNPKELWKIVKKEIKTVQTKFGLNTVIG 482

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
            RRT+F EV+  ++     A I KEPIT++ S  GW+RSLK H+ DLS + +KEGD+ K 
Sbjct: 483 ARRTSFEEVTLTNQVVDITAFIIKEPITIICSKMGWVRSLKGHNTDLSTIKYKEGDAEKF 542

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
            L A+TTD+IL++S++G+ +TL A N+  G+G GE+I+LL+D+ +N DI    VY     
Sbjct: 543 ILEAYTTDKILIVSSEGRFFTLLADNISKGKGTGESIKLLVDIGNN-DITNILVYKPDQL 601

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
           LL+ SS G  F+V  +E++A T+ GK  + V         + V GD +A +GE+RKLL+F
Sbjct: 602 LLLASSVGKGFLVNSNEVMAQTKTGKQIMNVPDGHVCIACLPVNGDSIACIGESRKLLVF 661

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
           +ID+IPEM +G+GV LQ +K+  + D+  F   +GL W ++ G+   + E +++ +LGKR
Sbjct: 662 NIDEIPEMKKGQGVTLQKFKNAKLLDIKIFNKEDGLGW-NNNGKV--KLEKNIVAFLGKR 718

Query: 734 GGVGSLVPKGFPRSGKFLS 752
           G  G L P GFP++ +F S
Sbjct: 719 GSTGKLPPMGFPKNNRFSS 737


>gi|254475270|ref|ZP_05088656.1| DNA topoisomerase IV, A subunit [Ruegeria sp. R11]
 gi|214029513|gb|EEB70348.1| DNA topoisomerase IV, A subunit [Ruegeria sp. R11]
          Length = 782

 Score =  771 bits (1991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/763 (50%), Positives = 518/763 (67%), Gaps = 38/763 (4%)

Query: 22  LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGE 81
           LR A+ ERYL YALSTI  RA+PD RDG KPVHRRI++AM+ + L     F KSA+I G+
Sbjct: 23  LRRAIGERYLTYALSTIMHRALPDARDGLKPVHRRILYAMNRLRLSSSGGFLKSAKISGD 82

Query: 82  VIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAE 141
            +G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEARMT +AE
Sbjct: 83  TMGDFHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDGDNPAASRYTEARMTFIAE 142

Query: 142 LILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICE 201
            +L+G++E+AVDFRD Y+   +EP V P+ FPN+LANG SGIAVGMAT+IP HN+ E+ +
Sbjct: 143 AMLEGLNENAVDFRDNYDGRLTEPAVLPATFPNILANGASGIAVGMATNIPPHNIAELID 202

Query: 202 AALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEV 261
           A + LI  P+   + LL Y+ GPDFPTGGIIVE +E+I ++Y  GRG FR+R +  VE++
Sbjct: 203 ACIHLIRTPDARDDTLLNYVPGPDFPTGGIIVEPKENIAKAYSTGRGSFRLRCQHEVEDL 262

Query: 262 GRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLD 321
           GRG W IVVTEIPYQVQKS+LIEKIAELI  K++P+L D+RDESA+D+RI+L PK++++D
Sbjct: 263 GRGQWQIVVTEIPYQVQKSKLIEKIAELIQTKKVPILADVRDESADDIRIILEPKSKNVD 322

Query: 322 PDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQ 381
           P++LM  +F  SD+E RF LNMNVL  G  P+V  +  +L+ +L HRR+VL RRS  RM 
Sbjct: 323 PEVLMNMMFRNSDLEVRFSLNMNVLIDGVTPKVCSMKEVLRAFLDHRRDVLQRRSQHRMD 382

Query: 382 AIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSR--------------------- 420
            ID R+E+L+G +IA+LN+D +I IIR +D PK  ++                       
Sbjct: 383 KIDHRLEVLEGFIIAFLNLDRVIDIIRYDDDPKAALMREDWDRDHPRAYSEAEYVSPGEG 442

Query: 421 -FSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEI 479
              LTE Q +AILN+RLRSLR+LEE ++  E D L  E+  +  LL S + QW++I  ++
Sbjct: 443 VGELTEVQAEAILNMRLRSLRRLEEIELTRERDALREERAGLVELLGSEELQWSRITEQL 502

Query: 480 REVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVD 539
           ++ K+ F K    G RRT F E    +   L +AMI++EPITVV S  GWIR++  H +D
Sbjct: 503 KDTKKQFGKDYAGGARRTRFAEAGEVEDVPL-EAMIDREPITVVCSQMGWIRAMTGH-ID 560

Query: 540 LS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNH 598
           L+  L FK+GD  +   HA TTDR+L+  ++G+ YT+ A NL  GRG GE ++L++DL +
Sbjct: 561 LNRELKFKDGDGPRFIFHAETTDRLLVFGSNGRFYTVSAANLPGGRGMGEPLRLMVDLPN 620

Query: 599 NQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG 658
             +IV   +++   +LLV S  GN FI  E +I+A TR GK  L V  ++K K+ + V G
Sbjct: 621 EVEIVDILIHNPDGRLLVASDAGNGFICAEKDIVAQTRSGKQVLNVKDDDKAKICIPVEG 680

Query: 659 DHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYK-----------DGGISDVICFKICE 707
           DHVAVV EN K L+FS++++PE+SRGKGVRLQ Y            DGG+SD+  F   E
Sbjct: 681 DHVAVVSENGKFLVFSVEEMPELSRGKGVRLQKYNMARGKQGALELDGGLSDITTFNWDE 740

Query: 708 GLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           GL W    G++  R E DL  WLGKR  VG   P GFPR+ KF
Sbjct: 741 GLKWEMGGGKT--RHEGDLTEWLGKRASVGKRPPHGFPRNYKF 781


>gi|294011464|ref|YP_003544924.1| topoisomerase IV subunit A [Sphingobium japonicum UT26S]
 gi|292674794|dbj|BAI96312.1| topoisomerase IV subunit A [Sphingobium japonicum UT26S]
          Length = 762

 Score =  769 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/745 (50%), Positives = 516/745 (69%), Gaps = 20/745 (2%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA------------- 71
           AL +RYL YALSTI  R++PDLRDG KPVHRR++ AM  + ++ G A             
Sbjct: 19  ALSQRYLVYALSTITARSLPDLRDGLKPVHRRLLWAMRLLKMEPGGASPDVLVANPARNT 78

Query: 72  --FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAY 129
             +KK AR+VG+VIGK HPHGD SVYD++VRLAQ F  R PL+ GQGNFGNIDGD+AAA 
Sbjct: 79  TSYKKCARVVGDVIGKYHPHGDASVYDAMVRLAQDFSLRTPLVDGQGNFGNIDGDNAAAM 138

Query: 130 RYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMAT 189
           RYTEAR+TQ A  ++ G+DE  V+FR TYN ED EP VFP  FPNLLANG SGIAVGMAT
Sbjct: 139 RYTEARLTQAAADLMAGLDEGTVEFRPTYNGEDQEPEVFPGLFPNLLANGASGIAVGMAT 198

Query: 190 SIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGG 249
           SIP HNV E+ +AA  LIDNP+    +L+  + GPDFPTGG++V+S   I E+Y  GRG 
Sbjct: 199 SIPPHNVAELIDAASLLIDNPDAEHAELMRIVRGPDFPTGGVLVDSPSIISEAYATGRGS 258

Query: 250 FRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDV 309
           FR RARW  E+ GRG+W  VVT+IP+QVQKS+LIE+IA LI  +++P+L D+RDES E +
Sbjct: 259 FRTRARWHKEDGGRGTWVAVVTQIPFQVQKSKLIEQIAALINDRKLPILADVRDESDELI 318

Query: 310 RIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRR 369
           RIV+ P+ R++DPD+LM+S+F L+D+E RFPLN+NVL   R P+V+ L  +L EWL H+ 
Sbjct: 319 RIVIEPRARTVDPDVLMDSLFRLTDLENRFPLNLNVLDATRTPRVLGLKPVLIEWLKHQI 378

Query: 370 EVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVD 429
           +VL +R+  R+  I  R+E+L G +IAYLN+D +I IIR ED+PK VM++ F L + Q +
Sbjct: 379 DVLVKRAQHRLDKIAARLELLDGYIIAYLNLDRVIEIIRTEDEPKEVMMAEFGLNDRQAE 438

Query: 430 AILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKS 489
           AILN+RLRSLRKLEE +++ E   LL E++ +  L+ S  +Q  ++  ++ ++++ +S  
Sbjct: 439 AILNMRLRSLRKLEEMELRREHSELLKERDDLIKLVESPARQRTRLKKDLADLRKRYSPD 498

Query: 490 TDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSA--LHFKE 547
           +D GRRRT   E + A +  L +AMIEKEPITV++S RGWIR++  H    SA  L FKE
Sbjct: 499 SDFGRRRTLVEEAAPAREIPL-EAMIEKEPITVILSERGWIRAMSGHRDLASADTLKFKE 557

Query: 548 GDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFV 607
           GD   IA HA TTD++LL +  G+ +TL A  L  GRG G+ ++ L+D++    IV    
Sbjct: 558 GDGPMIAFHAQTTDKLLLATETGRIFTLGADKLPGGRGFGDPVRSLVDMDGTGQIVALMP 617

Query: 608 YDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVT--GDHVAVVG 665
             +  +LL+ SS G  F+   +++IA TRKGK  + V +  K+ +V  +    D VAVVG
Sbjct: 618 ARTGGELLLASSDGRGFVAAVADVIAETRKGKQVVNVRTGAKLSVVHPIAPDADSVAVVG 677

Query: 666 ENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSEND 725
           ENRKLL+FS+ ++P M+RG+GV++Q Y+DGG+SD I F++ +GL+W    G    R+E D
Sbjct: 678 ENRKLLVFSLIEMPRMARGQGVQMQRYRDGGLSDAIAFRLSDGLSWAMGGGTGRVRTEAD 737

Query: 726 LLGWLGKRGGVGSLVPKGFPRSGKF 750
           +  W   RG  G + P GFPR  +F
Sbjct: 738 MTPWRVARGAAGRMPPTGFPRDNRF 762


>gi|6502510|gb|AAF14339.1|U86302_2 ParC [Caulobacter crescentus CB15]
 gi|2749945|gb|AAC38043.1| DNA topoisomerase IV ParC subunit [Caulobacter crescentus CB15]
          Length = 759

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/734 (51%), Positives = 514/734 (70%), Gaps = 11/734 (1%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIG 84
           AL  RYLAYALSTI  RA+PD+RDG KPVHRR+++AMS M L+  AA +K A++VGEV+G
Sbjct: 26  ALSRRYLAYALSTIGSRALPDVRDGLKPVHRRVLYAMSNMRLNPDAAARKCAKVVGEVMG 85

Query: 85  KLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELIL 144
             HPHGD S+YD+LVRLAQ F QR PL+ GQGNFGNIDGDSAAA RYTE +MT+ A L+L
Sbjct: 86  NFHPHGDASIYDALVRLAQEFSQRIPLVEGQGNFGNIDGDSAAAMRYTECKMTEAAMLLL 145

Query: 145 QGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAAL 204
            G+DEDAVDFR TY+ +D EPVV PS FPNLLANG+SGIAVGMATSIP HN  E+ +A  
Sbjct: 146 DGIDEDAVDFRPTYDGQDEEPVVLPSGFPNLLANGSSGIAVGMATSIPPHNAAELIDACQ 205

Query: 205 ALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRG 264
            L+ NP+ +   LLE + GPDFPTGG+IVESR S++E+Y  GRGG R+RA+W  E+ GRG
Sbjct: 206 LLLANPDATTADLLEKVPGPDFPTGGVIVESRASLLETYETGRGGVRMRAKWEKEDTGRG 265

Query: 265 SWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDL 324
           ++ IVVTEIPYQV+KS L+E++A+LI +K+  LL D+RDESAED+R+VL PK+++++P++
Sbjct: 266 TYQIVVTEIPYQVKKSDLVEQLADLIDSKKAALLGDVRDESAEDIRLVLEPKSKNVEPEV 325

Query: 325 LMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAID 384
           LMES+F LS +E+RFP+N+NVL     P VM +   L  +LAHRREVL RR+  R+  I+
Sbjct: 326 LMESLFKLSALESRFPVNINVLDARGTPGVMGIKQALMAFLAHRREVLTRRARHRLAKIE 385

Query: 385 RRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEE 444
            R+ IL GLLIAYLN+DE+I I+R EDKPK  ++  F LT+ Q DAILN RLR L KLEE
Sbjct: 386 ARLHILDGLLIAYLNLDEVIRIVRYEDKPKEKLIETFGLTDIQADAILNTRLRQLAKLEE 445

Query: 445 YQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREV-------KEIFSKSTDLG-RRR 496
            +I+ E   L+ E++ I ++L S  +QW  +   + EV       K    K    G   R
Sbjct: 446 MEIRREHAELVEERDGILAMLASEAKQWKLVGVGLSEVRAALLKIKHPLDKPAPTGVTGR 505

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
           + F E  + D     +AMI +EPIT+++S RGWIR+ K    D S L FKEGD L   + 
Sbjct: 506 SVFGEAPQVDADAAIEAMIVREPITIILSERGWIRAAKGKIDDPSELKFKEGDKLGFLVP 565

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
           A TTD++L+ S+DG+ +TL    L S RGHGE ++++I+L+    I+  F + +  K ++
Sbjct: 566 AETTDKLLIFSSDGRFFTLGCDKLPSARGHGEPVRMMIELDDKVKIIDVFPFKAGRKRIL 625

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSID 676
            S  G  F++ E E +AN + GK  L V + E     ++  GD +AV+G+N K+LIF ++
Sbjct: 626 ASKGGYGFLMPEEEALANRKAGKQVLNVGN-EGAAFCLEAVGDQLAVIGDNGKILIFPLE 684

Query: 677 QIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGV 736
           ++PEM RGKGV+LQ+Y++GG+ D + F    G  WID+AGR  + +E     W+G+R G 
Sbjct: 685 ELPEMPRGKGVKLQAYREGGLRDGLSFNAETGAYWIDTAGRRRDWAE--WKEWVGRRAGA 742

Query: 737 GSLVPKGFPRSGKF 750
           G LVPKGF  + +F
Sbjct: 743 GKLVPKGFATNKRF 756


>gi|16125813|ref|NP_420377.1| DNA topoisomerase IV subunit A [Caulobacter crescentus CB15]
 gi|221234574|ref|YP_002517010.1| DNA topoisomerase IV subunit A [Caulobacter crescentus NA1000]
 gi|13638360|sp|O54478|PARC_CAUCR RecName: Full=DNA topoisomerase 4 subunit A; AltName:
           Full=Topoisomerase IV subunit A
 gi|13422955|gb|AAK23545.1| topoisomerase IV, subunit A [Caulobacter crescentus CB15]
 gi|220963746|gb|ACL95102.1| topoisomerase IV subunit A [Caulobacter crescentus NA1000]
          Length = 759

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/734 (51%), Positives = 514/734 (70%), Gaps = 11/734 (1%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIG 84
           AL  RYLAYALSTI  RA+PD+RDG KPVHRR+++AMS M L+  AA +K A++VGEV+G
Sbjct: 26  ALSRRYLAYALSTIGSRALPDVRDGLKPVHRRVLYAMSNMRLNPDAAARKCAKVVGEVMG 85

Query: 85  KLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELIL 144
             HPHGD S+YD+LVRLAQ F QR PL+ GQGNFGNIDGDSAAA RYTE +MT+ A L+L
Sbjct: 86  NFHPHGDASIYDALVRLAQEFSQRIPLVEGQGNFGNIDGDSAAAMRYTECKMTEAAMLLL 145

Query: 145 QGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAAL 204
            G+DEDAVDFR TY+ +D EPVV PS FPNLLANG+SGIAVGMATSIP HN  E+ +A  
Sbjct: 146 DGIDEDAVDFRPTYDGQDEEPVVLPSGFPNLLANGSSGIAVGMATSIPPHNAAELIDACQ 205

Query: 205 ALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRG 264
            L+ NP+ +   LLE + GPDFPTGG+IVESR S++E+Y  GRGG R+RA+W  E+ GRG
Sbjct: 206 LLLANPDATTADLLEKVPGPDFPTGGVIVESRASLLETYETGRGGVRMRAKWEKEDTGRG 265

Query: 265 SWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDL 324
           ++ IVVTEIPYQV+KS L+E++A+LI +K+  LL D+RDESAED+R+VL PK+++++P++
Sbjct: 266 TYQIVVTEIPYQVKKSDLVEQLADLIDSKKAALLGDVRDESAEDIRLVLEPKSKNVEPEV 325

Query: 325 LMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAID 384
           LMES+F LS +E+RFP+N+NVL     P VM +   L  +LAHRREVL RR+  R+  I+
Sbjct: 326 LMESLFKLSALESRFPVNINVLDARGTPGVMGIKQALMAFLAHRREVLTRRARHRLAKIE 385

Query: 385 RRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEE 444
            R+ IL GLLIAYLN+DE+I I+R EDKPK  ++  F LT+ Q DAILN RLR L KLEE
Sbjct: 386 ARLHILDGLLIAYLNLDEVIRIVRYEDKPKEKLIETFGLTDIQADAILNTRLRQLAKLEE 445

Query: 445 YQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREV-------KEIFSKSTDLG-RRR 496
            +I+ E   L+ E++ I ++L S  +QW  +   + EV       K    K    G   R
Sbjct: 446 MEIRREHAELVEERDGILAMLASEAKQWKLVGVGLSEVRAALLKIKHPLDKPRPTGVTGR 505

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
           + F E  + D     +AMI +EPIT+++S RGWIR+ K    D S L FKEGD L   + 
Sbjct: 506 SVFGEAPQVDADAAIEAMIVREPITIILSERGWIRAAKGKIDDPSELKFKEGDKLGFLVP 565

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
           A TTD++L+ S+DG+ +TL    L S RGHGE ++++I+L+    I+  F + +  K ++
Sbjct: 566 AETTDKLLIFSSDGRFFTLGCDKLPSARGHGEPVRMMIELDDKVKIIDVFPFKAGRKRIL 625

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSID 676
            S  G  F++ E E +AN + GK  L V + E     ++  GD +AV+G+N K+LIF ++
Sbjct: 626 ASKGGYGFLMPEEEALANRKAGKQVLNVGN-EGAAFCLEAVGDQLAVIGDNGKILIFPLE 684

Query: 677 QIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGV 736
           ++PEM RGKGV+LQ+Y++GG+ D + F    G  WID+AGR  + +E     W+G+R G 
Sbjct: 685 ELPEMPRGKGVKLQAYREGGLRDGLSFNAETGAYWIDTAGRRRDWAE--WKEWVGRRAGA 742

Query: 737 GSLVPKGFPRSGKF 750
           G LVPKGF  + +F
Sbjct: 743 GKLVPKGFATNKRF 756


>gi|157803253|ref|YP_001491802.1| DNA topoisomerase IV subunit A [Rickettsia canadensis str. McKiel]
 gi|157784516|gb|ABV73017.1| DNA topoisomerase IV subunit A [Rickettsia canadensis str. McKiel]
          Length = 738

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/729 (51%), Positives = 527/729 (72%), Gaps = 4/729 (0%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIG 84
           AL ERYLAYALSTI  R++PD+RDG KPVHRR+++AM ++ L+  + +KK AR+VG+VIG
Sbjct: 14  ALSERYLAYALSTIMSRSLPDVRDGLKPVHRRLLYAMLQLRLEPNSGYKKCARVVGDVIG 73

Query: 85  KLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELIL 144
           K HPHGD +VYD+LVRLAQ F  RYPLI GQGNFG+IDGD+AAA RYTE+RMT++  L++
Sbjct: 74  KYHPHGDGAVYDTLVRLAQYFSLRYPLIDGQGNFGSIDGDNAAAMRYTESRMTEICMLLM 133

Query: 145 QGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAAL 204
             +D+D VDFR TY++ D EPV+ P+ FPNLLANG+ GIAVGMAT+IP HN+ E+C+A +
Sbjct: 134 DDIDKDTVDFRPTYDDSDLEPVIMPASFPNLLANGSEGIAVGMATNIPPHNLHELCDALI 193

Query: 205 ALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRG 264
            LID+P+  +  ++ +I GPDFPTGGII++  E I  +Y  GRG  RVR+RW  EE+  G
Sbjct: 194 HLIDHPKAEVNDIMNFIKGPDFPTGGIIIDKAEVINAAYSTGRGSLRVRSRWKKEELSYG 253

Query: 265 SWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDL 324
           ++ IVVTEIPYQVQKS+LIE+IA L+  K+IPL+ +IRDES + +R+V+ P++R+ DP +
Sbjct: 254 TYQIVVTEIPYQVQKSKLIEQIAILLKDKKIPLVSNIRDESTDIIRLVIEPRDRNCDPQV 313

Query: 325 LMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAID 384
           +MES+F L+++E+R  LNMNV+    VP+VM +  IL+E+L HR+ ++ RRS++ +  I 
Sbjct: 314 VMESLFKLTNLESRIQLNMNVIGSNNVPRVMNILEILQEFLDHRQSIVTRRSTYLLNKIQ 373

Query: 385 RRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEE 444
            R+EIL+GL IAYLN DEII IIR ED+PK +M++ F LTE QV+AILN RLRSL +LEE
Sbjct: 374 HRLEILEGLRIAYLNFDEIIKIIREEDEPKAIMINWFKLTEIQVEAILNTRLRSLHRLEE 433

Query: 445 YQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSR 504
            +I +E  NL  ++  ++ +LN+ K+ W  +  EI+ V+  F  +T +G RRT F EV+ 
Sbjct: 434 QKIINEHSNLKKQQVILEEILNNPKELWKVVKKEIKTVQTKFGLNTVIGARRTYFEEVTL 493

Query: 505 ADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRIL 564
            ++     A I KEPIT++ S  GW+RS K H+ DLS + +KEGD+ K  L A+TTD++L
Sbjct: 494 TNQVVDITAFITKEPITIICSKMGWVRSFKGHNNDLSNIKYKEGDTEKFILKAYTTDKLL 553

Query: 565 LLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAF 624
           ++S++G+ +TL A N+  G+G  E+I+LL+D+ +N DI    VY     LL+ SS G  F
Sbjct: 554 IVSSEGRFFTLLADNISKGKGTEESIKLLVDIGNN-DITNILVYKPDQLLLLASSIGKGF 612

Query: 625 IVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRG 684
           +V  +E+IA T+ GK  + V +       +   GD VA +GE+RKLL+F+ID+IPEM +G
Sbjct: 613 LVNSNEVIAQTKTGKQIMNVPNGHICITCLPANGDSVACIGESRKLLVFNIDEIPEMKKG 672

Query: 685 KGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGF 744
           +GV LQ +KD  + DV  F   +GL W ++ G+   + E +++ +LGKRGG G L P GF
Sbjct: 673 QGVTLQKFKDAKLLDVKIFNKEDGLGW-NNNGKV--KLEKNIITFLGKRGGAGKLPPMGF 729

Query: 745 PRSGKFLSS 753
           P++ +F SS
Sbjct: 730 PKNNRFSSS 738


>gi|326388525|ref|ZP_08210119.1| DNA topoisomerase IV subunit A [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326206990|gb|EGD57813.1| DNA topoisomerase IV subunit A [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 770

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/747 (50%), Positives = 514/747 (68%), Gaps = 23/747 (3%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIG 84
           AL ERYL YALSTI  R++PDLRDG KPVHRR++ AM ++ LD   AFKKSAR+VG+VIG
Sbjct: 25  ALSERYLVYALSTITARSLPDLRDGLKPVHRRLLWAMRQLRLDPTGAFKKSARVVGDVIG 84

Query: 85  KLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELIL 144
           K HPHGD SVYD++VRLAQ F  RYPL+ GQGNFGNIDGD+AAAYRYTEAR+T  A  ++
Sbjct: 85  KYHPHGDASVYDAMVRLAQDFALRYPLVEGQGNFGNIDGDNAAAYRYTEARLTATAARLM 144

Query: 145 QGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAAL 204
            G+DE  VDF  TYN E+ EP +FP  FPNLLANG++GIAVGMATSIPSHNV EI +A L
Sbjct: 145 AGLDEGTVDFHPTYNGEEHEPEIFPGLFPNLLANGSTGIAVGMATSIPSHNVAEIVDATL 204

Query: 205 ALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWC------- 257
            LIDNP +   +L+    GPDFPTGG++V+S  +I  +Y +G+G  RVR R+        
Sbjct: 205 MLIDNPYVEHAQLMTVFHGPDFPTGGVVVDSPAAISSAYEVGKGAIRVRGRFSTGRDEAG 264

Query: 258 ------VEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRI 311
                 +E++G G W +V++EIPY V K +LIE+IA LI  K++P+LED+RDES E +RI
Sbjct: 265 EWEDSGIEKLGSGQWQLVISEIPYMVAKGKLIEQIAALIADKKLPILEDVRDESDEHIRI 324

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           VL PK+R++DPDLL ES++ L+++E+RF LN+N+L   R P V+ L  IL+EW+  + ++
Sbjct: 325 VLVPKSRNVDPDLLKESLYRLTELESRFSLNLNMLDARRTPGVLGLKQILQEWVIAQIDI 384

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           L RRS  R+  I  R+E+L G +IAYLN+D II IIR ED+PKPVM++ F LT+ Q +AI
Sbjct: 385 LVRRSQHRLDKIAARLELLDGYIIAYLNLDRIIEIIRTEDEPKPVMMAEFGLTDRQAEAI 444

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           LN+RLRSLRKLEE +++ E D LLAE++++  LL +  +Q  ++  ++  +++ +   T 
Sbjct: 445 LNMRLRSLRKLEEMELRRERDALLAEQDELTKLLENPARQRTRLKRDLAALRKEYGPDTA 504

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSA------LHF 545
           LGRRRTT  E +   + ++  AMIEKEP+TV++S RGWIR+ K H V L          F
Sbjct: 505 LGRRRTTIAEAAPTREFSM-DAMIEKEPVTVILSQRGWIRAAKGH-VPLGTDGKGEDFKF 562

Query: 546 KEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTA 605
           KEGD    A HA TTD++L+   +G+ YTL A  L   RG GE I+ ++D++ N  +V  
Sbjct: 563 KEGDGPAFAFHAQTTDKLLIAIDNGRFYTLGADKLPGARGFGEPIRTVLDIDPNGQVVAI 622

Query: 606 FVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG--DHVAV 663
           F +    +LL+ ++ G  F+ E  E++A TRKG+  +       + +V ++    DHVAV
Sbjct: 623 FPWRHGGQLLLAANNGRGFVAEMDELLAETRKGRGVVSTKPGVHLAVVREIAPEHDHVAV 682

Query: 664 VGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSE 723
           VGENRKL+IF++ ++P + +G+GV LQ YKDGG+SD +  K+ +GL+W         R+E
Sbjct: 683 VGENRKLVIFALSEMPVLGKGQGVTLQRYKDGGLSDAVTLKLEDGLSWAMGGETGRTRTE 742

Query: 724 NDLLGWLGKRGGVGSLVPKGFPRSGKF 750
            DLL W   RG  G L P GFPR  KF
Sbjct: 743 KDLLPWKVARGAAGRLPPTGFPRDNKF 769


>gi|258543011|ref|YP_003188444.1| DNA topoisomerase IV subunit A [Acetobacter pasteurianus IFO
           3283-01]
 gi|256634089|dbj|BAI00065.1| DNA topoisomerase IV subunit A [Acetobacter pasteurianus IFO
           3283-01]
 gi|256637149|dbj|BAI03118.1| DNA topoisomerase IV subunit A [Acetobacter pasteurianus IFO
           3283-03]
 gi|256640201|dbj|BAI06163.1| DNA topoisomerase IV subunit A [Acetobacter pasteurianus IFO
           3283-07]
 gi|256643258|dbj|BAI09213.1| DNA topoisomerase IV subunit A [Acetobacter pasteurianus IFO
           3283-22]
 gi|256646313|dbj|BAI12261.1| DNA topoisomerase IV subunit A [Acetobacter pasteurianus IFO
           3283-26]
 gi|256649366|dbj|BAI15307.1| DNA topoisomerase IV subunit A [Acetobacter pasteurianus IFO
           3283-32]
 gi|256652352|dbj|BAI18286.1| DNA topoisomerase IV subunit A [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655410|dbj|BAI21337.1| DNA topoisomerase IV subunit A [Acetobacter pasteurianus IFO
           3283-12]
          Length = 742

 Score =  765 bits (1976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/727 (51%), Positives = 518/727 (71%), Gaps = 7/727 (0%)

Query: 16  NVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKS 75
           +++   L  AL ERYLAYALSTI  R++PD+RDG KPVHRR+++AM ++ LD  + FKK 
Sbjct: 15  HIEETKLAEALSERYLAYALSTIMSRSLPDVRDGLKPVHRRLVYAMHQLRLDPASGFKKC 74

Query: 76  ARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEAR 135
           AR+VG+VIGK HPHGD SVY++LVRLAQ F  RYPL+ GQGNFG++DGD+ AA RYTEAR
Sbjct: 75  ARVVGDVIGKFHPHGDASVYEALVRLAQDFAARYPLVEGQGNFGSVDGDNPAAMRYTEAR 134

Query: 136 MTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHN 195
           +T+VA  +L G+++DAVDFR TY+ E+ EPVV PS FPNLLANG +GIAVGMATSIP HN
Sbjct: 135 LTEVAVALLDGIEDDAVDFRPTYDGEEQEPVVLPSAFPNLLANGAAGIAVGMATSIPPHN 194

Query: 196 VQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRAR 255
             E+C AA  L+  P  + ++LLE + GPDFPTGG+IVE  ++I+++Y  GRG FR+RAR
Sbjct: 195 AAEVCAAAALLVRKPSATTQELLELMPGPDFPTGGLIVEDSDAILQAYETGRGSFRMRAR 254

Query: 256 WCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFP 315
           W VE+   G+W IVVT+IPYQVQKSRLIE+IA+L+  K++PLL DIRDES +++R+VL P
Sbjct: 255 WEVEQGRFGTWHIVVTQIPYQVQKSRLIEQIADLLDQKKLPLLGDIRDESTDEIRLVLEP 314

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           K R ++P++LME++F  + +E+RF LNMNVL   R P VM L  +++ WL HR EVL RR
Sbjct: 315 KTRGIEPEVLMETLFRATPLESRFGLNMNVLGADRSPGVMGLKQVIQAWLDHRHEVLERR 374

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
           S  R+ A++RR+EIL G L  YLN+D++I IIR ED  K  +++ F LT+ Q +++LN+R
Sbjct: 375 SRHRLTAVERRLEILSGFLAVYLNLDKVIRIIREEDDAKASLIATFKLTDLQAESVLNMR 434

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LRSLR+LEE +I+ E D L AEK  + +LL+S KQ+W  I  E+  + + F K   LG R
Sbjct: 435 LRSLRRLEEMEIRKEHDALSAEKAALMALLDSEKQRWKTIERELTGMIKAFGKGR-LGER 493

Query: 496 RTTFCEVSR-ADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIA 554
           R+T     +  D + +++  +E+EP+T+++S +GW+R++K H+VDL    FKEGD+LK+A
Sbjct: 494 RSTILSAPKPVDISVVEE--VEREPLTMILSQKGWVRAVKGHNVDLENQKFKEGDALKLA 551

Query: 555 LHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKL 614
           +   TTDR+   +TDG+AYT+   +L  GRG G+ I+LLIDL++++D++  F  +   + 
Sbjct: 552 IPCQTTDRLCFFATDGRAYTVKGADLPRGRGDGQPIRLLIDLSNDEDLLAVFPIEDGKRR 611

Query: 615 LVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
           LV SS G   +VEE  ++A  R G+  L +   E  ++ V   GDHVAVVG+NR+ LIF 
Sbjct: 612 LVASSAGRGMLVEEEALVAEKRSGRQVLNLKEGEFARVCVPAEGDHVAVVGDNRRFLIFP 671

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
           ++Q+P M+RG GV LQ Y DGG+   + F   +GL W    G +  R   DL  W+ +R 
Sbjct: 672 LEQLPVMARGLGVALQKYSDGGLRQAVVFTAADGLHW---PGTARIRQFADLQDWVSRRA 728

Query: 735 GVGSLVP 741
            VG + P
Sbjct: 729 AVGKVAP 735


>gi|85373274|ref|YP_457336.1| DNA topoisomerase IV subunit A [Erythrobacter litoralis HTCC2594]
 gi|84786357|gb|ABC62539.1| DNA topoisomeraseIV subunitA [Erythrobacter litoralis HTCC2594]
          Length = 769

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/748 (50%), Positives = 518/748 (69%), Gaps = 24/748 (3%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIG 84
           ALEERYL YALSTI  R++PDLRDG KPVHRR++  M ++ LD    FKKSAR+VGEVIG
Sbjct: 24  ALEERYLVYALSTITARSLPDLRDGLKPVHRRLLWTMRQLKLDPTNTFKKSARVVGEVIG 83

Query: 85  KLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELIL 144
           K HPHGD + YD++VRLAQ F  RYPL+ GQGNFGNIDGD+AAAYRYTEAR+T+ A  ++
Sbjct: 84  KYHPHGDTAAYDAMVRLAQDFALRYPLVEGQGNFGNIDGDNAAAYRYTEARLTRTAMALM 143

Query: 145 QGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAAL 204
            G+DE  VDF  TYN E+ EP + P  FPNLLANG SGIAVGMAT+IPSHNV EI +A L
Sbjct: 144 AGLDEGTVDFIPTYNGEEEEPELMPGLFPNLLANGASGIAVGMATNIPSHNVHEIIDATL 203

Query: 205 ALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW-------- 256
            LIDNP +   +L+E   GPD PTGG+IV+S E I  +Y  GRG FR+R R+        
Sbjct: 204 ELIDNPHVEHARLMELFQGPDLPTGGLIVDSPEVISNAYETGRGSFRIRGRFHAAEAEKQ 263

Query: 257 -----CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRI 311
                 +E +G G W +V++EIPYQVQK +LIE+IA+ I  K++P+L+D+RDES E +RI
Sbjct: 264 ADQGAGIERLGGGQWQLVISEIPYQVQKGKLIEQIAQAIADKKLPILDDVRDESDEQIRI 323

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           VL P++R++DP+LL ESI+ L+DMETRF LN+NVL   R P VM L  +L+ W+  + E+
Sbjct: 324 VLVPRSRNIDPELLKESIYKLTDMETRFGLNLNVLDATRTPMVMGLKELLENWVRSQIEI 383

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           L RR+  R+  I RR+E+++G +IA+LN+D +I IIR ED+PK VM++ FSLT+ Q +AI
Sbjct: 384 LQRRTQHRLDQIARRLELVEGYIIAFLNLDRVIEIIRYEDEPKQVMMAEFSLTDRQAEAI 443

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           LN+RLRSLRKLEE ++K E  +LLAE+E+++ LL S  +Q  ++  +++ +++ +   T+
Sbjct: 444 LNMRLRSLRKLEEMELKQEKTDLLAEQEELEKLLGSPARQRTRLKRDLKALQKEYGLDTE 503

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSA-------LH 544
           LG RRTT  E     + ++  AMIEKEP+TVV+S +GW+R+ K H VDL           
Sbjct: 504 LGARRTTIAEAEPTVEFSM-DAMIEKEPVTVVLSQKGWVRAAKGH-VDLEGSKDGCGDFK 561

Query: 545 FKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVT 604
           +KEGD    A+H  TTD++LL + +G+ +TL A  L   RG GE ++  +D++    IV 
Sbjct: 562 YKEGDGPAFAVHCQTTDKVLLAADNGRFFTLGADKLPGARGFGEPVRNTLDIDAEAQIVA 621

Query: 605 AFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVT--GDHVA 662
             V +   +LL+ +  G  F  E  E++A TRKGK  + +  + K+++V  +    DHVA
Sbjct: 622 MLVSNPRGRLLLAADTGKGFAAEMGELVAETRKGKQVVNLKGDAKLRVVRPIADCDDHVA 681

Query: 663 VVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRS 722
           VVGENRKL++F+++++P ++RG+GV+LQ Y+DGG+SD   F + +GL+W         R+
Sbjct: 682 VVGENRKLVVFNLEELPVLARGQGVQLQRYRDGGLSDAKTFVLDQGLSWQMGGKGDRTRT 741

Query: 723 ENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           E D+  W   RGG G L P+GFPR  +F
Sbjct: 742 ETDIWQWKVARGGAGRLPPQGFPRDNRF 769


>gi|329850741|ref|ZP_08265586.1| DNA topoisomerase IV, A subunit [Asticcacaulis biprosthecum C19]
 gi|328841056|gb|EGF90627.1| DNA topoisomerase IV, A subunit [Asticcacaulis biprosthecum C19]
          Length = 733

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/720 (51%), Positives = 509/720 (70%), Gaps = 8/720 (1%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIG 84
           AL +RYLAYALSTI  RA+PD+RDG KPVHRR+++AMS M L+  AA +K A++VGEV+G
Sbjct: 17  ALSKRYLAYALSTIMHRALPDVRDGLKPVHRRVLYAMSNMRLNPEAAARKCAKVVGEVMG 76

Query: 85  KLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELIL 144
             HPHGDQ++YD+LVR+AQ F QRY L+ GQGNFGNIDGD+AAA RYTE R+T  A +IL
Sbjct: 77  NFHPHGDQAIYDALVRMAQNFAQRYELVQGQGNFGNIDGDNAAAMRYTECRLTLAAMMIL 136

Query: 145 QGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAAL 204
            G++EDAVDFR TY+++D+EPVV P  FPNLLANG  GIAVGMATS+P HNV E+ +A  
Sbjct: 137 DGINEDAVDFRPTYDDQDTEPVVLPGGFPNLLANGAIGIAVGMATSVPPHNVVELVDACR 196

Query: 205 ALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRG 264
            L+ N   +  +L+E+I GPDFPTGG+ VESR+SI E+Y  GRG  RVRAR+ VE+ GRG
Sbjct: 197 KLLQNHAATTAELMEFIPGPDFPTGGVCVESRKSIQEAYETGRGSVRVRARYEVEDAGRG 256

Query: 265 SWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDL 324
            W I+V EIPYQVQKSRLIE++A+LI AK+ PLL D+RDES E++R+VL PK+R+++P++
Sbjct: 257 QWRIIVREIPYQVQKSRLIEQLADLIEAKKAPLLGDVRDESDENIRLVLEPKSRNIEPEV 316

Query: 325 LMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAID 384
           LMES+F +SD+ETRFP+NMNVL     P+VM L   L  WL HRR VL R S++R++ I+
Sbjct: 317 LMESLFKISDLETRFPINMNVLDATGTPRVMGLRACLIAWLDHRRVVLLRMSNWRLEKIE 376

Query: 385 RRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEE 444
           +R+ +L GL+IA+LN+DE+I I+R EDKP+ +++SRF+L+E Q D IL+ RLR L +LEE
Sbjct: 377 KRLHLLDGLMIAFLNLDEVIRIVREEDKPRDMLMSRFTLSELQADYILDTRLRQLARLEE 436

Query: 445 YQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSR 504
             I+ E   L  E+E I +LL S K QW +I   + EV++          RRTT+ +   
Sbjct: 437 MVIQDEHKKLSEEREGILALLGSEKMQWKRIDQLLVEVRKKLPSP-----RRTTYADAPV 491

Query: 505 ADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRIL 564
             +    ++ + KE ITV++S RGWIR+ K    D S L FKEGD L   +  + TD+ L
Sbjct: 492 GIEVAAIESYLPKEAITVILSKRGWIRAAKGKVEDPSELKFKEGDELSFLVPGYNTDKFL 551

Query: 565 LLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAF 624
           +L+TDG+  TL    L S RGHGE ++L++D+  +  IVT F Y +  K ++V+  G  F
Sbjct: 552 ILTTDGRFLTLSGDKLPSARGHGEPLRLMLDIEESAKIVTVFAYTAGAKRVMVAKNGYGF 611

Query: 625 IVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRG 684
           ++ E + +AN R GK  + V   E M   ++VTGD + V+GEN K+L++ + ++PEM+RG
Sbjct: 612 VMNEEDAVANKRAGKQTMTVDGTEAMA-ALQVTGDLICVLGENNKVLVYPVTELPEMARG 670

Query: 685 KGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGF 744
           KGV+LQ+YKDGG+ D+  +       W D AG++  R   D+  ++G+R   G + P+G 
Sbjct: 671 KGVKLQAYKDGGVKDITVYDSNGSPQWFDGAGKA--RDFKDIKDYIGRRATAGKMAPRGL 728


>gi|332186872|ref|ZP_08388614.1| DNA topoisomerase IV, A subunit [Sphingomonas sp. S17]
 gi|332013205|gb|EGI55268.1| DNA topoisomerase IV, A subunit [Sphingomonas sp. S17]
          Length = 750

 Score =  763 bits (1971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/731 (52%), Positives = 505/731 (69%), Gaps = 7/731 (0%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIG 84
           AL ERYL YALSTI  R++PD+RDG KPVHRR++ AM  + LD  A +KK AR+VG+VIG
Sbjct: 21  ALSERYLVYALSTITARSLPDVRDGLKPVHRRLLWAMRLLKLDPAAGYKKCARVVGDVIG 80

Query: 85  KLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELIL 144
           K HPHGDQSVYD++VRLAQ F  RYPL+ GQGNFGNIDGD+AAAYRYTEAR+TQVA  ++
Sbjct: 81  KYHPHGDQSVYDAMVRLAQDFALRYPLVDGQGNFGNIDGDNAAAYRYTEARLTQVAIDLM 140

Query: 145 QGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAAL 204
            G+DEDAV +R TYN E+ EP +FP  FPNLLANG SGIAVGMATSIP HN  E+ +AA+
Sbjct: 141 DGLDEDAVAYRPTYNGEEQEPELFPGLFPNLLANGASGIAVGMATSIPPHNAAELLDAAI 200

Query: 205 ALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRG 264
            ++D+P+   + +L  + GPDFPTGGI+V++   + ESY  GRGGFRVRARW +E    G
Sbjct: 201 HVVDHPDADDDAILARVKGPDFPTGGIVVDAPAILRESYTTGRGGFRVRARWEIEREKGG 260

Query: 265 SWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDL 324
            W IVV+EIPY V K +LIE+IA LI  K++P+L D+RDES   VRIVL P++R++DP +
Sbjct: 261 GWQIVVSEIPYGVAKGKLIEQIATLINDKKLPILADVRDESDAQVRIVLEPRSRTVDPQV 320

Query: 325 LMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAID 384
           LM+ +F  SD+ETR  LN+NVL   R P+VM L   L  W+ H+  VL RRS  R+  I 
Sbjct: 321 LMDGLFRFSDLETRISLNLNVLDKDRTPRVMSLREALAAWVEHQFVVLRRRSEHRLGKIA 380

Query: 385 RRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEE 444
            R+E+L G L+AYLN+D +I IIR ED+PK VM+  F LT+ Q +AILN+RLRSLR+LEE
Sbjct: 381 DRIELLDGYLVAYLNLDRVIEIIRTEDEPKAVMIEEFRLTDRQAEAILNMRLRSLRRLEE 440

Query: 445 YQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSR 504
           ++I+ E D L  E+E++  LL S ++Q  ++  ++ ++++ +   T LG RRT   E + 
Sbjct: 441 FEIRGERDKLDKEREQLTQLLGSEQRQRTRMKKDLGKIRDRYGLETILGARRTLIEEAAP 500

Query: 505 ADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALH---FKEGDSLKIALHAHTTD 561
                L +AMIE+EPITV++S RGWIR++K H VDL++     FKEGD    A HA TTD
Sbjct: 501 TRDIPL-EAMIEREPITVILSQRGWIRAMKGH-VDLASAETAKFKEGDGPAFAFHAQTTD 558

Query: 562 RILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKG 621
           ++LL + +G+ +TL A  L  GRG GE ++ +IDL+ +  IV         KLLV +S G
Sbjct: 559 KLLLAAANGRFFTLAADKLPGGRGFGEPVRAMIDLDGSIGIVGFLPAARAAKLLVAASDG 618

Query: 622 NAFIVEESEIIANTRKGKTFLKVSSEEKMKLV--VKVTGDHVAVVGENRKLLIFSIDQIP 679
             FIV  ++ IA TRKGKT L   +   +K+V  V    D+VA +G+NRKLL+F + +  
Sbjct: 619 RGFIVPAADTIAETRKGKTVLTPRAGASLKVVRPVGAEDDYVAAIGDNRKLLVFPLTEFV 678

Query: 680 EMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSL 739
           E+SRG GV+LQ Y+DGG+SD   F   +GL+W         R+E DL  W   RG  G +
Sbjct: 679 ELSRGTGVQLQRYRDGGLSDATTFVFKDGLSWPMGGETGRVRTEADLSAWRTARGAAGRM 738

Query: 740 VPKGFPRSGKF 750
            P GFPR  +F
Sbjct: 739 PPTGFPRDNRF 749


>gi|149185900|ref|ZP_01864215.1| DNA topoisomerase IV subunit A [Erythrobacter sp. SD-21]
 gi|148830461|gb|EDL48897.1| DNA topoisomerase IV subunit A [Erythrobacter sp. SD-21]
          Length = 765

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/741 (49%), Positives = 510/741 (68%), Gaps = 16/741 (2%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIG 84
           AL ERYL YALSTI  R++PDLRDG KPVHRR++  M ++ LD  + FKKSAR+VGEVIG
Sbjct: 25  ALSERYLVYALSTITARSLPDLRDGLKPVHRRLLWTMRQLKLDPASGFKKSARVVGEVIG 84

Query: 85  KLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELIL 144
           K HPHGD + YD++VRLAQ F  RYPL+ GQGNFGNIDGD+AAAYRYTEAR+T+ A  ++
Sbjct: 85  KYHPHGDTAAYDAMVRLAQDFALRYPLVEGQGNFGNIDGDNAAAYRYTEARLTKTAMRLM 144

Query: 145 QGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAAL 204
           +G+D   VDF  TYN E+ EP + P  FPNLLANG SGIAVGMAT+IPSHNV EI +A L
Sbjct: 145 EGLDAGTVDFIPTYNNEEEEPEIMPGLFPNLLANGASGIAVGMATNIPSHNVAEIVDATL 204

Query: 205 ALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW-------- 256
            +IDNP +   +L+E   GPDF TGG++ ES E+I  +Y  GRG FRVR R+        
Sbjct: 205 EVIDNPHVEHARLMEIFKGPDFATGGVVPESTETISHAYETGRGSFRVRGRFHAAEAEKE 264

Query: 257 -----CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRI 311
                 +E +G G W +V++EIPYQV K +LIE+IA  I  +++P+LED+RDES E +RI
Sbjct: 265 EDKQAGIERLGGGQWQLVISEIPYQVAKGKLIEQIAAAIADRKLPILEDVRDESDEQIRI 324

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           VL P++R++DP+LL ESI+ L+DMETRF LN+NVL   R P VM L  +L+ W+A + ++
Sbjct: 325 VLVPRSRNVDPELLKESIYKLTDMETRFGLNLNVLDRTRTPMVMGLKELLENWIASQIDI 384

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           L RRS  R+  I RR+E++ G +IA+LN+D +I IIR ED+PKPVM+  F LT+ Q +AI
Sbjct: 385 LQRRSQHRLDQIARRLELVDGYIIAFLNLDRVIEIIRTEDEPKPVMMDEFKLTDRQAEAI 444

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           LN+RLRSLRKLEE Q++ E D LL E+++++ LL S  +Q  ++  ++  +++ +S+ T 
Sbjct: 445 LNMRLRSLRKLEEMQLRGEKDELLKEQDELEKLLGSPARQRTRLKRDLGALRKEYSEDTA 504

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
           LG RRTT  E + A + ++  AMIEKEP+TV++S +GWIR  K H        +KEGD+ 
Sbjct: 505 LGARRTTIEEAAPAVEFSM-DAMIEKEPVTVILSQKGWIRGAKGHLPLDQEFKYKEGDAP 563

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
              LHA TTD++LL+  DG+ +TL A  L   RG GE ++  +D++     V+  V+   
Sbjct: 564 AFVLHAQTTDKLLLIGNDGRVFTLGADKLPGARGFGEPVRNTLDIDGQAQFVSVVVHSEG 623

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLV--VKVTGDHVAVVGENRK 669
            ++L+ +S G  F V    ++A TRKG+  + V    K+ +   +    DHVAVVG+NRK
Sbjct: 624 QEVLLAASNGKGFAVGTDAMLAETRKGRQVMNVKGNVKLVVARPIAKAHDHVAVVGDNRK 683

Query: 670 LLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGW 729
           L++F+++++P +++G+G +LQ+Y+DGG+SD   F + +GL+W         R+E ++  W
Sbjct: 684 LVVFNLEELPRLAKGQGNKLQNYRDGGLSDATTFTMEDGLSWTMGGKEGRTRTEPEMWQW 743

Query: 730 LGKRGGVGSLVPKGFPRSGKF 750
              RGG G L P+GFPR  KF
Sbjct: 744 KVARGGAGRLPPQGFPRDNKF 764


>gi|329115618|ref|ZP_08244340.1| DNA topoisomerase 4 subunit A [Acetobacter pomorum DM001]
 gi|326695046|gb|EGE46765.1| DNA topoisomerase 4 subunit A [Acetobacter pomorum DM001]
          Length = 735

 Score =  757 bits (1955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/736 (50%), Positives = 520/736 (70%), Gaps = 11/736 (1%)

Query: 16  NVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKS 75
           +++   L  AL ERYLAYALSTI  R++PD+RDG KPVHRR+++AM ++ LD  + FKK 
Sbjct: 7   HIEETKLAEALSERYLAYALSTIMSRSLPDVRDGLKPVHRRLVYAMHQLRLDPASGFKKC 66

Query: 76  ARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEAR 135
           AR+VG+VIGK HPHGD SVY++LVRLAQ F  RYPL+ GQGNFG++DGD+ AA RYTEAR
Sbjct: 67  ARVVGDVIGKFHPHGDASVYEALVRLAQDFAARYPLVEGQGNFGSVDGDNPAAMRYTEAR 126

Query: 136 MTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHN 195
           +T+VA  +L G+++DAVDFR TY+ E+ EPVV PS FPNLLANG +GIAVGMATSIP HN
Sbjct: 127 LTEVAVALLDGIEDDAVDFRPTYDGEEQEPVVLPSAFPNLLANGAAGIAVGMATSIPPHN 186

Query: 196 VQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRAR 255
             E+C AA  L+  P  + ++LLE + GPDFPTGG+IVE  ++I+++Y  GRG FR+RAR
Sbjct: 187 AAEVCAAAALLVRKPSATTQELLELMPGPDFPTGGLIVEDSDAILQAYETGRGSFRMRAR 246

Query: 256 WCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFP 315
           W VE+    +W IVVT+IPYQVQKSRLIE+IA+L+  K++PLL DIRDES +++R++L P
Sbjct: 247 WEVEQGRFSTWHIVVTQIPYQVQKSRLIEQIADLLDQKKLPLLGDIRDESTDEIRLILEP 306

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           K R ++P++LME++F  + +E+RF LNMNVL   R P VM L  +++ WL HR EVL RR
Sbjct: 307 KTRGIEPEVLMETLFRATPLESRFGLNMNVLGADRSPGVMGLKQVIQAWLNHRHEVLERR 366

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
           S  R+ A++RR+EIL G L  YLN+DE+I IIR ED  K  +++ F LT+ Q +++LN+R
Sbjct: 367 SRHRLTAVERRLEILSGFLAVYLNLDEVIRIIREEDDAKASLIATFKLTDLQAESVLNMR 426

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LRSLR+LEE +I+ E D L AE+  + +LL+S KQ+W  I  E+  + + F K   LG R
Sbjct: 427 LRSLRRLEEMEIRKEHDALSAEQAALMALLDSEKQRWKTIERELTTMIKAFGKGR-LGER 485

Query: 496 RTTFCEVSR-ADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIA 554
           R+T     +  D + +++  +E+EP+T+++S +GW+R++K H+VDL    FKEGD+ K+A
Sbjct: 486 RSTILSAPKPVDISVVEE--VEREPLTMILSQKGWVRAVKGHNVDLENQKFKEGDAFKLA 543

Query: 555 LHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKL 614
           +   T+DR+   +TDG+AYT+   +L  GRG G+ I+LLIDL++++D++  F  +   + 
Sbjct: 544 IPCQTSDRLCFFATDGRAYTVKGADLPRGRGDGQPIRLLIDLSNDEDLLAVFPIEDGKRR 603

Query: 615 LVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
           LV SS G   +VEE  ++A  R G+  L +   E  ++ V   GDHVAVVG+NR+ LIF 
Sbjct: 604 LVASSAGRGMLVEEEALVAEKRSGRQVLNLKEGEFARICVPAEGDHVAVVGDNRRFLIFP 663

Query: 675 IDQIPEMSRGKGVRLQSYKD-GGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
           ++Q+P M+RG GV LQ Y D GG+   + F   +GL W    G +  R   DL  W+ +R
Sbjct: 664 LEQLPVMARGLGVALQKYSDGGGLRQAVVFTAADGLHW---PGTARVRQFADLQDWVSRR 720

Query: 734 GGVGSLVPKGFPRSGK 749
             VG + P   P +GK
Sbjct: 721 AAVGKVAP---PWAGK 733


>gi|329890068|ref|ZP_08268411.1| DNA topoisomerase IV, A subunit [Brevundimonas diminuta ATCC 11568]
 gi|328845369|gb|EGF94933.1| DNA topoisomerase IV, A subunit [Brevundimonas diminuta ATCC 11568]
          Length = 737

 Score =  757 bits (1955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/720 (50%), Positives = 503/720 (69%), Gaps = 7/720 (0%)

Query: 25  ALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIG 84
           AL  RYLAYALSTI  RA+PD+RDGFKPVHRRI++AM +M L+  AA +K A++VGEV+G
Sbjct: 21  ALSRRYLAYALSTITNRALPDVRDGFKPVHRRIMYAMHQMRLNPQAAARKCAKVVGEVMG 80

Query: 85  KLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELIL 144
             HPHGD S+Y++LVRLAQ F QRYPL+ GQGNFGNIDGDSAAA RYTE ++T  A L+L
Sbjct: 81  GYHPHGDASIYEALVRLAQDFAQRYPLVDGQGNFGNIDGDSAAAMRYTECKLTPAAVLLL 140

Query: 145 QGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAAL 204
            G+D+DAVDFR TY+++D EPVV P+ FPNLLANG+SGIAVGMATSIP HNV E+ +A  
Sbjct: 141 DGIDQDAVDFRPTYDDQDEEPVVLPAGFPNLLANGSSGIAVGMATSIPPHNVGELIDACQ 200

Query: 205 ALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRG 264
            L++ P+ + E L++ + GPDFPTGG+ VE   S++++Y  GRGG R+RA W  E++GRG
Sbjct: 201 LLLEQPDATTEDLVKIVPGPDFPTGGVSVEGHASMLDAYETGRGGVRLRAAWDTEDLGRG 260

Query: 265 SWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDL 324
            W IVVTEIPYQVQKS+LIE++A+LI  K+ PLL D+RDESAED+R++L PK+R+++P++
Sbjct: 261 VWRIVVTEIPYQVQKSKLIEQLADLIENKKAPLLADVRDESAEDIRLILEPKSRTVEPEV 320

Query: 325 LMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAID 384
           LMES+F LSD+ETRFP+NMNVL     P+VM L   L+ +L HRR VL RRS +R+  ++
Sbjct: 321 LMESLFKLSDLETRFPINMNVLDATGTPRVMGLKDCLRAFLDHRRVVLNRRSQWRIARVE 380

Query: 385 RRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEE 444
           +R+ +L+GL I +LN+DE+I I+R E++PK  +++ F L+E Q D IL+ RLR L +LEE
Sbjct: 381 KRLHLLEGLRIVFLNLDEVIRIVREEEQPKAALIATFGLSELQADFILDTRLRQLARLEE 440

Query: 445 YQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSR 504
             I+ E   L  E   + +L +S  +QW  I  E+  V++       +  RRT   +   
Sbjct: 441 MTIEKEFKELSEELAALQALTSSETKQWKAIGKELEAVRKAL-----VSPRRTVIGDAVD 495

Query: 505 ADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRIL 564
           A      +A I +E ITV++S+RGWIR+ K    D S L FKEGD L   + A+TTD++L
Sbjct: 496 ASAFVAPEAFIPREAITVILSDRGWIRAAKGKVDDPSELKFKEGDKLGFLVPAYTTDKLL 555

Query: 565 LLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAF 624
           + ++DG+ +T+ A  L SGRGHGE ++L+IDL+   +I+    ++   KLL+ S  G  F
Sbjct: 556 VGASDGRIFTIGADKLASGRGHGEPLRLMIDLDEKAEIINVVAHEPDAKLLIASKAGYGF 615

Query: 625 IVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRG 684
           +  E++++A  R GK  L       +++  +   DHVAV+GEN K LIF + ++PEM RG
Sbjct: 616 VAPENDLLAQKRGGKQVLNGEMLAMLRIPSQPQADHVAVIGENIKTLIFPLAELPEMGRG 675

Query: 685 KGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGF 744
           KGV+LQ+YK GG++DV  F    G  W D  GR   R+  D   WLGKR G G   P+G 
Sbjct: 676 KGVKLQNYKQGGLADVTVFNAEAGPEWADGGGR--RRNWPDWKDWLGKRAGAGRQGPRGL 733


>gi|51473276|ref|YP_067033.1| DNA topoisomerase IV subunit A [Rickettsia typhi str. Wilmington]
 gi|81390282|sp|Q68XU1|PARC_RICTY RecName: Full=DNA topoisomerase 4 subunit A; AltName:
           Full=Topoisomerase IV subunit A
 gi|51459588|gb|AAU03551.1| DNA topoisomerase IV subunit A [Rickettsia typhi str. Wilmington]
          Length = 737

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/739 (49%), Positives = 526/739 (71%), Gaps = 4/739 (0%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           E  ++ +    AL ERYLAYALSTI  R++PD+RDG KPVHRR+++AM ++ L+  + +K
Sbjct: 3   EAKIENIDFGNALSERYLAYALSTIMSRSLPDVRDGLKPVHRRLLYAMLQLRLEPNSGYK 62

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K AR+VG+VIGK HPHGD +VYD+LVRLAQ F  RYPLI GQGNFG+IDGD+AAA RYTE
Sbjct: 63  KCARVVGDVIGKYHPHGDVAVYDTLVRLAQHFSLRYPLIDGQGNFGSIDGDNAAAMRYTE 122

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           +RMT++  L+++ +D+D VDFR TY++ D EPV+ P+ FPNLLANG+ GIAVGMAT+IP 
Sbjct: 123 SRMTEICMLLMKDIDKDTVDFRSTYDDSDLEPVIMPASFPNLLANGSEGIAVGMATNIPP 182

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN+ E+C+A L LIDNP+  +  ++ +I GPDFPTGGII++  + I  +Y  GRG FRVR
Sbjct: 183 HNLHELCDALLYLIDNPQAGVNDIMNFIKGPDFPTGGIIIDQTKVINAAYTTGRGSFRVR 242

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           +RW  EE+  G++ IVVTEIPYQVQKS+LIE+IA L+  K+IPL+  IRDES + +R+V+
Sbjct: 243 SRWEKEELSYGTYQIVVTEIPYQVQKSKLIEQIAILLKDKKIPLISSIRDESTDIIRLVI 302

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            P++RS DP ++MES+F L+++E+R  LNMNV+    VP+VM +  IL+E+L HR+ ++ 
Sbjct: 303 EPRDRSCDPQIVMESLFKLTNLESRIQLNMNVIGSNNVPRVMNIVEILQEFLVHRQNIIT 362

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS++ +  I +R+EILK L I YLN+DEII IIR ED+PK +++ RF ++E QV+ ILN
Sbjct: 363 RRSTYLLNKIKQRLEILKVLKIVYLNLDEIIEIIRREDEPKTIIMERFKISEIQVEVILN 422

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
            RLR+L+KLEE+ I  E  NL  ++  ++ +L + K+ W  +  EI+ V+  F  +T +G
Sbjct: 423 TRLRALQKLEEHAIIDEHSNLQKQQAILEKILKNHKELWKIVKKEIKSVQTQFGLNTIIG 482

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
            RRT+F EV   ++     A I KEPIT++ S  GWIR LK H+ DLS + +KEGD+ K 
Sbjct: 483 ARRTSFEEVDLTNQVIDITAFITKEPITIICSKMGWIRLLKGHNTDLSTIKYKEGDAEKF 542

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
            + A+TTD+IL++S+ G+ +TL A N+  G+G   +I+LL+D+ +N DI    VY     
Sbjct: 543 IIEAYTTDKILIISSKGRFFTLLADNISKGKGTAVSIKLLVDIGNN-DITNILVYKPYQL 601

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
           LL+ SS G  F+V  +E+IA T+ GK  + +         + V G+ +A + E+R+LLIF
Sbjct: 602 LLLASSIGKGFLVNSNEVIAQTKAGKQIMNIPEGYACITCLPVNGNSIACINESRRLLIF 661

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
           +I++IPEM +G+GV LQ +K+  + D+  F   +GL+W D  G+   + E +++ +LGKR
Sbjct: 662 NINEIPEMKKGQGVVLQRFKNAKLLDIKIFNKEDGLSWND--GKKI-QLEKNIVAFLGKR 718

Query: 734 GGVGSLVPKGFPRSGKFLS 752
           G  G+L P GFP++ +F S
Sbjct: 719 GSAGTLPPIGFPKNNRFSS 737


>gi|296116241|ref|ZP_06834858.1| DNA topoisomerase IV subunit A [Gluconacetobacter hansenii ATCC
           23769]
 gi|295977175|gb|EFG83936.1| DNA topoisomerase IV subunit A [Gluconacetobacter hansenii ATCC
           23769]
          Length = 740

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/728 (49%), Positives = 516/728 (70%), Gaps = 10/728 (1%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           EN K V    AL ERYLAYA+STI  R++PD+RDG KPVHRR+I AM ++ LD  + FKK
Sbjct: 11  ENTKLVD---ALSERYLAYAMSTIMSRSLPDVRDGMKPVHRRMIFAMQQLRLDPTSGFKK 67

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEA 134
            AR+VG+VIGK HPHGD SVY++LVRLAQ F  RYPL+ GQGNFG++DGD+AAA RYTEA
Sbjct: 68  CARVVGDVIGKYHPHGDASVYEALVRLAQDFAVRYPLVEGQGNFGSVDGDNAAAMRYTEA 127

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           R+T+VA+ +L+G+++D+VDFR TY+ E+ EPVV P+ FPNLLANG +GIAVGMATSIP H
Sbjct: 128 RLTEVAKALLEGINDDSVDFRPTYDGEEHEPVVLPAAFPNLLANGAAGIAVGMATSIPPH 187

Query: 195 NVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
           NV EIC AA+ LI +P++++ KLLE + GPDFPTG +IVE R++I  +Y  GRG FR+RA
Sbjct: 188 NVGEICAAAMLLIRDPDVTVAKLLEVMPGPDFPTGCMIVEDRDAIARAYETGRGSFRIRA 247

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLF 314
           RW VE+   G+W IVVTEIPYQVQKSRLIE++A+L+  K++PLL DIRDES+ D+R+VL 
Sbjct: 248 RWEVEQGRFGTWQIVVTEIPYQVQKSRLIEQVADLMEQKKLPLLGDIRDESSADIRLVLE 307

Query: 315 PKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFR 374
           PK+R ++P++LME++F  + +E+RF LNMNVL   +VP V  L  +L+ WL HR +VL R
Sbjct: 308 PKSRGIEPEVLMETMFRATQLESRFGLNMNVLGADQVPGVRSLKEVLQAWLDHRHDVLVR 367

Query: 375 RSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNL 434
           R+  R+ A+DRR+EIL G L  YLN+DE+I IIR ED  +  +++ F L+E Q +++LN+
Sbjct: 368 RTRHRLDAVDRRLEILDGFLAVYLNLDEVIRIIREEDDARASLMAAFDLSELQAESVLNM 427

Query: 435 RLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGR 494
           RLRSLR+LEE +I+ E   L  E+  + +L+     +W  I  EI+ +++ F   T LG 
Sbjct: 428 RLRSLRRLEETEIRKEHAALTEERAGLLALMEKESLRWKHITSEIKGIQKKFGGGT-LGA 486

Query: 495 RRTTFCEVSRADKATLQQAM-IEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
           RR+T    +   +  +  A+ +E+EP++V++S +GWIR+++ H VD  A  FKEGD L++
Sbjct: 487 RRSTLA--APPAEVDISAALPVEREPLSVILSQKGWIRTVRGHGVDPEAQKFKEGDGLRL 544

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
            +   ++DR+   +TDG+A+TL A +L  GRG G+ ++L+I+L++ +DI+T F      +
Sbjct: 545 IVECQSSDRLCCFATDGRAFTLRAADLPRGRGDGQPLRLMIELSNEEDIITIFPVTQDAR 604

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIF 673
            L+ SS G   IV E +++A  R GK  L +   E  ++     GDHV V+G N+++L+F
Sbjct: 605 RLLASSAGRGMIVREEDMVAEKRTGKQVLNLKEGESAQVCALAQGDHVLVIGSNKRMLVF 664

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKR 733
           ++ Q+PEM+RG GV LQ YK+G + D + F    G+ W D       R+ +D+   +GKR
Sbjct: 665 ALTQLPEMTRGLGVALQKYKEGHLRDAVVFAGDAGVAWPDP---QRVRTLSDMKEQMGKR 721

Query: 734 GGVGSLVP 741
           G +G   P
Sbjct: 722 GDMGRPAP 729


>gi|15603946|ref|NP_220461.1| DNA topoisomerase IV subunit A [Rickettsia prowazekii str. Madrid
           E]
 gi|7387992|sp|Q9ZE79|PARC_RICPR RecName: Full=DNA topoisomerase 4 subunit A; AltName:
           Full=Topoisomerase IV subunit A
 gi|3860637|emb|CAA14538.1| TOPOISOMERASE IV SUBUNIT A (parC) [Rickettsia prowazekii]
 gi|292571664|gb|ADE29579.1| Topoisomerase IV subunit A [Rickettsia prowazekii Rp22]
          Length = 738

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/738 (49%), Positives = 524/738 (71%), Gaps = 5/738 (0%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           E  ++ +    AL ERYLAYALSTI  R++PD+RDG KPVHRR+++AM ++ L+  + +K
Sbjct: 3   EAKIENIDFGNALSERYLAYALSTIMSRSLPDVRDGLKPVHRRLLYAMLQLRLEPNSGYK 62

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K AR+VG+VIGK HPHGD +VYD+LVRLAQ F  RYPLI GQGNFG+IDGD+AAA RYTE
Sbjct: 63  KCARVVGDVIGKYHPHGDVAVYDTLVRLAQHFSLRYPLIDGQGNFGSIDGDNAAAMRYTE 122

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           +RMT++  L+++ +D+D VDFR TY++ D EPV+ P+ FPNLLANG+ GIAVGMAT+IP 
Sbjct: 123 SRMTEICMLLMEDIDKDTVDFRSTYDDSDLEPVIMPASFPNLLANGSEGIAVGMATNIPP 182

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN+ E+C+A L LIDNP+  I  ++ +I GPDFPTGGII++  E I  +Y  GRG FRVR
Sbjct: 183 HNLHELCDALLYLIDNPQAGINDIMNFIKGPDFPTGGIIIDKAEVINAAYTTGRGSFRVR 242

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVL 313
           +RW  EE+  G++ IVVTEIPYQ+QKS+LIE+IA L+  K+IPL+  IRDES + +R+V+
Sbjct: 243 SRWEKEELSYGTYQIVVTEIPYQIQKSKLIEQIAILLKDKKIPLISSIRDESTDIIRVVI 302

Query: 314 FPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLF 373
            P++RS DP ++MES+F L+++E+R  LNMNV+    VP+VM +  IL+E+L HR+ ++ 
Sbjct: 303 EPRDRSCDPQIVMESLFKLTNLESRIQLNMNVIGSNNVPRVMNILEILQEFLVHRKNIII 362

Query: 374 RRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILN 433
           RRS++ +  I +R+EILK L I YLN+DEII IIR ED+PK +++ RF ++  QV+ ILN
Sbjct: 363 RRSTYLLNKIKQRLEILKVLRIVYLNLDEIIEIIREEDEPKTIIMERFKISAIQVEVILN 422

Query: 434 LRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLG 493
            RLRSL+KLEE+ I  E  NL  ++  ++ +L + K+ W  +  EI+ V+  F  +T +G
Sbjct: 423 TRLRSLQKLEEHAIIDEHSNLQKQQAILEKILKNHKELWQIVKKEIKAVQTKFGLNTIIG 482

Query: 494 RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
            RRT+F EV   ++     A I KEPIT++ S  GW+RSLK H+ DLS + +KEGD+ K 
Sbjct: 483 ARRTSFEEVDLTNQVVDITAFITKEPITIICSKMGWVRSLKGHNTDLSTIKYKEGDTEKF 542

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGE-AIQLLIDLNHNQDIVTAFVYDSTC 612
            + A+TTD+IL++S+ G+ +TL A N+  G+G G  +I+LL+D+ +N DI    VY    
Sbjct: 543 IIEAYTTDKILIISSKGRFFTLLADNISKGKGTGGVSIKLLVDIGNN-DITNILVYKPNQ 601

Query: 613 KLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLI 672
            LL+ SS G  F+V  +E+IA T+ GK  + +         + V GD +A +GE+R+LL+
Sbjct: 602 LLLLASSIGKGFLVNSNEVIAQTKTGKQIMNIPEGYSCIACLPVNGDSIACIGESRRLLV 661

Query: 673 FSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGK 732
           F+ID+IPEM +G+GV LQ +K+  + D+  F   +GL+W D         E +++ +LGK
Sbjct: 662 FNIDEIPEMKKGQGVVLQRFKNAKLLDIKIFNKQDGLSWNDGTKIQL---EKNIVAFLGK 718

Query: 733 RGGVGSLVPKGFPRSGKF 750
           RGG G+  P GFP++ +F
Sbjct: 719 RGGFGTFPPIGFPKNNRF 736


>gi|58038562|ref|YP_190526.1| DNA topoisomerase IV subunit A [Gluconobacter oxydans 621H]
 gi|58000976|gb|AAW59870.1| Topoisomerase IV subunit A [Gluconobacter oxydans 621H]
          Length = 736

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/733 (48%), Positives = 505/733 (68%), Gaps = 7/733 (0%)

Query: 16  NVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKS 75
           +++   L  AL ERY+AYA+STI  R++PD+RDG KPVHRR+++AM ++ LD  + FKK 
Sbjct: 8   HIEDTKLAEALSERYIAYAMSTIMSRSLPDVRDGLKPVHRRLLYAMQQLRLDPTSGFKKC 67

Query: 76  ARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEAR 135
           AR+VG+VIGK HPHGD SVY++LVRLAQ F  RYPL+ GQGNFG+IDGD AAA RYTE+R
Sbjct: 68  ARVVGDVIGKFHPHGDASVYEALVRLAQDFAVRYPLVEGQGNFGSIDGDGAAAMRYTESR 127

Query: 136 MTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHN 195
           +T+VA+ +L G+ +DAVDFR TY+ ED EP+V P  FPNLLANG +GIAVGMATSIP HN
Sbjct: 128 LTEVAQALLDGIQDDAVDFRATYDNEDHEPIVLPGTFPNLLANGAAGIAVGMATSIPPHN 187

Query: 196 VQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRAR 255
             EIC AA  LI+ P+++I +L++ + GPDFPTGGI+VE R+SI+ SY  GRG FR RAR
Sbjct: 188 AAEICRAAKLLIEKPDVTIAELVDLMPGPDFPTGGILVEERDSIIRSYETGRGSFRTRAR 247

Query: 256 WCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFP 315
           W VE+   G+W I+VTEIPYQVQKSRLIE+IA+L+  +++PLL D+RDES  D+R+VL P
Sbjct: 248 WEVEQGRFGTWVIIVTEIPYQVQKSRLIEQIADLMEQRKLPLLGDVRDESTTDIRLVLEP 307

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           K + ++P++LME++F  + +E RF LNMNVL   RVP V+ L  +L+ WL H  EVL RR
Sbjct: 308 KTKGVEPEVLMETLFRNTALENRFSLNMNVLGGDRVPGVLSLKQVLRAWLDHVHEVLVRR 367

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
           S+ R+ A+ RR+EIL+G L  YLN+DE+I IIR ED+PK  +++ FSLT+ Q +A+LN+R
Sbjct: 368 SNHRLAAVLRRLEILEGFLAVYLNLDEVIRIIREEDEPKVSLMATFSLTDVQAEAVLNMR 427

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LRSLR+LEE +I+ E D L  E++ +++LL S +++W +I  ++    + F  S  LG R
Sbjct: 428 LRSLRRLEEMEIRRERDKLADEQKALETLLGSERRRWTRIGKDLDGTIKKFG-SGPLGER 486

Query: 496 RTTFCEVSRADKATLQQAM-IEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIA 554
           RT     +  +   +  A+ I++EP+TV++S  GWIR++K H +D     FKEGD   ++
Sbjct: 487 RTLIA--AAPELIDISAALEIDREPLTVLLSREGWIRAMKGHGLDPQGHRFKEGDEGWLS 544

Query: 555 LHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKL 614
           +   +TDR+ L+S+ GKAYT+ A +L  GRG G+  + ++D+     +VT F      + 
Sbjct: 545 VECQSTDRLCLISSSGKAYTIKAADLPRGRGFGQPFRTVVDVPQEDRVVTLFPVSDEGRR 604

Query: 615 LVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFS 674
           L+ S+ G   IV E+ ++A  R GK    +   +++   V V G HV  +G+N++ LIF 
Sbjct: 605 LIASAAGRGMIVSEAGLVAEKRTGKQVFNIKDGDEVFACVPVGGTHVLTLGQNKRALIFP 664

Query: 675 IDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRG 734
           ++Q+PEM+RG GV  Q   D  + D+    + EGL W +       R+  DL    G+RG
Sbjct: 665 LEQVPEMTRGGGVAFQKLGDSTLRDIRTLTLSEGLLWQEG---QRVRATADLAPLEGRRG 721

Query: 735 GVGSLVPKGFPRS 747
            VG   P+   R+
Sbjct: 722 AVGRAAPQWMLRN 734


>gi|163744726|ref|ZP_02152086.1| DNA topoisomerase IV subunit A [Oceanibulbus indolifex HEL-45]
 gi|161381544|gb|EDQ05953.1| DNA topoisomerase IV subunit A [Oceanibulbus indolifex HEL-45]
          Length = 813

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/816 (47%), Positives = 523/816 (64%), Gaps = 75/816 (9%)

Query: 6   ISNSNTLVEENVKAVS--LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSE 63
           +S++ T  E +   +S  LR AL ERYL YALSTI  RA+PD RDG KPVHRRI+ AM E
Sbjct: 1   MSDTTTPPELDPNDLSEPLRRALGERYLTYALSTIMHRALPDARDGLKPVHRRILFAMRE 60

Query: 64  MGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG 123
           + L     F+KSA+I G+V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDG
Sbjct: 61  LRLSSTGGFRKSAKISGDVMGNYHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDG 120

Query: 124 DSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGI 183
           D+ AA RYTEARMT VAE +L+G++E+AVD+R+ Y+   +EPVV P++FPNLLANG+SGI
Sbjct: 121 DNPAASRYTEARMTAVAEAMLEGLNENAVDYRENYDGTLTEPVVLPAQFPNLLANGSSGI 180

Query: 184 AVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESY 243
           AVGMAT+IP HN+ E+C+A + LI  P+   E LL Y+ GPDFPTGG+IVE  E+I  +Y
Sbjct: 181 AVGMATNIPPHNIAELCDACIHLIKTPDARDETLLNYVPGPDFPTGGVIVEPPENIANAY 240

Query: 244 RLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRD 303
           R GRG FR+R RW VE++GRG+W IVVTEIPYQVQKS+LIEKIAELI AK+IP+L D+RD
Sbjct: 241 RTGRGSFRLRCRWEVEDLGRGAWQIVVTEIPYQVQKSKLIEKIAELIQAKKIPILADVRD 300

Query: 304 ESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGIL-- 361
           ESAEDVR+++ P+++++DP +LM  +F  SD+E RF LNMNVL  G+ P+V  L  +L  
Sbjct: 301 ESAEDVRMIIEPRSKNVDPAVLMGMLFRNSDLEVRFSLNMNVLIDGQTPKVCSLKEVLRA 360

Query: 362 -----KEWLAHRREVLFRRSSFRMQAI----------DRRVEILK-------GLL----- 394
                +E L  R      +   R++ +          DR +EI++        L+     
Sbjct: 361 FLDHRREVLQRRSRHRMDKIDHRLEVLQGLITAFLNLDRVIEIIRYDDDPKAALMYEDWS 420

Query: 395 -------------------IAYLNIDEIIAIIRNEDKPKPVMVS--------------RF 421
                              +A +++ ++  I   E +   V+                  
Sbjct: 421 RVHQDTLARAMDEAAYISPLAGVDVSKLAVIADAEAQATGVLTESGDTRAVPHSYAGREN 480

Query: 422 SLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIRE 481
            L++ Q +AILN+RLRSLR+LEE  +  E D L++E+  ++ LL++   QW  IA ++R 
Sbjct: 481 GLSDVQAEAILNMRLRSLRRLEEDALVKERDTLMSERAGLEDLLDNEDLQWTTIADQLRA 540

Query: 482 VKEIFSK-----STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSH 536
            K+ F K         G+R +TF      +   ++ AMI++EPITVV S  GWIR++  H
Sbjct: 541 TKKQFGKDWVIDGIKRGQRLSTFETAGEVEDVPIE-AMIDREPITVVCSQMGWIRAMTGH 599

Query: 537 SVDLS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLID 595
            +DL+  L FK+GD  +   HA TTDR+L+  ++G+ YT+ A NL  GRG GE ++L++D
Sbjct: 600 -IDLNRELKFKDGDGPRFIFHAETTDRLLVFGSNGRFYTVSAANLPGGRGMGEPLRLMVD 658

Query: 596 LNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVK 655
           L +   IV+ F++    KLLV SS G+ F+V E E++A TR GK  L V  +    LV  
Sbjct: 659 LPNEVQIVSLFIHQPGRKLLVASSAGDGFVVPEDEVVAQTRSGKQVLNVRGDGVAALVCH 718

Query: 656 -VTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDS 714
            V+GD VA VGENRK+L+F +D++PEM RGKGVRLQ YKDGG+SD   F    GL+W D 
Sbjct: 719 PVSGDSVATVGENRKVLVFGLDELPEMGRGKGVRLQKYKDGGLSDATTFTRDAGLSWQDP 778

Query: 715 AGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           AGR+  R+E DL  W GKR   G + P+GFPR  KF
Sbjct: 779 AGRT--RTEADLAEWTGKRASSGRMAPRGFPRDNKF 812


>gi|84685508|ref|ZP_01013406.1| DNA topoisomerase IV, A subunit [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84666665|gb|EAQ13137.1| DNA topoisomerase IV, A subunit [Rhodobacterales bacterium
           HTCC2654]
          Length = 856

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/822 (46%), Positives = 522/822 (63%), Gaps = 81/822 (9%)

Query: 3   VDNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMS 62
            D + + +  + E   A  LR A+ +RYL YALSTI  RA+PD RDG KPVHRRI+ AM 
Sbjct: 41  TDTVDDPDNPISEF--AEPLRRAIGDRYLTYALSTIMNRALPDARDGLKPVHRRILFAMR 98

Query: 63  EMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNID 122
           E+ L+ G  F+KS++I G+V+G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNID
Sbjct: 99  ELRLNSGGRFRKSSKISGDVMGNYHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNID 158

Query: 123 GDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSG 182
           GD+ AA RYTEARMT VAE +L+G+DEDAVDFR+ Y+    EPVV P+ FP+LLANG +G
Sbjct: 159 GDNPAASRYTEARMTIVAEALLEGLDEDAVDFRENYDGTLREPVVLPATFPHLLANGAAG 218

Query: 183 IAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVES 242
           IAVGMAT+IP HN+ E+ +A L LI  P+   + LL YI GPDFPTGG+IVE RE+I E+
Sbjct: 219 IAVGMATNIPPHNISELVDACLHLIKTPDARDDTLLNYIPGPDFPTGGVIVEPRENIAEA 278

Query: 243 YRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIR 302
           YR GRG  R+R++W VE++GRG W I+VTEIPYQVQKS+LIEK+AE+I  K++PLL D+R
Sbjct: 279 YRTGRGSIRLRSKWEVEDLGRGQWQIIVTEIPYQVQKSKLIEKLAEVIQTKKVPLLADVR 338

Query: 303 DESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILK 362
           DESA+DVRIVL PK R+++P++LM  +F  SD+E RF LNMNVL  G  P+V  L  +L+
Sbjct: 339 DESADDVRIVLEPKTRNVEPEMLMGLLFRNSDLEVRFSLNMNVLIDGLTPKVCSLKEVLR 398

Query: 363 -------EWLAHRREVLFRRSSFRMQAI----------DRRVEILK-------------- 391
                  E L  R +    +   R++ +          DR ++I++              
Sbjct: 399 AFLDFRREVLIRRSQHRMEKIDHRLEVLEGFIIAFLNLDRVIDIIRYDDDPKAALMYEDW 458

Query: 392 ----------------------GLLIAYLNIDE---------IIAIIRNEDKPKPVMVSR 420
                                 G+ +A L + E         I     +   PK  +   
Sbjct: 459 SRPHQDTIARATNEHDYVSPLAGIDVASLELREDETATAPEIITDNTGSGATPKRFVGRS 518

Query: 421 FSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIR 480
             L++ Q DAILN+RLRSLR+LEE ++  E D L+ E+  ++ LL+S   QW +I  E++
Sbjct: 519 EGLSDVQADAILNMRLRSLRRLEELELIRERDALMEERAGLEDLLDSEDLQWGRIGDELK 578

Query: 481 EVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDL 540
           + K+ F K    G RRT F E +      L+ AMIE+EP+T+V S  GWIR++  H VDL
Sbjct: 579 DAKKKFGKDYVAGARRTQFAEAAEVPDVPLE-AMIEREPVTIVCSQMGWIRAMSGH-VDL 636

Query: 541 S-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHN 599
           +    FK+GD  + A HA TTD+I++ + +G+ YTL A NL  GRG GE ++L++DL ++
Sbjct: 637 TRDFKFKDGDGPRFAFHAETTDKIIVFAANGRFYTLGASNLPGGRGMGEPLRLMVDLPND 696

Query: 600 QDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGD 659
            +I+  FV+    KL+V S  GN FIV E++++A T+ GK  L V S++  KLV  V GD
Sbjct: 697 VEIIDMFVHAPDRKLIVASKGGNGFIVPEADVVAQTKNGKQVLNV-SDDVAKLVKPVAGD 755

Query: 660 HVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYK-----------DGGISDVICFKICEG 708
           HVAVV ENRKLL+F I ++PEM RGKGVRLQ Y            DGG+SD+  F +  G
Sbjct: 756 HVAVVSENRKLLVFPIAELPEMGRGKGVRLQKYGSARGRQGTLDLDGGLSDLTTFDLATG 815

Query: 709 LTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
           L+W  +  R+  R+E D+  W+GKR GVG + P GFP+S  F
Sbjct: 816 LSWAATGDRT--RTEVDMSPWIGKRAGVGKMPPHGFPKSNTF 855


>gi|83855001|ref|ZP_00948531.1| DNA topoisomerase IV subunit A [Sulfitobacter sp. NAS-14.1]
 gi|83842844|gb|EAP82011.1| DNA topoisomerase IV subunit A [Sulfitobacter sp. NAS-14.1]
          Length = 696

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/699 (50%), Positives = 487/699 (69%), Gaps = 35/699 (5%)

Query: 83  IGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAEL 142
           +G  HPHGD ++YD++ RLAQ F  RYPL+ GQGNFGNIDGD+ AA RYTEARMT VAE 
Sbjct: 1   MGNYHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFGNIDGDNPAASRYTEARMTAVAEA 60

Query: 143 ILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEA 202
           +L+G++E+AVDFR+ Y+   +EP V P++FPNLLANG+SGIAVGMAT+IP HN+ E+ +A
Sbjct: 61  MLEGLNENAVDFRENYDGTLTEPAVLPAQFPNLLANGSSGIAVGMATNIPPHNISELVDA 120

Query: 203 ALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVG 262
            + LI  P+   + LL+Y+ GPDFPTGGIIVE  E+I  +YR G+GGFR+R RW  E++G
Sbjct: 121 CIHLIKTPDARDDTLLKYVPGPDFPTGGIIVEPPENIANAYRTGKGGFRLRCRWETEDLG 180

Query: 263 RGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDP 322
           RG+W IV+TEIPYQVQKS+LIEKIAELI  K+IP+L D+RDESA+D+R+++ P+++++DP
Sbjct: 181 RGAWQIVITEIPYQVQKSKLIEKIAELIQTKKIPILGDVRDESADDIRLIIEPRSKNVDP 240

Query: 323 DLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQA 382
           ++LM  ++  SD+E RF LNMNVL  G  P+V  +  +L+ +L HRREVL RRS+ RM+ 
Sbjct: 241 EVLMGMLYRSSDLEVRFSLNMNVLIDGVTPKVCSMKEVLRAFLDHRREVLQRRSTHRMEK 300

Query: 383 IDRRVEILKGLLIAYLNIDEIIAIIRNEDKPK-----------------------PVMVS 419
           ID R+E+L+G ++A+LN+D +I IIR ++ PK                       P   +
Sbjct: 301 IDHRLEVLEGFIVAFLNLDRVIDIIRYDEDPKSALMAEDWGKDHVRAMDEASYVPPAPST 360

Query: 420 RFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEI 479
             +L+E Q DAILN+RLRSLR+LEE ++  E   L+ E+  ++ LL +   QW+ I  ++
Sbjct: 361 ENALSEVQADAILNMRLRSLRRLEEIELLREQSALMEERSGLEDLLENEGTQWDTIIDQL 420

Query: 480 REVKEIFSK-----STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLK 534
           RE K+ F K       ++GRRRT+F E    ++  L +AMI++EPITVV S  GWIR++ 
Sbjct: 421 RETKKQFGKDWSLDGKNIGRRRTSFSEAGVIEEVPL-EAMIDREPITVVCSQMGWIRAMT 479

Query: 535 SHSVDLS-ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLL 593
            H +DL+  L FK+GD  +   HA TTDR+L+  ++G+ YT+ A  L  GRG GE ++L+
Sbjct: 480 GH-IDLNRELKFKDGDGPRFIFHAETTDRLLVFGSNGRFYTVSASTLPGGRGMGEPLRLM 538

Query: 594 IDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLV 653
           +DL +   IV   ++ +  KLLV SS G+ FIV E +++A TR GK  L V  + K  + 
Sbjct: 539 VDLPNEVQIVDILIHKAGRKLLVASSAGDGFIVPEDDVLAQTRSGKQVLNVRGDAKAMIC 598

Query: 654 VKVTG--DHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTW 711
             VTG  D VAVVGENRK+L+F +D++PEM RGKGVRLQ YKDGG+SD I F    GL+W
Sbjct: 599 APVTGDADAVAVVGENRKVLVFGLDELPEMGRGKGVRLQKYKDGGMSDAITFSRENGLSW 658

Query: 712 IDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKF 750
            D AGR+  R+E+DL  W GKR   G + P+GFPR  +F
Sbjct: 659 QDPAGRT--RTESDLTEWTGKRATAGRMAPRGFPRDNRF 695


>gi|117924909|ref|YP_865526.1| DNA topoisomerase IV subunit A [Magnetococcus sp. MC-1]
 gi|117608665|gb|ABK44120.1| DNA topoisomerase IV subunit A [Magnetococcus sp. MC-1]
          Length = 754

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/737 (47%), Positives = 491/737 (66%), Gaps = 12/737 (1%)

Query: 9   SNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDF 68
           SNT   E +   +LR  LE RYLAYALSTI  R++PD+RDG KPVHRRI+ AM  + LD 
Sbjct: 2   SNTF--EQIDPCNLREELESRYLAYALSTIISRSLPDVRDGLKPVHRRILFAMRALRLDP 59

Query: 69  GAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAA 128
            + +KKSAR+VG+VIGK HPHGDQ+ YD++VRLAQ F  RYPL+ GQGNFGNIDGDSAAA
Sbjct: 60  NSPYKKSARVVGDVIGKYHPHGDQAAYDAMVRLAQEFAVRYPLVDGQGNFGNIDGDSAAA 119

Query: 129 YRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMA 188
            RYTEAR+T VA+ +L+ ++ D VDF  TY+    EPVV P++FPNLLANG+SGIAVGM+
Sbjct: 120 MRYTEARLTSVAKALLEDLEMDTVDFMPTYDGSMEEPVVLPARFPNLLANGSSGIAVGMS 179

Query: 189 TSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRG 248
           T++P HNV EI +A L LI  P  SIE+L++++  PDFPTGGI++      +E Y  GRG
Sbjct: 180 TNVPPHNVGEILDACLLLISKPNCSIEELMQHLPAPDFPTGGILMADHAERLEVYSEGRG 239

Query: 249 GFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED 308
             R+RARW VE++GRG W IVVTEIPYQVQKSRLIE+IA+L+I ++ P L ++RDES E+
Sbjct: 240 SLRLRARWAVEDLGRGLWQIVVTEIPYQVQKSRLIERIAQLVIDRKCPFLTNVRDESDEN 299

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
           +RIVL P+ R+LDP+L+M  +F  SD+E+R   N+NV+  G  P+V+ L GIL+ WL HR
Sbjct: 300 LRIVLEPRARTLDPELIMHFLFKHSDLESRASFNLNVIVGGHRPEVLDLKGILRHWLDHR 359

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
             V  RR+S+ ++ I  R+ +L+  LI +LNIDE+I II+  D P PV+++RFSL E Q 
Sbjct: 360 FVVHTRRASYELKKIRERLHLLQAFLIVHLNIDEVIEIIKKNDDPAPVLMARFSLDEIQA 419

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AILN+RLR+LRKLEE +I+ E++ L A  + ++++L   K  W  I  E++  ++ F+ 
Sbjct: 420 EAILNMRLRNLRKLEEMKIRKEMEELQARADLLEAMLADDKIMWKAIRDELKATRKEFAD 479

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RRT  C  S  D     +  +EKEPI+V++S  GW+++ K H V+   L FK  
Sbjct: 480 V-----RRTEICG-SVEDVHVRPEDFVEKEPISVILSQMGWVKANKGHDVNTEVLRFKGD 533

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           D L  +   +T   +  +S  GK +T+ A NL +G+G GE +  + DL+    ++ A   
Sbjct: 534 DLLLRSFPCYTNQSVSFISQSGKLFTILASNLPAGKGFGEPLTSMFDLDGGDRVLWALPV 593

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENR 668
           D   + L+++  G  F V+  ++IAN RKGK  + + S ++   +  V G  V  +  +R
Sbjct: 594 DPEQEYLLITRLGQGFRVKGVDLIANQRKGKQLITLKSGDQPLHLHPVKGPWVGSISRSR 653

Query: 669 KLLIFSIDQIPEMSRGKGVRLQSY-KDGGISDVICFKICEGLTWIDSAGRSYNRSENDLL 727
           +LLIF I+Q P M++GKGVR+Q    D  + DV  F   EG   +DS  ++ + ++ D  
Sbjct: 654 RLLIFPIEQFPLMAKGKGVRVQKLGADEVVVDVTTFTDEEGFV-LDSGKKTKHVTDYD-- 710

Query: 728 GWLGKRGGVGSLVPKGF 744
            W G R G G+++P GF
Sbjct: 711 QWHGNRAGRGAMLPHGF 727


>gi|23011502|ref|ZP_00051841.1| COG0188: Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase
           IV), A subunit [Magnetospirillum magnetotacticum MS-1]
          Length = 623

 Score =  634 bits (1635), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 315/625 (50%), Positives = 441/625 (70%), Gaps = 8/625 (1%)

Query: 130 RYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMAT 189
           RYTEA++T++A  +++G+DED+VDFR TY+  + EP V PS  PNLLANG++GIAVGMAT
Sbjct: 2   RYTEAKLTEIAAALMEGLDEDSVDFRPTYDGTEEEPAVMPSAIPNLLANGSAGIAVGMAT 61

Query: 190 SIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGG 249
           SIP HN+ EIC+A   LI  P+  +++L+ ++ GPDFPTGG++VE+  +I E+YR G+G 
Sbjct: 62  SIPPHNLGEICDALDHLIAKPDCDVDELIAHMPGPDFPTGGVLVETSAAISEAYRTGKGS 121

Query: 250 FRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDV 309
           FRVRA+W VE++  G + IV+TEIPYQVQK++LIEKIAEL+  K++PLL DIRDESAED+
Sbjct: 122 FRVRAKWAVEKLSHGLYQIVITEIPYQVQKAKLIEKIAELLSEKKLPLLADIRDESAEDI 181

Query: 310 RIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVL---SMGRV-PQVMPLDGILKEWL 365
           R+VL P+NR+++ +L+ME +F  +D+E+RF LNMNVL   S G + P VM L  +L+ +L
Sbjct: 182 RLVLEPRNRTVEAELVMEQLFRQTDLESRFSLNMNVLAPDSHGHLTPGVMNLKEVLRAFL 241

Query: 366 AHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTE 425
            HR  VL RR+ FR++ I +R+E+L+G L  Y ++D++I IIR  D+PK  ++  F L+E
Sbjct: 242 DHRMVVLERRTRFRLEKIAKRLEVLEGFLKVYADLDKVIKIIRFADEPKAELIKTFKLSE 301

Query: 426 NQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEI 485
            Q +AILN+RLRSL KL+E +IK+E   L AEK  +++LL    ++W  IA +  E+++ 
Sbjct: 302 VQAEAILNMRLRSLNKLQELEIKTEHAELSAEKADLEALLADEGRRWTTIAAQNAEIRKA 361

Query: 486 FSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHF 545
           F  +T LG+RRT   +   A    + +A +E+E IT+V+S +GWIR+LK HS    AL F
Sbjct: 362 FGGATALGKRRTELGDAPSAVVVPI-EAYVEREAITMVLSEKGWIRALKGHSDSPDALKF 420

Query: 546 KEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTA 605
           KEGD L   L A TTD+IL+ +TDG+ YT+    L SGRGHGE ++L+IDL  + DI   
Sbjct: 421 KEGDQLGHLLKAWTTDKILVFATDGRFYTIGGDKLPSGRGHGEPLRLMIDLAGDVDIAAV 480

Query: 606 FVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVG 665
            V+    KLLV ++    F+VEE+E++A TR GK  L     EK K  +   GD VAV+G
Sbjct: 481 LVHKPGRKLLVATNSDRGFVVEENEVLAQTRAGKMVLNCGDGEKAKFCLPFEGDAVAVIG 540

Query: 666 ENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSEND 725
           ENRKLL+F  D+IP M+RG+GV LQ Y+DGG++D+  F + +GLTW  + G    R+E D
Sbjct: 541 ENRKLLVFMADEIPVMTRGRGVILQKYRDGGMADIKVFTLAQGLTW--NLGDRV-RTEAD 597

Query: 726 LLGWLGKRGGVGSLVPKGFPRSGKF 750
           L  WLGKR  VG L P GFPR+ +F
Sbjct: 598 LTPWLGKRASVGRLPPTGFPRNNRF 622


>gi|239787276|emb|CAX83754.1| DNA topoisomerase IV subunit A [uncultured bacterium]
          Length = 765

 Score =  634 bits (1634), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 327/736 (44%), Positives = 468/736 (63%), Gaps = 10/736 (1%)

Query: 10  NTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFG 69
             +  E ++  ++R  LE RYLAYALSTI  R++PD+RDG KPVHRRI+ AM  + LD G
Sbjct: 2   GAVTAEKIEPAAIRGELESRYLAYALSTIISRSLPDVRDGLKPVHRRILFAMRALRLDPG 61

Query: 70  AAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAY 129
           + FKKSAR+VG+VIGK HPHGDQ+ YD++VRLAQ F QRYPL+ GQGNFGN+DGD AAA 
Sbjct: 62  SGFKKSARVVGDVIGKFHPHGDQAAYDAMVRLAQDFAQRYPLVDGQGNFGNVDGDGAAAM 121

Query: 130 RYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMAT 189
           RYTEAR+T VA+ +L+ +D   VD   TY+    EPVV P++FPNLLANG +GIAVGM+T
Sbjct: 122 RYTEARLTPVAQALLEDLDRQTVDLIPTYDGSQEEPVVLPARFPNLLANGATGIAVGMST 181

Query: 190 SIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGG 249
           +IP HN  E+  AAL LI +P+  + +L++++ GPDFPTGG++V   E + E Y  GRGG
Sbjct: 182 AIPPHNAGEVLAAALHLIRHPDCGVAELMKHLPGPDFPTGGVLVAEPEELREVYATGRGG 241

Query: 250 FRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDV 309
            R+RARW  E VG G+W +VVTEIPY VQK RLIE+IA+LI+ ++ P L D+RDES   V
Sbjct: 242 LRLRARWEQEMVGHGTWRLVVTEIPYHVQKGRLIERIAQLILDRKCPFLSDVRDESDAKV 301

Query: 310 RIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRR 369
           RIVL P++R LDP+ +M  +F  SD+E R  +N+NV++    P+VM L G+L+ WL HR 
Sbjct: 302 RIVLEPRSRGLDPEKIMAFLFKNSDLEVRINVNLNVVTAEARPEVMDLKGLLRAWLDHRF 361

Query: 370 EVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVD 429
           +V  RR++  ++ I  R+ +L+  L  +LNID +IAII+  D P P ++ RF +   Q +
Sbjct: 362 QVHTRRATHDLERIRERLHLLQAYLTVHLNIDAVIAIIKAHDDPAPALMQRFGMDSEQAE 421

Query: 430 AILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKS 489
           A+LNLRLR+LR+LEE  I+ E+    A   ++ ++L      W  +  E++  ++ FS  
Sbjct: 422 AVLNLRLRALRRLEEMSIRKEMGEKEARAAELSAMLADPTLMWAAVQDEVKRTRKEFSD- 480

Query: 490 TDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGD 549
              GRR          D     + +I+KEP+T V+S +GWI++LK H +DL  + FKE D
Sbjct: 481 ---GRRTRMAGPAPEID--LRPEDLIQKEPLTAVLSRKGWIKALKGHDIDLEKIRFKEED 535

Query: 550 SLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYD 609
            L+ A+  ++   +  L+  GK Y+L    L SG+  GE + +L +L+    I+     D
Sbjct: 536 GLERAVKGYSHQTVTFLAASGKVYSLLGDRLPSGKRFGEPLTVLFELDPGDRILWMLAVD 595

Query: 610 STCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRK 669
              +  V +  G  F +   +++AN R GK  + +   ++   V  V G  VA +   R+
Sbjct: 596 PEGEYFVTTRLGQGFRIRGRDLVANQRTGKQVVSLREGDQPLHVHPVRGAAVAAISHGRR 655

Query: 670 LLIFSIDQIPEMSRGKGVRLQSYKDG-GISDVICFKICEGLTWIDSAGRSYNRSENDLLG 728
           LLI  +++ P + RGKGVR+Q+   G G+ D + F    GL  +DS  R+   +E D   
Sbjct: 656 LLICRLEEFPLLGRGKGVRIQNLGRGEGLVDAMTFDPQAGLV-LDSGKRTRQLTELD--K 712

Query: 729 WLGKRGGVGSLVPKGF 744
           W G RG  G+++P GF
Sbjct: 713 WQGTRGSRGAMLPHGF 728


>gi|85707863|ref|ZP_01038929.1| DNA topoisomerase IV subunit A [Erythrobacter sp. NAP1]
 gi|85689397|gb|EAQ29400.1| DNA topoisomerase IV subunit A [Erythrobacter sp. NAP1]
          Length = 622

 Score =  605 bits (1561), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 299/623 (47%), Positives = 427/623 (68%), Gaps = 18/623 (2%)

Query: 144 LQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAA 203
           ++G+D   VDF  TYN E+ EP + P  FPNLL NG SGIAVGMAT+IPSHNV E+ +A 
Sbjct: 1   MEGLDAGTVDFIPTYNGEEEEPELMPGLFPNLLGNGASGIAVGMATNIPSHNVAEVIDAT 60

Query: 204 LALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW------- 256
           L LIDNP +  E+L+E + GPDF TGG +V+S E + E+YR GRG FR+R  +       
Sbjct: 61  LELIDNPHVEHERLMELMPGPDFATGGQLVDSAEVLSEAYRTGRGSFRLRGVFHAPEAEK 120

Query: 257 ------CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVR 310
                  +E +G G W +V++EIPYQV K +LIE+IA+ I  K++P+LED+RDES E +R
Sbjct: 121 TEDIEAGIERLGGGQWQLVISEIPYQVAKGKLIEQIAQAIADKKLPILEDVRDESDESIR 180

Query: 311 IVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRRE 370
           IVL P++R++DPDLL ESIF L+DMETRF LNMNVL   R P VM L  +L+ W A + E
Sbjct: 181 IVLVPRSRNVDPDLLKESIFKLTDMETRFGLNMNVLDATRTPMVMGLKELLQNWTAAQIE 240

Query: 371 VLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDA 430
           +L RR+ +R+  I+RR+E++ G ++A+LN+D +I IIR ED+PK VM++ FSLT+ Q +A
Sbjct: 241 ILQRRTRYRLGQIERRLELVDGYIVAFLNLDRVIEIIRYEDEPKAVMMAEFSLTDRQAEA 300

Query: 431 ILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKST 490
           ILN+RLRSLRKLEE ++K E   LLAE+E+++ LL S  +Q  ++  ++R +++ +++ T
Sbjct: 301 ILNMRLRSLRKLEEMELKQEKSELLAEQEELNKLLESPARQRTRLKKDLRALRKDYAEDT 360

Query: 491 DLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSA-LHFKEGD 549
            LG RRT   E + A + ++  AMIEKEP+TV++S +GWIR+ K H VDL+    +KEGD
Sbjct: 361 ALGARRTRIEEAAPAVEFSM-DAMIEKEPVTVILSQKGWIRAAKGH-VDLAQEFKYKEGD 418

Query: 550 SLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYD 609
           +L   LHA TTD++L+  +DG+ YTL A  L   RG GE ++ +IDL     I    V+ 
Sbjct: 419 ALAFILHAQTTDKLLIAGSDGRFYTLGADKLPGARGFGEPVRTMIDLPAETQIAAMMVHK 478

Query: 610 STCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKV--TGDHVAVVGEN 667
              KLL+ SS G  FI E  E++A T+KGK  + +  + K++++ +V    DHVA VGEN
Sbjct: 479 EGGKLLLASSIGKGFIAETKELLAETKKGKQVVNLKGDAKLQVIREVPENHDHVAAVGEN 538

Query: 668 RKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLL 727
           RKL++F+++++P M+RG+GV LQ Y+DGG+SD   F + +GL+W         R+END+ 
Sbjct: 539 RKLIVFNLEEMPVMARGQGVMLQRYRDGGLSDATTFVLEDGLSWQMGGSGERTRTENDIW 598

Query: 728 GWLGKRGGVGSLVPKGFPRSGKF 750
            W   RG  G L P+GFP++ +F
Sbjct: 599 QWKVARGAAGRLPPQGFPKNNRF 621


>gi|262277165|ref|ZP_06054958.1| DNA gyrase subunit A [alpha proteobacterium HIMB114]
 gi|262224268|gb|EEY74727.1| DNA gyrase subunit A [alpha proteobacterium HIMB114]
          Length = 746

 Score =  602 bits (1551), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 319/739 (43%), Positives = 464/739 (62%), Gaps = 24/739 (3%)

Query: 13  VEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAF 72
           + +N+    L+    ++YLAYALSTI +RA+PD+RDG KPVHRR+I+AM  + L   + F
Sbjct: 1   MSKNIVKDELQNQFAKKYLAYALSTITQRALPDVRDGLKPVHRRLIYAMYLLNLSPKSQF 60

Query: 73  KKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYT 132
           KKSAR+VG+VIGK HPHGDQSVYD+LVRLAQ F   YPL++GQGNFGN+DGD+AAA RYT
Sbjct: 61  KKSARVVGDVIGKFHPHGDQSVYDALVRLAQDFSTHYPLVNGQGNFGNVDGDNAAAMRYT 120

Query: 133 EARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIP 192
           E ++T+ +E +L  ++E+ V+F+ TY+ E  EP + PS+FPN+LANG+SGIAVGMATSIP
Sbjct: 121 ETKLTKTSEYLLADIEEETVNFKKTYDGELDEPEILPSQFPNILANGSSGIAVGMATSIP 180

Query: 193 SHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRV 252
            HNVQEICEA + L DNP  SI+ LL++I GPDFPTGGI+ E ++ I ++Y+ GRG F +
Sbjct: 181 PHNVQEICEALIYLNDNPNCSIKDLLKFIKGPDFPTGGILNEDKKEIFKAYKTGRGFFEI 240

Query: 253 RARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIV 312
           ++++ VE++GRG + I VTEIPY V KS+LIEK+A +II K+  LL+ + DES E +RIV
Sbjct: 241 KSKYKVEDLGRGLYQIAVTEIPYSVNKSKLIEKLAGIIINKKNKLLDHVSDESDEKIRIV 300

Query: 313 LFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVL 372
           L PKNR+++P+ LM S+F  S+++ +  LNMNVL+    P+VM L  ILK  L HR  +L
Sbjct: 301 LRPKNRNVNPEDLMNSLFEQSELKNKIFLNMNVLNEKNEPKVMNLKEILKSLLKHRYIIL 360

Query: 373 FRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAIL 432
             + +F+++ I RR+EILKG +I Y N+++II IIRN   PK  ++ ++  T  QVD+IL
Sbjct: 361 NNKINFKLKKIKRRLEILKGFIIVYKNLNQIIKIIRNSKDPKKELIKKYKFTLIQVDSIL 420

Query: 433 NLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDL 492
            +RLR+L+K+EE  IK E  NL  EK+++  +LNS   Q  +I  E  EV   F  ++  
Sbjct: 421 EMRLRNLKKIEELDIKKEFKNLELEKKRLSKILNSKTLQRKEINNEYTEVINEFGDNSTY 480

Query: 493 GRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLK 552
           G RR+   +  +     L+  +   E I V + N  +++S K  +   S    K  D + 
Sbjct: 481 GPRRSILEKFVKFTDDELESKLEVIENINVSLINEKFLKS-KKGTYKRSE---KNSDDVS 536

Query: 553 IALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTC 612
           + ++  T+D+I LLS  GK+Y L   NL  G   G  I   + L   + IV  FVY    
Sbjct: 537 LIINCKTSDQICLLSNIGKSYILNCSNLKFGSTKGFLISSYLKLKDEEKIVDLFVYKEKQ 596

Query: 613 KLLVVSSKGNAFIVEESEIIANTRKGKTFLKVS-----------SEEKMKLVVKVTGDHV 661
           ++++ S  G  F V+  ++  N + GK    +            ++EK K +V    D++
Sbjct: 597 EIILSSQNGYGFFVKSEDLFTNKKSGKKIFNIKKNDQFYGSCLINKEKDKFIVLFLKDNL 656

Query: 662 AVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNR 721
                  KL+IF + ++P + +G GV L  +K  G        I + L+ ID   +    
Sbjct: 657 KY-----KLIIFELKEVPYLQKGSGVIL--FKTKGFKLNNFCSIDDNLSLIDIDSKKIEL 709

Query: 722 SENDLLGWLGKRGGVGSLV 740
              +L  +L KRG  G ++
Sbjct: 710 G--NLKSFLSKRGKSGKVI 726


>gi|218515928|ref|ZP_03512768.1| DNA topoisomerase IV subunit A [Rhizobium etli 8C-3]
          Length = 399

 Score =  586 bits (1510), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 278/399 (69%), Positives = 350/399 (87%)

Query: 65  GLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGD 124
           G +    F+K A+IVGEV+G  HPHGDQS+YD+L RLAQ F QRY L++GQGNFGNIDGD
Sbjct: 1   GAETDIGFRKCAKIVGEVMGNYHPHGDQSIYDALARLAQDFSQRYTLVNGQGNFGNIDGD 60

Query: 125 SAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIA 184
           S AA RYTE++MT V+EL+L+G+D+DAVDFRDTY+E +SEP+V P  FPNLLANG+SGIA
Sbjct: 61  SPAAMRYTESKMTAVSELLLEGIDQDAVDFRDTYDESNSEPIVLPGAFPNLLANGSSGIA 120

Query: 185 VGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYR 244
           VGMATSIPSHN  E+C+AAL LI +P+ ++EKL+E+I GPDFPTGGII++SR+SI+ESYR
Sbjct: 121 VGMATSIPSHNAHELCDAALHLIKHPDATVEKLVEFIPGPDFPTGGIIIDSRDSIIESYR 180

Query: 245 LGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDE 304
            GRGGFRVRA+W  E++GRG + IVVTEIP+QVQKSRLIEKIAEL+IA+++PLLEDIRDE
Sbjct: 181 TGRGGFRVRAKWQTEDLGRGGYQIVVTEIPFQVQKSRLIEKIAELLIARKLPLLEDIRDE 240

Query: 305 SAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEW 364
           SAED+RIVL PK+R++DP +LMES+F L+++E+RFPLNMNVLSMGR+P+VM L+ +LKEW
Sbjct: 241 SAEDIRIVLVPKSRTVDPTILMESMFKLTELESRFPLNMNVLSMGRIPKVMALNEVLKEW 300

Query: 365 LAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLT 424
           L HRREVL RRS FR+ AID+R+EIL GLLIAYLNIDE+I IIR ED+PKPVM++R+ LT
Sbjct: 301 LDHRREVLQRRSRFRLAAIDKRLEILGGLLIAYLNIDEVIRIIREEDEPKPVMMARWDLT 360

Query: 425 ENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDS 463
           +NQV+AILN+RLR+LRKLEE++I+ E D L  EK +I++
Sbjct: 361 DNQVEAILNMRLRALRKLEEFEIRKEFDELTKEKGEIEA 399


>gi|254718872|ref|ZP_05180683.1| DNA topoisomerase IV subunit A [Brucella sp. 83/13]
          Length = 465

 Score =  583 bits (1503), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 288/454 (63%), Positives = 361/454 (79%), Gaps = 22/454 (4%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           EE+++ V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+   A+ 
Sbjct: 12  EEHIERVDLKSALEERYLAYALSTIMHRALPDVRDGLKPVHRRIMHAMRLLRLNPDQAYA 71

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+V+GK HPHGD S+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTE
Sbjct: 72  KCARIVGDVMGKFHPHGDASIYDALVRLAQDFAVRYPLVDGQGNFGNIDGDNAAAMRYTE 131

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT+VA L+L+G++E+A+DFR TYNEED EP+V P  FPNLLANG++GIAVGMAT+IP 
Sbjct: 132 ARMTEVATLLLEGINENAIDFRPTYNEEDEEPIVLPGAFPNLLANGSAGIAVGMATNIPP 191

Query: 194 HNVQEICEAALALIDNPEISIEKLLEY----------------------IIGPDFPTGGI 231
           HNV E+C +AL LI++P+  +E+L+                        + GPDFPTGGI
Sbjct: 192 HNVAELCSSALYLINHPDAPVEELVTSPEQWAEIEQESKTDPAALLKCKVRGPDFPTGGI 251

Query: 232 IVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELII 291
           +VE   +I+E+YR GRG FRVRARW  EE  RG+W IVVTEIPYQVQKSRLIEKIAEL++
Sbjct: 252 LVEEHGNILEAYRTGRGAFRVRARWHKEEGNRGTWVIVVTEIPYQVQKSRLIEKIAELLL 311

Query: 292 AKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRV 351
           AK++PLL+DIRDESAED+RIVL PKNR++DP+LLMES+F L+++E+R  LNMNVLS G+V
Sbjct: 312 AKKLPLLDDIRDESAEDIRIVLEPKNRTVDPELLMESLFKLTELESRVSLNMNVLSHGKV 371

Query: 352 PQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNED 411
           P V+ L  +L+EWL HR+EVL RRS FR+  I+RR+EIL G LIAYLN+DE+I IIR ED
Sbjct: 372 PNVLSLGAVLREWLEHRKEVLVRRSQFRLVEIERRLEILGGFLIAYLNLDEVIRIIREED 431

Query: 412 KPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEY 445
           +PK  ++  F LT+ Q ++ILN+RLRSLRKLEE+
Sbjct: 432 EPKQELMRAFELTDVQAESILNMRLRSLRKLEEF 465


>gi|265983858|ref|ZP_06096593.1| DNA topoisomerase IV subunit A [Brucella sp. 83/13]
 gi|264662450|gb|EEZ32711.1| DNA topoisomerase IV subunit A [Brucella sp. 83/13]
          Length = 470

 Score =  583 bits (1503), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 288/454 (63%), Positives = 361/454 (79%), Gaps = 22/454 (4%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           EE+++ V L+ ALEERYLAYALSTI  RA+PD+RDG KPVHRRI+HAM  + L+   A+ 
Sbjct: 17  EEHIERVDLKSALEERYLAYALSTIMHRALPDVRDGLKPVHRRIMHAMRLLRLNPDQAYA 76

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           K ARIVG+V+GK HPHGD S+YD+LVRLAQ F  RYPL+ GQGNFGNIDGD+AAA RYTE
Sbjct: 77  KCARIVGDVMGKFHPHGDASIYDALVRLAQDFAVRYPLVDGQGNFGNIDGDNAAAMRYTE 136

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           ARMT+VA L+L+G++E+A+DFR TYNEED EP+V P  FPNLLANG++GIAVGMAT+IP 
Sbjct: 137 ARMTEVATLLLEGINENAIDFRPTYNEEDEEPIVLPGAFPNLLANGSAGIAVGMATNIPP 196

Query: 194 HNVQEICEAALALIDNPEISIEKLLEY----------------------IIGPDFPTGGI 231
           HNV E+C +AL LI++P+  +E+L+                        + GPDFPTGGI
Sbjct: 197 HNVAELCSSALYLINHPDAPVEELVTSPEQWAEIEQESKTDPAALLKCKVRGPDFPTGGI 256

Query: 232 IVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELII 291
           +VE   +I+E+YR GRG FRVRARW  EE  RG+W IVVTEIPYQVQKSRLIEKIAEL++
Sbjct: 257 LVEEHGNILEAYRTGRGAFRVRARWHKEEGNRGTWVIVVTEIPYQVQKSRLIEKIAELLL 316

Query: 292 AKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRV 351
           AK++PLL+DIRDESAED+RIVL PKNR++DP+LLMES+F L+++E+R  LNMNVLS G+V
Sbjct: 317 AKKLPLLDDIRDESAEDIRIVLEPKNRTVDPELLMESLFKLTELESRVSLNMNVLSHGKV 376

Query: 352 PQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNED 411
           P V+ L  +L+EWL HR+EVL RRS FR+  I+RR+EIL G LIAYLN+DE+I IIR ED
Sbjct: 377 PNVLSLGAVLREWLEHRKEVLVRRSQFRLVEIERRLEILGGFLIAYLNLDEVIRIIREED 436

Query: 412 KPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEY 445
           +PK  ++  F LT+ Q ++ILN+RLRSLRKLEE+
Sbjct: 437 EPKQELMRAFELTDVQAESILNMRLRSLRKLEEF 470


>gi|330814139|ref|YP_004358378.1| topoisomerase IV subunit A [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487234|gb|AEA81639.1| topoisomerase IV subunit A [Candidatus Pelagibacter sp. IMCC9063]
          Length = 752

 Score =  576 bits (1484), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 301/687 (43%), Positives = 463/687 (67%), Gaps = 12/687 (1%)

Query: 8   NSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLD 67
           N N + EE +K    +FA  ++YLAYALSTI +RA+PD+RDG KPVHRR+I+AM  + L 
Sbjct: 4   NKNNITEEQLKN---QFA--KKYLAYALSTITQRALPDVRDGLKPVHRRLIYAMHLLDLT 58

Query: 68  FGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAA 127
             ++FKKSAR+VG+VIGK HPHGDQSVYD+LVRLAQ F  +YPLI+GQGNFGNIDGD+AA
Sbjct: 59  SKSSFKKSARVVGDVIGKFHPHGDQSVYDALVRLAQDFSTKYPLINGQGNFGNIDGDNAA 118

Query: 128 AYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGM 187
           A RYTE ++T+V+E +L+ +  + V+FR TY+ E SEP V P+ FPNLLANG+SGIAVGM
Sbjct: 119 AMRYTETKLTEVSEFLLKDIGSETVNFRKTYDGELSEPTVLPAAFPNLLANGSSGIAVGM 178

Query: 188 ATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGR 247
           AT+IP HN++EIC + + L ++ + SI  LL+ + GPDFPTGGI+   ++ ++++Y  GR
Sbjct: 179 ATNIPPHNLEEICSSIIHLNNHRDCSIRDLLKILKGPDFPTGGILNLDQKEMIKTYTTGR 238

Query: 248 GGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAE 307
           G F +RA++ VE++ +G + + +++IPYQV KS+LIEKIA+LII K+  L++++ DES E
Sbjct: 239 GFFELRAKYKVEDLSKGQYQVSISQIPYQVNKSKLIEKIADLIINKKNKLIDNVIDESDE 298

Query: 308 DVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAH 367
           ++R+V+ PKNR++DP +LM S++  +D+E +F LNMNVL+    P+VM +  IL  +L H
Sbjct: 299 NIRVVIRPKNRNIDPVVLMNSLYQQTDLEIKFFLNMNVLNHKLEPKVMSIKEILYSFLKH 358

Query: 368 RREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQ 427
           R  +L ++S F +  I+ R+EILKG LIA+ N++ II IIRN + PK  +V ++  TENQ
Sbjct: 359 RYIILEKKSKFALNKINIRLEILKGFLIAFKNLNNIIKIIRNSNNPKAELVKKYRFTENQ 418

Query: 428 VDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFS 487
           V+AIL+++LRSLRK+EE +IK E   LL +K+ +  LL+S   Q  +I  E+ ++   F 
Sbjct: 419 VNAILDMKLRSLRKIEEKEIKEENSKLLNKKKLLMKLLSSKSLQKKEINKEMEDLILQFG 478

Query: 488 KSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKE 547
            ++  G R+T   + +R + + L + +   +PIT ++   G++++   +SV      F E
Sbjct: 479 NNSAYGLRKTVIEKFNRIESSELDEELKSTDPITAILLKTGFLKAKIGYSVCKVNADFSE 538

Query: 548 GDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFV 607
            + L +  +   +D+ + LS+ GK+YTL   NL+ G   G+       L  N++IV +F+
Sbjct: 539 NEHLYV--NGRKSDKFIFLSSFGKSYTLDGENLVFGSQKGKPFSSYFSLKENEEIVDSFL 596

Query: 608 YDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGD--HVAVVG 665
           Y +  K+L+ SS G  F +    +I+N + GK    +   + +   V++  D  ++ ++ 
Sbjct: 597 YKNNEKILLCSSNGYGFFINSDNLISNKKSGKKVFNIKKNDFLHSSVQIHKDQKYIFLLT 656

Query: 666 ENRK---LLIFSIDQIPEMSRGKGVRL 689
           +N+K     + S+  IP   +G G+ L
Sbjct: 657 KNKKENRASVISMKDIPTQEKGVGIIL 683


>gi|326794771|ref|YP_004312591.1| DNA topoisomerase IV, subunit alpha [Marinomonas mediterranea
           MMB-1]
 gi|326545535|gb|ADZ90755.1| DNA topoisomerase IV, A subunit [Marinomonas mediterranea MMB-1]
          Length = 756

 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 300/744 (40%), Positives = 465/744 (62%), Gaps = 23/744 (3%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           E+ + +SL+   E+ YL Y++  I +RA+P + DG KPV RRI++AMSE+GL   A +KK
Sbjct: 8   ESNETLSLKEYTEKAYLNYSMYVILDRALPHIGDGLKPVQRRIVYAMSELGLKATAKYKK 67

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE
Sbjct: 68  SARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTE 127

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           +R+++ ++++L+ V +  VD+   ++    EP V P++ PNLL NGT+GIAVGMAT +P 
Sbjct: 128 SRLSKYSDVLLREVSQGTVDWVPNFDGTLKEPSVLPARLPNLLLNGTTGIAVGMATDVPP 187

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN++EI  A + L++NP+  +++LLE++ GPDFPTGG I+ SR  + + Y LG+G  + R
Sbjct: 188 HNLREIGNACVHLLNNPKAELDELLEHVQGPDFPTGGEIITSRSDLRKMYELGKGQVKAR 247

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           AR+ +E+       IVV E+P+QV  S+++E++A  + AK++P++ D+RDES  +   R 
Sbjct: 248 ARYRIED-----GEIVVYELPHQVSGSKVLEQVAAQMQAKKLPMVVDLRDESDHENPTRF 302

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ PK+  +D + +M  +F  +D+E  + +NMNV+ +  +PQV  L   +KEWL  R +V
Sbjct: 303 VIVPKSSRVDTESVMTHLFATTDLEKSYRVNMNVIGLDGLPQVKGLRAFIKEWLTFRIDV 362

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           + +R  FR+  +  R+ IL+GLL+A+LNIDE+I IIRNEDKPK  ++ RF L+++Q +AI
Sbjct: 363 VRKRLQFRLDKVLNRLHILEGLLVAFLNIDEVIDIIRNEDKPKEELIKRFGLSDSQAEAI 422

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L L+LR L KLEE +IKSE D L  E+E++++LL S ++    I  EI+E  E F     
Sbjct: 423 LELKLRHLAKLEEMRIKSEQDELNKEREQLEALLGSDRKLKKLITEEIKEAIEDFGDE-- 480

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
              RRT   E   A +A  ++ ++  +P+TVV+S +GWIR+ K H +D++ L +K GD  
Sbjct: 481 ---RRTPLIERKEA-QAFSEEDLLSNDPVTVVLSKQGWIRAAKGHDIDVTGLSYKSGDEF 536

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
            ++    T   ++L++++G+ Y+L A  L S RG GE I   I L     IV A +    
Sbjct: 537 LLSAKGRTNQTLVLIASNGRTYSLKAHTLPSARGQGEPITGRISLEKGATIVAAVLDSEE 596

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKV---TGDHVAVVGENR 668
              L+ S  G  F+ +  ++ A  + GK  L + S  ++   VKV    GD V VV    
Sbjct: 597 AHYLLASDAGYGFVAQLKDLYAKNKAGKATLSLPSNAEVISPVKVESPEGDKVVVVSNEG 656

Query: 669 KLLIFSIDQIPEMSRGKGVRLQSYKDGGISD----VICFKICEG--LTWIDSAGRSYNRS 722
           ++L FS+  +P+M++GKG ++ S      +D    VI     +   L    S  R  + +
Sbjct: 657 RMLAFSVKSLPQMAKGKGNKMLSIPSSRAADREELVIAMATIQSNDLLVAHSGKRFLSLA 716

Query: 723 ENDLLGWLGKRGGVGSLVPKGFPR 746
           E DL  ++G+RG  G  +P+GF R
Sbjct: 717 EKDLQEYVGERGRRGLKLPRGFQR 740


>gi|152996848|ref|YP_001341683.1| DNA topoisomerase IV subunit A [Marinomonas sp. MWYL1]
 gi|150837772|gb|ABR71748.1| DNA topoisomerase IV, A subunit [Marinomonas sp. MWYL1]
          Length = 765

 Score =  558 bits (1437), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 300/747 (40%), Positives = 464/747 (62%), Gaps = 29/747 (3%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           E+ + +SL+   E+ YL Y++  I +RA+P + DG KPV RRII+AMSE+GL   A +KK
Sbjct: 8   ESNETLSLKDYTEKAYLNYSMYVILDRALPHIGDGLKPVQRRIIYAMSELGLKATAKYKK 67

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE
Sbjct: 68  SARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTE 127

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           +R+++ A+++L+ V +  VD+   ++    EP V PS+ PNLL NGT+GIAVGMAT IP 
Sbjct: 128 SRLSKYADVLLREVSQGTVDWTPNFDGTLQEPSVLPSRLPNLLLNGTTGIAVGMATDIPP 187

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN++EI  A + L++NP   ++ LL ++ GPDFPTGG I+  +  IV  Y  G+G  + R
Sbjct: 188 HNLREIGGACIHLLNNPNAELDDLLNFVQGPDFPTGGEIITPKSDIVRLYETGKGQIKAR 247

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           AR+ +EE       IVV E+P+QV  S+++E+IA  + AK++P++ D+RDES  +   R+
Sbjct: 248 ARFTIEE-----GEIVVNELPHQVSGSKILEQIAAQMQAKKLPMVVDLRDESDHENPTRL 302

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ PK+  +D D +M  +F  +D+E  + +NMNV+ +  +PQV PL   L EWL  R +V
Sbjct: 303 VIVPKSNRVDIDSVMTHLFATTDLEKSYRVNMNVIGLDGLPQVKPLKNFLSEWLRFRIDV 362

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           + RR  FR+  ++ R+ IL+GLLIAYLNIDE+I IIR E+KPK  +++RF L++ Q ++I
Sbjct: 363 VRRRLQFRLDKVNNRLHILEGLLIAYLNIDEVIEIIRTEEKPKVELMARFGLSDMQAESI 422

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L L+LR L KLEE +IK E D L  E+++++ LL+S ++    I  EI+E  +      D
Sbjct: 423 LELKLRHLAKLEEMRIKGEQDELEKERKQLEGLLSSDRKLKKLITEEIQEAID------D 476

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
            G  R T     +  +A  ++ ++  +PITVVIS +GWIR+ K H +D++ L +K GD  
Sbjct: 477 FGDDRRTPIVARKEAQAFSEEDLLSNDPITVVISKQGWIRAAKGHDIDVNGLSYKSGDEF 536

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
            ++    +   ++LL+++G+ Y++ A  L S RG GE I   I L  +  IV+A + +  
Sbjct: 537 LVSTKGRSNQTLVLLASNGRTYSIKAHTLPSARGQGEPITGRISLEKDATIVSAVLDNEE 596

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVV----KVTGDHVAVVGEN 667
              L+ S  G  F+ +  ++ A  + GK  L +    ++   V     V+G  VA+  E 
Sbjct: 597 AHYLIASDAGYGFVAQLKDLYAKNKAGKATLSLPKGARVMAPVPVQDPVSGRVVAISNEG 656

Query: 668 RKLLIFSIDQIPEMSRGKGVRLQSYKDGGISD-------VICFKICEGLTWIDSAGRSY- 719
           R +L F +  +P+M++GKG ++ S      +D       + C +  + LT    AG+ + 
Sbjct: 657 R-MLAFDVASLPQMAKGKGNKMLSIPSSRAADREELVIALACVQPNDLLTAY--AGKRFI 713

Query: 720 NRSENDLLGWLGKRGGVGSLVPKGFPR 746
           + +E DL  +LG+RG  G  +P+GF R
Sbjct: 714 SFTEKDLEEYLGERGRRGLKLPRGFQR 740


>gi|269137555|ref|YP_003294255.1| DNA topoisomerase IV subunit A [Edwardsiella tarda EIB202]
 gi|267983215|gb|ACY83044.1| DNA topoisomerase IV subunit A [Edwardsiella tarda EIB202]
 gi|304557628|gb|ADM40292.1| Topoisomerase IV subunit A [Edwardsiella tarda FL6-60]
          Length = 758

 Score =  542 bits (1396), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 287/747 (38%), Positives = 453/747 (60%), Gaps = 24/747 (3%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L  +N + V+L    E+ YL Y++  I +RA+P + DG KPV RRI++AMSE+GL   A 
Sbjct: 4   LTHDNSERVALHAFTEDAYLQYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLSASAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP   P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSRYAEILLSELGQGTVDYVANFDGTLQEPKFLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HN +E+  A +AL+DNP+ S++ LL +I GPDFPT   I+  R+ I + YR GRG  
Sbjct: 184 IPPHNAREVAAALVALLDNPQSSLDDLLTHIQGPDFPTEAEIITPRDEIRKIYRTGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  EE       IV++ +P+Q   ++++E+IA  + AK++P+++D+RDES  +  
Sbjct: 244 RMRAVWRKEESE-----IVISALPHQTSGAKVLEQIASQMRAKKLPMVDDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P++  +D D LM  +F  +D+E  + +NMN++ + R P V  L  IL EWL++R
Sbjct: 299 TRLVIVPRSNRVDLDQLMNHLFATTDLEKSYRINMNMIGLDRRPAVKDLREILSEWLSYR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           RE + RR ++R++ + +R+ IL+GLL A+LNIDE+I IIR+ED+PKPV+V+RF L++ Q 
Sbjct: 359 RETVRRRLNYRLEKVLKRLHILEGLLCAFLNIDEVIHIIRSEDEPKPVLVARFGLSDTQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L +LEE +I+ E D L  E++++ +LL S ++    I  EI    E +  
Sbjct: 419 EAILELKLRHLARLEEVKIRGEQDALAQERDRLQTLLASERKLGTLIKKEIMADAETYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
           +     RR+   E S A +A  +   +  EP+T+V+S  GW+RS K H +D S L++K G
Sbjct: 479 A-----RRSPLQERSEA-RAMSEHDFVPSEPVTIVLSEGGWVRSAKGHDIDPSGLNYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           D+ + A    +   ++ + + G++Y L    L S RG GE +   +       I    + 
Sbjct: 533 DAFRAAARGKSNQPVVFIDSSGRSYALDPLTLPSARGQGEPLTGKLTPPPGATIEHVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH--VAVVGE 666
               KLL+ S  G  F+   S+++A  R GK  L +    K+   +++ GD   +  + E
Sbjct: 593 ADNQKLLMASDAGYGFVCTFSDLVARNRAGKAMLTLPENAKVLTPLEINGDDDMLLAITE 652

Query: 667 NRKLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVICFKIC----EGLTWIDSAGRSY 719
             ++L+F +  +P++S+GKG   V + + +     D + + +       LT +    R  
Sbjct: 653 AGRMLMFPVHDLPQLSKGKGNKIVSIPAAQAAAGEDTLKWLLVLAPQTSLT-LHVGKRKL 711

Query: 720 NRSENDLLGWLGKRGGVGSLVPKGFPR 746
                DL  +  +RG  G+L+P+G  R
Sbjct: 712 VMKPQDLQKFRAERGRKGTLLPRGLQR 738


>gi|294634296|ref|ZP_06712837.1| DNA topoisomerase IV, A subunit [Edwardsiella tarda ATCC 23685]
 gi|291092289|gb|EFE24850.1| DNA topoisomerase IV, A subunit [Edwardsiella tarda ATCC 23685]
          Length = 758

 Score =  540 bits (1390), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 282/746 (37%), Positives = 453/746 (60%), Gaps = 22/746 (2%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L  +N + V+LR   E+ YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A 
Sbjct: 4   LTHDNSERVALRAFTEDAYLQYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  V++   ++    EP   P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSRYAEVLLSELGQGTVEYTANFDGTLQEPKYLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HN +E+  A +AL+DNP+ S++ LL +I GPDFPT   I+  R+ I + YR GRG  
Sbjct: 184 IPPHNAREVANALVALLDNPDSSLDDLLTHIQGPDFPTEAEIITPRDEIRKIYRTGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  EE       IV++ +P+Q   ++++E+IA  + +K++P++ED+RDES  +  
Sbjct: 244 RMRAVWRKEE-----GEIVISALPHQTSGAKVLEQIASQMRSKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P++  +D D +M  +F  +D+E  + +N+N++ + R P V  L  IL EWL++R
Sbjct: 299 TRLVIVPRSNRVDFDQVMNHLFATTDLEKSYRINLNMIGLDRRPAVKDLREILTEWLSYR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           RE + RR ++R++ + +R+ IL+GLLIA+LNIDE+I +IR ED+PKPV+V+RF L+E Q 
Sbjct: 359 RETVRRRLNYRLEKVLKRLHILEGLLIAFLNIDEVIHLIRTEDEPKPVLVARFGLSETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L +LEE +I+ E D L  E++++ +LL S +    ++A  I+  KEI + 
Sbjct: 419 EAILELKLRQLARLEEMKIRGEQDELAQERDRLQALLASER----KLATLIK--KEIIAD 472

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
           + + G  R +        KA  +   +  EP+T+V+S  GW+RS K H +D S L++K G
Sbjct: 473 AQNYGDARRSPLHQRAEAKAMSEHDFVPSEPVTIVLSESGWVRSAKGHDIDPSGLNYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           DS + A    +   ++ + + G++Y L    L S RG GE +   +       I    + 
Sbjct: 533 DSFRAAARGKSNQPVVFIDSTGRSYALDPLTLPSARGQGEPLTGKLTPPPGATIEHVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH--VAVVGE 666
               KLL+ S  G  F+   S+++A  R GK  L +    K+   + + GD   +  + +
Sbjct: 593 ADNQKLLMASDAGYGFVCTFSDLVARNRAGKAMLTLPENAKVLAPLAIHGDDDMLLAITQ 652

Query: 667 NRKLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVICFKIC---EGLTWIDSAGRSYN 720
             ++L+F +  +P++S+GKG   V + + +     D + + +    +    +    R   
Sbjct: 653 AGRMLMFPVHDLPQLSKGKGNKIVSIPAAQAAAGEDTLKWLLVLAPQTTLTLHVGKRKLV 712

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPR 746
               DL  +  +RG  G+ +P+G  R
Sbjct: 713 MKPQDLQKFRAERGRKGTQLPRGLQR 738


>gi|238918167|ref|YP_002931681.1| DNA topoisomerase IV subunit A [Edwardsiella ictaluri 93-146]
 gi|238867735|gb|ACR67446.1| DNA topoisomerase IV, A subunit, putative [Edwardsiella ictaluri
           93-146]
          Length = 760

 Score =  538 bits (1387), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 286/747 (38%), Positives = 451/747 (60%), Gaps = 24/747 (3%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L  +N + V+L    E+ YL Y++  I +RA+P + DG KPV RRI++AMSE+GL   A 
Sbjct: 4   LTHDNSERVALHAFTEDAYLQYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLSASAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP   P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSRYAEILLSELGQGTVDYVANFDGTLQEPKFLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HN +E+  A +AL+DNP+ S++ LL +I GPDFPT   I+  R+ I + YR GRG  
Sbjct: 184 IPPHNAREVAAALVALLDNPQSSLDDLLTHIQGPDFPTEAEIITPRDEIHKIYRTGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  EE       IV++ +P+Q   ++++E+IA  + AK++P+++D+RDES  +  
Sbjct: 244 RMRAVWRKEE-----GEIVISALPHQTSGAKVLEQIASQMRAKKLPMVDDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P++  +D D LM  +F  +D+E  + +NMN++ + R P V  L  IL EWL++R
Sbjct: 299 TRLVIVPRSNRVDLDQLMNHLFATTDLEKSYRINMNMIGLDRRPAVKDLREILSEWLSYR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           RE + RR ++R++ + +R+ IL GLL A+LNIDE+I IIR+ED+PKPV+V+RF L++ Q 
Sbjct: 359 RETVRRRLNYRLEKVLKRLHILDGLLCAFLNIDEVIHIIRSEDEPKPVLVARFGLSDTQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L +LEE +I+ E D L  E++++ +LL S ++    I  EI    E +  
Sbjct: 419 EAILELKLRHLARLEEVKIRGEQDELAQERDRLQTLLASERKLGTLIKKEIMADAETYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
           +     RR+   E S A +A  +   +  EP+T+V+S  GW+RS K H +D S L++K G
Sbjct: 479 A-----RRSPLQERSEA-RAMSEHDFVPNEPVTIVLSEGGWVRSAKGHDIDPSGLNYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           D+ + A    +   ++ + + G++Y L    L S RG GE +   +       I    + 
Sbjct: 533 DAFRAAARGKSNQPVVFIDSSGRSYALDPLTLPSARGQGEPLTGKLTPPPGATIEHVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH--VAVVGE 666
               KLL+ S  G  F+   S+++A  R GK  L +     +   +++ GD   +  + E
Sbjct: 593 ADDQKLLMASDAGYGFVCTFSDLVARNRAGKAMLTLPENANVLTPLEINGDDDMLLAITE 652

Query: 667 NRKLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVICFKIC----EGLTWIDSAGRSY 719
             ++L+F +  +P++S+GKG   V + + +     D + + +       LT +    R  
Sbjct: 653 AGRMLMFPVHDLPQLSKGKGNKIVSIPAAQAAAGEDTLKWLLVLAPQTSLT-LHIGKRKL 711

Query: 720 NRSENDLLGWLGKRGGVGSLVPKGFPR 746
                DL  +  +RG  G+L+P+G  R
Sbjct: 712 VMKPQDLQKFRAERGRKGTLLPRGLQR 738


>gi|88705253|ref|ZP_01102964.1| DNA topoisomerase IV, A subunit [Congregibacter litoralis KT71]
 gi|88700343|gb|EAQ97451.1| DNA topoisomerase IV, A subunit [Congregibacter litoralis KT71]
          Length = 749

 Score =  538 bits (1386), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 296/754 (39%), Positives = 452/754 (59%), Gaps = 26/754 (3%)

Query: 6   ISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMG 65
           ++ +NT+ ++ ++ +SL+   E+ YL Y++  I +RA+P + DG KPV RRII+AMSE+G
Sbjct: 1   MTETNTIDDDGIEGISLKQYAEKAYLDYSMYVILDRALPHIGDGLKPVQRRIIYAMSELG 60

Query: 66  LDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-D 124
           L   A FKKSAR VG+VIGK HPHGD + Y+++V +AQ F  RYPL+ GQGN+G+ D   
Sbjct: 61  LKATAKFKKSARTVGDVIGKFHPHGDSAAYEAMVLMAQSFSYRYPLVDGQGNWGSPDDPK 120

Query: 125 SAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIA 184
           S AA RYTE+R+T  A+++L  + +  VD+   ++    EP + P++ PN+L NGT+GIA
Sbjct: 121 SFAAMRYTESRLTAYADVLLGELGQGTVDWVPNFDGTMEEPSLLPAQVPNVLLNGTTGIA 180

Query: 185 VGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYR 244
           VGMAT IP HN++E+  AA+ L+D P+ ++ +L E I GPD+PT   I+ SRE I + Y 
Sbjct: 181 VGMATDIPPHNLREVVTAAVTLLDAPKTTLAELCEIIQGPDYPTEAEIITSREDIAQIYA 240

Query: 245 LGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDE 304
            GRGG R+RA W  E        IVVT +P+Q   SR++E+IA+ + AK++P++ D+RDE
Sbjct: 241 TGRGGLRMRAVWDTEH-----GDIVVTALPHQASGSRVLEQIAQQMQAKKLPMVADLRDE 295

Query: 305 SAED--VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILK 362
           S  +   R+V+ P++  +D D LM  +F  +D+E  + +N+N++ +   P V  LDGILK
Sbjct: 296 SDHENPTRLVIVPRSNRIDRDALMSHLFATTDLERTYRVNLNMIGIDGRPGVRSLDGILK 355

Query: 363 EWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFS 422
           +WL  RRE + RR  +R++ + RR+ IL+G L AYLNIDE+I IIR E+ PK  +++RF 
Sbjct: 356 QWLKFRRETVRRRLDYRLERVQRRLHILEGYLAAYLNIDEVIHIIRTEEHPKQALIARFE 415

Query: 423 LTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREV 482
           L++ Q +AIL L+LR+L KLEE +I+ E D L  E++ ++  L S  +    I  E+  +
Sbjct: 416 LSDIQAEAILELKLRNLAKLEEMKIRGEQDELEKERDWLEKTLGSEARLKTLIKKELTAI 475

Query: 483 KEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSA 542
            E +        RR+       A +A  +  ++  +PITVV+S +GWIR+ K H +D ++
Sbjct: 476 AEKYGDD-----RRSPLASREEA-QAFSELELMTADPITVVLSEKGWIRAAKGHDMDPAS 529

Query: 543 LHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDI 602
           L +K GDS K+A    +    +++ + G+AYTL   NL S RG GE +   I+       
Sbjct: 530 LSYKSGDSFKLAARGRSNQPAVIIDSTGRAYTLATHNLPSARGQGEPLTGRINPPSGAGF 589

Query: 603 VTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH-- 660
               + DS  + L+ S  G  FI    E+    R GK  L + +  ++     +  D   
Sbjct: 590 DGLMMGDSGQRCLLSSDAGYGFITTLGELQTKNRAGKAALTLPAGARVVSPAPIGEDAQW 649

Query: 661 VAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKIC-------EGLT-WI 712
           VA V    +LL+F +  +P +SRGKG ++ +       D   F I        +GLT W 
Sbjct: 650 VAAVSNEGRLLLFPLADLPSLSRGKGNKIIAIPGPRARDREEFMIATAVLRENDGLTVWA 709

Query: 713 DSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPR 746
                +  RSE  L  + G+RG  G+ +P+GF R
Sbjct: 710 GKRHLTLKRSE--LEHYHGERGRRGNKLPRGFQR 741


>gi|251791327|ref|YP_003006048.1| DNA topoisomerase IV subunit A [Dickeya zeae Ech1591]
 gi|247539948|gb|ACT08569.1| DNA topoisomerase IV, A subunit [Dickeya zeae Ech1591]
          Length = 758

 Score =  537 bits (1384), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 286/746 (38%), Positives = 453/746 (60%), Gaps = 22/746 (2%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           +  +  + ++L    E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A 
Sbjct: 4   MTHDGAERLALHTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLGELGQGTVDYVPNFDGTLQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+E+  AA+ALID P+ S+E LL Y+ GPDFPT   I+  R+ I + Y  GRG  
Sbjct: 184 IPPHNVREVAAAAMALIDEPDTSLEALLRYVQGPDFPTDAEIITPRDEIRKMYESGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+   GS  +V+T +P+QV  +R++E+IA  + AK++P+++D+RDES  +  
Sbjct: 244 RMRAVWKKED---GS--VVITALPHQVSGARVLEQIASQMRAKKLPMIDDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+VL P++  +D D +M  +F  +D+E  + +NMN++ +   P V  L  IL EWLA R
Sbjct: 299 TRLVLVPRSNRIDFDQVMNHLFATTDLEKSYRINMNMIGLDGRPSVKGLREILTEWLAFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ + RR +FR+  + +R+ IL+GLLIA+LNIDE+I IIRNED+PKPV++++F L++ Q 
Sbjct: 359 RDTVRRRLNFRLDKVLKRLHILEGLLIAFLNIDEVIHIIRNEDEPKPVLMAKFGLSDTQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D+L  E+++I +LL S ++    +  EI+E  + +  
Sbjct: 419 EAILELKLRHLAKLEEMKIRGEQDDLAKERDQIQALLASERKMNTLLKKEIQEDAKAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E   A KA  +  +   EP+T+V+S  GW+RS K H +D S L +K G
Sbjct: 479 D-----RRSPLHERGEA-KAMSEHDLSPSEPVTIVLSEMGWVRSAKGHDIDPSGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           D+ + A    +   ++ + + G++Y L    L S RG GE +   + L     I    + 
Sbjct: 533 DAYRAAARGKSNQPVVFMDSTGRSYALDPLTLPSARGQGEPLTGKLTLPPGATIEQVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH--VAVVGE 666
               +LL+ S  G  FI   ++++A  R GK  L +    ++   +++  D   +  +  
Sbjct: 593 ADNQRLLLASDAGYGFICTFADLVARNRVGKAVLTLPDHARVLPPLELQRDDELLLTITA 652

Query: 667 NRKLLIFSIDQIPEMSRGKGVRLQSYKDGGIS---DVICFKIC---EGLTWIDSAGRSYN 720
             +LL+F +  +P +S+GKG ++ S     ++   D I + +    +    + +  R Y+
Sbjct: 653 AGRLLLFPVADLPALSKGKGNKIVSIPAAQLASGDDRILWLMTIAPQSSVTLYAGKRKYS 712

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPR 746
               +L  +   RG  G+ +P+G  R
Sbjct: 713 LRPEELQKYQASRGCKGTALPRGLQR 738


>gi|329896487|ref|ZP_08271545.1| Topoisomerase IV subunit A [gamma proteobacterium IMCC3088]
 gi|328921704|gb|EGG29077.1| Topoisomerase IV subunit A [gamma proteobacterium IMCC3088]
          Length = 753

 Score =  537 bits (1384), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 293/751 (39%), Positives = 450/751 (59%), Gaps = 24/751 (3%)

Query: 6   ISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMG 65
           +S+   L EE+ ++VSLR   E+ YL Y++  I +RA+P++ DG KPV RRII+AMSE+G
Sbjct: 1   MSDMPMLPEED-ESVSLRDYAEKAYLDYSMYVILDRALPNVGDGLKPVQRRIIYAMSELG 59

Query: 66  LDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-D 124
           L   A +KKSAR VG+VIGK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G+ D   
Sbjct: 60  LKASAKYKKSARTVGDVIGKFHPHGDSAAYEAMVLMAQPFSYRYPLVDGQGNWGSADDPK 119

Query: 125 SAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIA 184
           S AA RYTE+R+T  A+ +L  + +  VD+   ++    EP V P++ PN+L NGT+GIA
Sbjct: 120 SFAAMRYTESRLTAYADALLGELGQGTVDWVPNFDGTMDEPSVLPAQVPNVLLNGTTGIA 179

Query: 185 VGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYR 244
           VGMAT IP HN++E+  A + L++ P+ ++++L E+I  PDFPT   I+  R+ I   YR
Sbjct: 180 VGMATDIPPHNLREVVSATIRLLEYPKSTLDELCEHIQAPDFPTQAEIITPRDEIKAFYR 239

Query: 245 LGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDE 304
            GRG  ++RA W  E+       I+V  +P+QV  ++++E+IA  + AK++PL+ D+RDE
Sbjct: 240 SGRGSIKMRAHWRKED-----GAIIVDALPHQVSGAKVLEQIAAQMQAKKLPLVNDLRDE 294

Query: 305 SAED--VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILK 362
           S  +   R+V+ PK+  +D D LM  +F  +D+E  + +N+N++     P V  LD IL+
Sbjct: 295 SDHENPTRLVIVPKSNRVDIDALMLHLFATTDLERSYRINLNLIGNNGRPGVKSLDAILR 354

Query: 363 EWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFS 422
           EWL  R E + RR  +R++ + +R+ +L+G LIAYLNIDE+I IIR EDKPKPV++ RF 
Sbjct: 355 EWLEFRTETVRRRLQYRLEKVLKRLHLLEGYLIAYLNIDEVIHIIRTEDKPKPVLMQRFG 414

Query: 423 LTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREV 482
           L++ Q +A+L L+LR+L KLEE +I+ E D L  E+E+++  L S  +    I  E+  V
Sbjct: 415 LSDAQAEAVLELKLRNLAKLEEMKIRGEQDELEKEREQLELTLGSTARMRTLIKKELLAV 474

Query: 483 KEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSA 542
            E F      G  R++        KA  ++ ++  EPITVV+S +GWIR+ K H +D ++
Sbjct: 475 AEQF------GDERSSPLVAREEAKAFSEKELMSTEPITVVLSEKGWIRAAKGHDIDPTS 528

Query: 543 LHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDI 602
           L +K GD+  +A    +    +L+ + G+AYTLP  NL S RG GE +   I        
Sbjct: 529 LSYKAGDNFNLAAAGRSNQSAILIDSTGRAYTLPTHNLPSARGQGEPVTGRISPPPGVGF 588

Query: 603 VTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKV-TGDH- 660
               + D   K+L+ S  G  F+ E   ++A  + GK  L + +  ++    +V  GD  
Sbjct: 589 KALLLGDERQKILLASDAGYGFVTELGHLMAKNKAGKAILNLPNGSEVLPPAQVPPGDDL 648

Query: 661 -VAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDV------ICFKICEGLTWID 713
            VA V    +LL+F +  +PE++RGKG ++ S     +         I     E    + 
Sbjct: 649 LVAAVSTEGRLLVFPLADLPELARGKGNKILSVPSARVKSREEMVKGIAVLTQESRLVLH 708

Query: 714 SAGRSYNRSENDLLGWLGKRGGVGSLVPKGF 744
           +  R      ++L  + G+RG  GS +P+G 
Sbjct: 709 AGKRHLTLKVSELDHYRGERGRRGSKLPRGL 739


>gi|153214093|ref|ZP_01949227.1| topoisomerase IV, subunit A [Vibrio cholerae 1587]
 gi|124115519|gb|EAY34339.1| topoisomerase IV, subunit A [Vibrio cholerae 1587]
          Length = 761

 Score =  535 bits (1378), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 286/745 (38%), Positives = 454/745 (60%), Gaps = 25/745 (3%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + V+ + LR   EE YL Y++  I +RA+P + DG KPV RRII+AMSE+GL   A +KK
Sbjct: 8   DGVEQLPLRQFTEEAYLNYSMYVIMDRALPYIGDGLKPVQRRIIYAMSELGLSASAKYKK 67

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE
Sbjct: 68  SARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTE 127

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           A++++ AE++L  + +  VD++  ++    EP + P++ P++L NG +GIAVGMAT IP 
Sbjct: 128 AKLSKFAEILLSELGQGTVDWQPNFDGTMQEPKMLPARLPHILLNGVTGIAVGMATDIPP 187

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV+E+ +A + LIDNP   +  L++Y+ GPDFPT   I+     + + YR GRG  ++R
Sbjct: 188 HNVREVADATIHLIDNPNAPLTDLMQYVKGPDFPTEAEIITPTVELEKIYRSGRGSIKMR 247

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           A WC E    GS  IV+T +P+QV  ++L+E+IA  + AK++P++ED+RDES  +   RI
Sbjct: 248 AVWCKE----GS-DIVITALPHQVSGAKLLEQIAAQMRAKKLPMVEDLRDESDHENPTRI 302

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ P++  +D DLLM  +F  +D+E  F +N+N++ +   PQV  L  IL EW++ RRE 
Sbjct: 303 VIVPRSNRVDCDLLMNHLFASTDLEKSFRVNLNMIGLDNRPQVKGLVQILSEWISFRRET 362

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           +  R  +R+  +  R+ IL+GLLIAYLN+DE+I IIRNED PK V+++RF LT+ Q DAI
Sbjct: 363 VRSRLQYRLDKVLARLHILQGLLIAYLNLDEVIEIIRNEDDPKAVLMARFDLTDLQADAI 422

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L+ +LR L KLEE +I+ E D L  E++K++ LL S ++  N +  EI+   + F     
Sbjct: 423 LDTKLRHLAKLEEMKIRGEQDELEKERKKLEELLGSERRLNNLLKKEIKADADKFGDD-- 480

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
              RR+   E   A KA  ++ ++  E ITVV+S +GWIR  K H VD  +L++K GD+ 
Sbjct: 481 ---RRSPLVEREEA-KALTERDLMPSEAITVVLSEKGWIRHAKGHDVDCQSLNYKAGDNY 536

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
                  +  + + L +DG++Y+L +  L S RG GE I   +++     I    + +  
Sbjct: 537 LTHACGKSNQQAVFLGSDGRSYSLESHTLPSARGQGEPITGRLNVAEGTTIRQVVMGEED 596

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENR 668
              LV S  G  F+ +  ++++  R GK  + +    ++   +++  +  D +  +    
Sbjct: 597 QLWLVGSDAGYGFVCKGDDLLSKNRSGKALINLPENSEVMTPQVIADLDNDEILAITNQG 656

Query: 669 KLLIFSIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSYNR 721
           ++L+F I  +P++S+GKG ++          ++  +S+++       +T + +  R    
Sbjct: 657 RMLLFPIKDLPQLSKGKGNKIINIPAAKAKTREEVLSNLMVLPQGASIT-LYAGKRKLGL 715

Query: 722 SENDLLGWLGKRGGVGSLVPKGFPR 746
             +DL  + G+RG  G+L+P+G  R
Sbjct: 716 KVSDLDNFRGERGRRGALLPRGLQR 740


>gi|327484922|gb|AEA79329.1| Topoisomerase IV subunit A [Vibrio cholerae LMA3894-4]
          Length = 761

 Score =  535 bits (1378), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 288/744 (38%), Positives = 454/744 (61%), Gaps = 23/744 (3%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + V+ + LR   E+ YL Y++  I +RA+P + DG KPV RRII+AMSE+GL   A +KK
Sbjct: 8   DGVEQLPLRKFTEDAYLNYSMYVIMDRALPYIGDGLKPVQRRIIYAMSELGLSASAKYKK 67

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE
Sbjct: 68  SARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTE 127

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           A++++ AE++L  + +  VD++  ++    EP + P++ P++L NG +GIAVGMAT IP 
Sbjct: 128 AKLSKFAEILLSELGQGTVDWQPNFDGTMQEPKMLPARLPHILLNGVTGIAVGMATDIPP 187

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV+E+ +A + LIDNP   +  L++Y+ GPDFPT   I+     + + YR GRG  ++R
Sbjct: 188 HNVREVADATIHLIDNPNAPLTDLMQYVKGPDFPTEAEIITPTVELEKIYRSGRGSIKMR 247

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           A WC E    GS  IV+T +P+QV  ++L+E+IA  + AK++P++ED+RDES  +   RI
Sbjct: 248 AVWCKE----GS-DIVITALPHQVSGAKLLEQIAAQMRAKKLPMVEDLRDESDHENPTRI 302

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ P++  +D DLLM  +F  +D+E  F +N+N++ +   PQV  L  IL EW++ RRE 
Sbjct: 303 VIVPRSNRVDCDLLMNHLFASTDLEKSFRVNLNMIGLDNRPQVKGLVQILSEWISFRRET 362

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           +  R  +R+  +  R+ IL+GLLIAYLN+DE+I IIRNED PK V+++RF LT+ Q DAI
Sbjct: 363 VRSRLQYRLDKVLARLHILQGLLIAYLNLDEVIEIIRNEDDPKAVLMARFDLTDLQADAI 422

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L+ +LR L KLEE +I+ E D L  E++K++ LL S ++  N +  EI+   + F     
Sbjct: 423 LDTKLRHLAKLEEMKIRGEQDELEKERKKLEELLGSERRLNNLLKKEIKADADKFGDD-- 480

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
              RR+   E   A KA  ++ ++  E ITVV+S +GWIR  K H VD  +L++K GD+ 
Sbjct: 481 ---RRSPLVEREEA-KALTERDLMPSEAITVVLSEKGWIRHAKGHDVDCQSLNYKAGDNY 536

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
                  +  + + L +DG++Y+L +  L S RG GE I   +++     I    + +  
Sbjct: 537 LTHACGKSNQQAVFLGSDGRSYSLESHTLPSARGQGEPITGRLNVAEGTTIRQVVMGEED 596

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENR 668
              LV S  G  F+ +  ++++  R GK  + +    ++   +++  +  D +  +    
Sbjct: 597 QLWLVGSDAGYGFVCKGDDLLSKNRSGKALINLPENSEVMTPQVIADLDNDEILAITNQG 656

Query: 669 KLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVIC--FKICEGLTWIDSAG-RSYNRS 722
           ++L+F I  +P++S+GKG   + + + K     +V+     + +G +    AG R     
Sbjct: 657 RMLLFPIKDLPQLSKGKGNKIINIPAAKANSREEVLSNLMVLPQGASITLYAGKRKLGLK 716

Query: 723 ENDLLGWLGKRGGVGSLVPKGFPR 746
            +DL  + G+RG  G+L+P+G  R
Sbjct: 717 VSDLDNFRGERGRRGALLPRGLQR 740


>gi|88812693|ref|ZP_01127940.1| DNA topoisomerase IV subunit A [Nitrococcus mobilis Nb-231]
 gi|88790109|gb|EAR21229.1| DNA topoisomerase IV subunit A [Nitrococcus mobilis Nb-231]
          Length = 747

 Score =  535 bits (1377), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 294/741 (39%), Positives = 439/741 (59%), Gaps = 23/741 (3%)

Query: 22  LRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGE 81
           LR   E+ YL Y++  I +RA+P L DG KPV RRII+AMSE+G+   A +KKSAR VG+
Sbjct: 13  LREFTEKAYLDYSMYVILDRALPHLGDGLKPVQRRIIYAMSELGISAAAKYKKSARTVGD 72

Query: 82  VIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNID-GDSAAAYRYTEARMTQVA 140
           V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G+ D   S AA RYTEAR+T+ A
Sbjct: 73  VLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGSADEPKSFAAMRYTEARLTRYA 132

Query: 141 ELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEIC 200
           +L+L  + E  V++   ++    EP + P++ PNLL NG++GIAVGMAT IP HN++E+ 
Sbjct: 133 QLLLTELGEGTVEWMPNFDGTLEEPRILPARLPNLLLNGSTGIAVGMATDIPPHNLREVV 192

Query: 201 EAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEE 260
            A + L+D P+ S+  L E I+GPDFPT   I+   E I   Y +G GG R RA W    
Sbjct: 193 AACIHLLDQPDASVADLCEAILGPDFPTRAEIITPAEDIRRFYEIGYGGLRQRACW---- 248

Query: 261 VGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIVLFPKNR 318
             R    IV+T +PYQV  S+++E+IA  + +K++P++ED+RDES  D   R+++ P++ 
Sbjct: 249 -ERDGLDIVITALPYQVSGSKVLEQIAAQMQSKKLPMVEDLRDESDHDSPTRLIITPRSA 307

Query: 319 SLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSF 378
            +D + LM+ +F  +D+E  + +N+NV+ +   P+V  L  IL EWL  R E + RR  +
Sbjct: 308 RVDAEPLMQHLFATTDLEKTYRVNLNVIGLDARPRVRNLREILTEWLRFRTETVCRRLQW 367

Query: 379 RMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRS 438
           R+  ++ R+ +L G LIA+LNIDE+IAIIR EDKPK V++ RF LTE Q +AIL LRLR 
Sbjct: 368 RLDKVEARLHLLDGYLIAFLNIDEVIAIIRAEDKPKLVLMERFGLTERQAEAILELRLRH 427

Query: 439 LRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTT 498
           L KLEE +I +E D LL E++++ S+LNS  +    I  E++E  + +      G  R +
Sbjct: 428 LAKLEEIKIHAEQDELLRERDRLRSILNSEARLKALIKSELQEDAQKY------GDPRCS 481

Query: 499 FCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAH 558
                 + +A     ++  EP+T+V+S RGWIR+ K H VD   L +K GD  + A    
Sbjct: 482 PLVQRGSARALSDTELVPSEPVTLVLSQRGWIRAAKGHDVDAQRLSYKAGDGYRDAAIGR 541

Query: 559 TTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVS 618
           T  + + L + G+AY+LPA  L S RG GE +   + L    +     + D     L+ S
Sbjct: 542 TNQQAVFLDSQGRAYSLPAHTLPSARGQGEPLTGRLSLPGGGEFSYVLLGDPDSLWLLAS 601

Query: 619 SKGNAFIVEESEIIANTRKGKTFLKVSSEE---KMKLVVKVTGDHVAVVGENRKLLIFSI 675
             G  FI     + +  R GK  L V+      K   +  +  D +       +LL+F +
Sbjct: 602 DHGYGFITRLGNLYSKNRAGKAVLSVAGGAQPLKPARIYALAQDRLVAATTAGRLLVFPL 661

Query: 676 DQIPEMSRGKG---VRLQSYKDGGISDVIC--FKICEGLTWIDSAG-RSYNRSENDLLGW 729
            ++PE+ +GKG   +++ S +     +V+     +  G   I  AG R+     +DL  +
Sbjct: 662 QELPELGKGKGNKLIQIPSPRLKTREEVVAGVLAVPPGRAVILQAGKRTLTLRPSDLERY 721

Query: 730 LGKRGGVGSLVPKGFPRSGKF 750
           LG+RG  G  +P+GF R  +F
Sbjct: 722 LGQRGRRGDALPRGFQRVQQF 742


>gi|121729937|ref|ZP_01682359.1| topoisomerase IV, subunit A [Vibrio cholerae V52]
 gi|121628325|gb|EAX60832.1| topoisomerase IV, subunit A [Vibrio cholerae V52]
          Length = 761

 Score =  535 bits (1377), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 286/745 (38%), Positives = 454/745 (60%), Gaps = 25/745 (3%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + V+ + LR   E+ YL Y++  I +RA+P + DG KPV RRII+AMSE+GL   A +KK
Sbjct: 8   DGVEQLPLRKFTEDAYLNYSMYVIMDRALPYIGDGLKPVQRRIIYAMSELGLSASAKYKK 67

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE
Sbjct: 68  SARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTE 127

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           A++++ AE++L  + +  VD++  ++    EP + P++ P++L NG +GIAVGMAT IP 
Sbjct: 128 AKLSKFAEILLSELGQGTVDWQPNFDGTMQEPKMLPARLPHILLNGVTGIAVGMATDIPP 187

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV+E+ EA + LIDNP   +  L++Y+ GPDFPT   I+     + + YR GRG  R+R
Sbjct: 188 HNVREVAEATIHLIDNPNAPLTDLMQYVKGPDFPTEAEIITPTVELEKIYRSGRGSVRMR 247

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           A WC E    GS  IV+T +P+QV  ++L+E+IA  + AK++P++ED+RDES  +   RI
Sbjct: 248 AVWCKE----GS-DIVITALPHQVSGAKLLEQIAAQMRAKKLPMVEDLRDESDHENPTRI 302

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ P++  +D DLLM  +F  +D+E  F +N+N++ +   PQV  L  IL EW++ RRE 
Sbjct: 303 VIVPRSNRVDCDLLMNHLFASTDLEKSFRVNLNMIGLDNRPQVKGLVQILSEWISFRRET 362

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           +  R  +R+  +  R+ +L+GLLIAYLN+DE+I IIRNED PK V+++RF LT+ Q DAI
Sbjct: 363 VRSRLQYRLDKVLARLHVLQGLLIAYLNLDEVIEIIRNEDDPKAVLMARFDLTDIQADAI 422

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L+ +LR L KLEE +I+ E D L  E++K++ LL S ++  N +  EI+   + F     
Sbjct: 423 LDTKLRHLAKLEEMKIRGEQDELEKERKKLEELLGSERRLNNLLKKEIKADADKFGDD-- 480

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
              RR+   E   A KA  ++ ++  E ITVV+S +GWIR  K H VD  +L++K GD+ 
Sbjct: 481 ---RRSPLVEREEA-KALTERDLMPSEAITVVLSEKGWIRHAKGHDVDCQSLNYKAGDNY 536

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
                  +  + + L +DG++Y+L +  L S RG GE I   +++     I    + +  
Sbjct: 537 LTHACGKSNQQAVFLGSDGRSYSLESHTLPSARGQGEPITGRLNVAEGTTIRQVVMGEED 596

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENR 668
              LV S  G  F+ +  ++++  R GK  + +    ++   +++  +  D +  +    
Sbjct: 597 QLWLVGSDAGYGFVCKGDDLLSKNRSGKALINLPENSEVMTPQVIADLDKDEILAITNQG 656

Query: 669 KLLIFSIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSYNR 721
           ++L+F I  +P++S+GKG ++          ++  +S+++       +T + +  R    
Sbjct: 657 RMLLFPIKDLPQLSKGKGNKIINIPAAKAKTREEVLSNLMVLPQGASIT-LYAGKRKLGL 715

Query: 722 SENDLLGWLGKRGGVGSLVPKGFPR 746
             +DL  + G+RG  G+L+P+G  R
Sbjct: 716 KVSDLDNFRGERGRRGALLPRGLQR 740


>gi|290474835|ref|YP_003467715.1| DNA topoisomerase IV subunit A [Xenorhabdus bovienii SS-2004]
 gi|289174148|emb|CBJ80935.1| DNA topoisomerase IV, subunit A [Xenorhabdus bovienii SS-2004]
          Length = 751

 Score =  534 bits (1376), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 291/751 (38%), Positives = 455/751 (60%), Gaps = 30/751 (3%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           +  + V+   L    E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL   A 
Sbjct: 4   ITHDGVECQPLHTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLSNSAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDGACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AEL+L  +    VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAELLLSELGHGTVDWVPNFDGTLQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+E+  A +A++DNP  S++ ++EYI GPD+PT   I+ S+E I + Y+ GRG  
Sbjct: 184 IPPHNVREVVSALVAMLDNPNCSLDDVMEYIKGPDYPTEAEIITSKEDIRKIYKNGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  EE       +V+T +P+QV  ++++E+IA  + AK++P+++D+RDES  +  
Sbjct: 244 RMRAVWSKEESN-----VVITALPHQVSGAKVLEQIASQMRAKKLPMVDDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ PKN  +D + +M  +F+ +D+E  + +N+N++ +   P V  L  IL EWL  R
Sbjct: 299 TRLVIVPKNNRVDVEQVMNHLFVTTDLEKSYRVNLNMIGLDNRPNVKGLVEILSEWLVFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           RE +  R ++R++ + +R+ IL GLL AYL+IDE+I IIRNED+PKPV++ RF LTE Q 
Sbjct: 359 RETVRNRLNYRLEKVLKRLHILDGLLKAYLSIDEVIQIIRNEDEPKPVLMQRFELTETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D L  E++K+ ++L S ++    +       KEI + 
Sbjct: 419 EAILELKLRHLAKLEEVKIRGEQDGLAKERDKLQAILGSERKLSTLLK------KEIIAD 472

Query: 489 STDLG-RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKE 547
           + + G  RR+   E S A KA     ++  EPITVV+S  GW+RS K H +D + L++K 
Sbjct: 473 AENYGDHRRSPLKERSEA-KAMSDHDILPSEPITVVLSEMGWVRSAKGHEIDPAGLNYKS 531

Query: 548 GDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQ-LLIDLNHNQDIVTAF 606
           GDS + A    +   ++ + T G++Y++   +L S RG GE +   L+ L     I    
Sbjct: 532 GDSFRSAARGKSNQPVVFIDTTGRSYSVDPLDLPSARGQGEPLTGKLLALPAGASIEHLL 591

Query: 607 VYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH----VA 662
           +     K L+ S  G  FI   S++IA  R GK  + +    K+   +++T +     +A
Sbjct: 592 IAKEEQKFLMASDAGYGFICTFSDLIAKNRAGKALITLPENAKVMQPLEITNEQDDMLLA 651

Query: 663 VVGENRKLLIFSIDQIPEMSRGKGVRLQSYK-------DGGISDVICFKICEGLTWIDSA 715
           +  E R +L+F +  +P++S+GKG ++ S         +  +S ++   +   +T     
Sbjct: 652 ITKEGR-MLMFPVADLPQLSKGKGNKIVSIPAAQAASGEDMLSWLLVLPVQSSITLYFGK 710

Query: 716 GRSYNRSENDLLGWLGKRGGVGSLVPKGFPR 746
            +   R E DL  +  +RG  G+ +P+G  R
Sbjct: 711 RKLLLRPE-DLQKFRAERGRKGTSLPRGLQR 740


>gi|227082551|ref|YP_002811102.1| topoisomerase IV, subunit A [Vibrio cholerae M66-2]
 gi|227010439|gb|ACP06651.1| topoisomerase IV, subunit A [Vibrio cholerae M66-2]
          Length = 761

 Score =  534 bits (1376), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 288/744 (38%), Positives = 455/744 (61%), Gaps = 23/744 (3%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + V+ + LR   E+ YL Y++  I +RA+P + DG KPV RRII+AMSE+GL   A +KK
Sbjct: 8   DGVEQLPLRKFTEDAYLNYSMYVIMDRALPYIGDGLKPVQRRIIYAMSELGLSASAKYKK 67

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE
Sbjct: 68  SARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTE 127

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           A++++ AE++L  + +  VD++  ++    EP + P++ P++L NG +GIAVGMAT IP 
Sbjct: 128 AKLSKFAEILLSELGQGTVDWQPNFDGTMQEPKMLPARLPHILLNGVTGIAVGMATDIPP 187

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV+E+ +A + LIDNP   +  L++Y+ GPDFPT   I+     + + YR GRG  ++R
Sbjct: 188 HNVREVADATIHLIDNPNAPLTDLMQYVKGPDFPTEAEIITPTVELEKIYRSGRGSIKMR 247

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           A WC E    GS  IV+T +P+QV  ++L+E+IA  + AK++P++ED+RDES  +   RI
Sbjct: 248 AVWCKE----GS-DIVITALPHQVSGAKLLEQIAAQMRAKKLPMVEDLRDESDHENPTRI 302

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ P++  +D DLLM  +F  +D+E  F +N+N++ +   PQV  L  IL EW++ RRE 
Sbjct: 303 VIVPRSNRVDCDLLMNHLFASTDLEKSFRVNLNMIGLDNRPQVKGLVQILSEWISFRRET 362

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           +  R  +R+  +  R+ IL+GLLIAYLN+DE+I IIRNED PK V+++RF LT+ Q DAI
Sbjct: 363 VRSRLQYRLDKVLARLHILQGLLIAYLNLDEVIEIIRNEDDPKAVLMARFDLTDIQADAI 422

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L+ +LR L KLEE +I+ E D L  E++K++ LL S ++  N +  EI+   + F     
Sbjct: 423 LDTKLRHLAKLEEMKIRGEQDELEKERKKLEELLGSERRLNNLLKKEIKADADKFGDD-- 480

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
              RR+   E   A KA  ++ ++  E ITVV+S +GWIR  K H+VD  +L++K GD+ 
Sbjct: 481 ---RRSPLVEREEA-KALTERDLMPSEAITVVLSEKGWIRHAKGHNVDCQSLNYKAGDNY 536

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
                  +  + + L +DG++Y+L +  L S RG GE I   +++     I    + +  
Sbjct: 537 LTHACGKSNQQAVFLGSDGRSYSLESHTLPSARGQGEPITGRLNVAEGTTIRQVVMGEED 596

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENR 668
              LV S  G  F+ +  ++++  R GK  + +    ++   +++  +  D +  +    
Sbjct: 597 QLWLVGSDAGYGFVCKGDDLLSKNRSGKALINLPENSEVMTPQVIADLDNDEILAITNQG 656

Query: 669 KLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVIC--FKICEGLTWIDSAG-RSYNRS 722
           ++L+F I  +P++S+GKG   + + + K     +V+     + +G +    AG R     
Sbjct: 657 RMLLFPIKDLPQLSKGKGNKIINIPAAKAKTREEVLSNLMVLPQGASITLYAGKRKLGLK 716

Query: 723 ENDLLGWLGKRGGVGSLVPKGFPR 746
            +DL  + G+RG  G+L+P+G  R
Sbjct: 717 VSDLDNFRGERGRRGALLPRGLQR 740


>gi|153827235|ref|ZP_01979902.1| topoisomerase IV, subunit A [Vibrio cholerae MZO-2]
 gi|149738849|gb|EDM53185.1| topoisomerase IV, subunit A [Vibrio cholerae MZO-2]
          Length = 761

 Score =  534 bits (1375), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 285/745 (38%), Positives = 455/745 (61%), Gaps = 25/745 (3%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + V+ + LR   E+ YL Y++  I +RA+P + DG KPV RRII+AMSE+GL   A +KK
Sbjct: 8   DGVEQLPLRKFTEDAYLNYSMYVIMDRALPYIGDGLKPVQRRIIYAMSELGLSASAKYKK 67

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE
Sbjct: 68  SARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTE 127

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           A++++ AE++L  + +  VD++  ++    EP + P++ P++L NG +GIAVGMAT IP 
Sbjct: 128 AKLSKFAEILLSELGQGTVDWQPNFDGTMQEPKMLPARLPHILLNGVTGIAVGMATDIPP 187

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV+E+ +A + LIDNP   +  L++Y+ GPDFPT   I+     + + YR GRG  ++R
Sbjct: 188 HNVREVADATIHLIDNPNAPLTDLMQYVKGPDFPTEAEIITPTVELEKIYRSGRGSIKMR 247

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           A WC E    GS  IV+T +P+QV  ++L+E+IA  + AK++P++ED+RDES  +   RI
Sbjct: 248 AVWCKE----GS-DIVITALPHQVSGAKLLEQIAAQMRAKKLPMVEDLRDESDHENPTRI 302

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ P++  +D DLLM  +F  +D+E  F +N+N++ +   PQV  L  IL EW++ RRE 
Sbjct: 303 VIVPRSNRVDCDLLMNHLFASTDLEKSFRVNLNMIGLDNRPQVKGLVQILSEWISFRRET 362

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           +  R  +R+  +  R+ IL+GLLIAYLN+DE+I IIRNED PK V+++RF LT+ Q DAI
Sbjct: 363 VRSRLQYRLDKVLARLHILQGLLIAYLNLDEVIEIIRNEDDPKAVLMARFDLTDLQADAI 422

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L+ +LR L KLEE +I+ E D L  E++K++ LL S ++  N +  EI+   + F     
Sbjct: 423 LDTKLRHLAKLEEMKIRGEQDELEKERKKLEELLGSERRLNNLLKKEIKADADKFGDD-- 480

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
              RR+   E   A KA  ++ ++  E ITVV+S +GWIR  K H VD  +L++K GD+ 
Sbjct: 481 ---RRSPLVEREEA-KALTERDLMPSEAITVVLSEKGWIRHAKGHDVDCQSLNYKAGDNY 536

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
                  +  + + L +DG++Y+L + +L S RG GE I   +++     I    + +  
Sbjct: 537 LTHACGKSNQQAVFLGSDGRSYSLESHSLPSARGQGEPITGRLNVAEGTTIRQVVMGEED 596

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENR 668
              LV S  G  F+ +  ++++  R GK  + +    ++   +++  +  D +  +    
Sbjct: 597 QLWLVGSDAGYGFVCKGDDLLSKNRSGKALINLPENSEVMTPQVIADLDNDEILAITNQG 656

Query: 669 KLLIFSIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSYNR 721
           ++L+F I  +P++S+GKG ++          ++  +S+++       +T + +  R    
Sbjct: 657 RMLLFPIKDLPQLSKGKGNKIINIPAAKAKTREEVLSNLMVLPQGSSIT-LYAGKRKLGL 715

Query: 722 SENDLLGWLGKRGGVGSLVPKGFPR 746
             +DL  + G+RG  G+L+P+G  R
Sbjct: 716 KVSDLDNFRGERGRRGALLPRGLQR 740


>gi|271498908|ref|YP_003331933.1| DNA topoisomerase IV subunit A [Dickeya dadantii Ech586]
 gi|270342463|gb|ACZ75228.1| DNA topoisomerase IV, A subunit [Dickeya dadantii Ech586]
          Length = 758

 Score =  534 bits (1375), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 285/746 (38%), Positives = 451/746 (60%), Gaps = 22/746 (2%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           +  +  + ++L    E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL   A 
Sbjct: 4   MTHDGAERLALHTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLSASAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLGELGQGTVDYVPNFDGTLQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+E+  AA+ALID P+  +E LL ++ GPDFPT   I+  R+ I + Y  GRG  
Sbjct: 184 IPPHNVREVAAAAIALIDEPDTPLEALLRHVQGPDFPTEAEIITPRDEIRKMYESGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+   GS  +V+T +P+QV  +R++E+IA  + AK++P+L+D+RDES  +  
Sbjct: 244 RMRAVWRKED---GS--VVITSLPHQVSGARVLEQIASQMRAKKLPMLDDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+VL P++  +D D +M  +F  +D+E  + +NMN++ +   P V  L  IL EWLA R
Sbjct: 299 TRLVLVPRSNRVDLDQVMNHLFATTDLEKSYRINMNMIGLDGRPAVKGLREILTEWLAFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ + RR +FR+  + +R+ IL+GLLIA+LNIDE+I IIRNED+PKPV++++F L++ Q 
Sbjct: 359 RDTVRRRLNFRLDKVLKRLHILEGLLIAFLNIDEVIHIIRNEDEPKPVLMAKFGLSDTQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D+L  E+++I +LL S ++    +  EI+E  + +  
Sbjct: 419 EAILELKLRHLAKLEEMKIRGEQDDLAKERDQIQALLASERKMNTLLKKEIQEDAKAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E   A KA  +  +   EP+T+V+S  GW+RS K H +D S L +K G
Sbjct: 479 D-----RRSPLHERGEA-KAMSEHDLSPSEPVTIVLSEMGWVRSAKGHDIDPSGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           D+ + A    +   ++ + + G++Y L    L S RG GE +   + L     I    + 
Sbjct: 533 DAYRAAARGKSNQPVVFMDSTGRSYALDPLTLPSARGQGEPLTGKLTLPPGASIEQVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGDHVAVVGE 666
               +LL+ S  G  FI   ++++A  R GK  L +    ++   L ++   D +  +  
Sbjct: 593 ADNQRLLLASDAGYGFICTFADLVARNRVGKAVLTLPDNARVLPPLELQRDDDLLLTITA 652

Query: 667 NRKLLIFSIDQIPEMSRGKGVRLQSYKDGGIS---DVICFKIC---EGLTWIDSAGRSYN 720
             ++L+F +  +P +S+GKG ++ S     ++   D I + +    +    + +  R Y+
Sbjct: 653 AGRMLLFPVADLPALSKGKGNKIVSIPAAQLASGDDRILWLMAIAPQSSVTLYAGKRKYS 712

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPR 746
               +L  +   RG  G+ +P+G  R
Sbjct: 713 LRPEELQKYQASRGCKGTSLPRGLQR 738


>gi|227326925|ref|ZP_03830949.1| DNA topoisomerase IV subunit A [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 756

 Score =  534 bits (1375), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 285/752 (37%), Positives = 458/752 (60%), Gaps = 35/752 (4%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           +  +  ++++LR   E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A 
Sbjct: 4   MTHDGAESLALRTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNSSAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AEL+L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAELLLSELGQGTVDYTPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+E+  AA+ L++NP+ S+E+LL+++ GPDFPT   I+  R+ + + Y+ GRG  
Sbjct: 184 IPPHNVREVAAAAVMLLENPKASLEELLQHVQGPDFPTEAEIITPRDEVRKLYQNGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+       +V+T +P+QV  ++++E+IA  + AK++P++ED+RDES  +  
Sbjct: 244 RMRAVWKKED-----GDVVITALPHQVSGAKVLEQIASQMRAKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+VL P++  +D D +M  +F  +D+E  + +NMN++ +   P V  L  IL EWL  R
Sbjct: 299 TRLVLVPRSNRIDMDQVMNHLFATTDLEKSYRVNMNMIGLDGRPSVKGLVEILSEWLVFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ + RR ++R++ + +R+ IL+GLLIA+LNIDE+I IIR ED+PKPV++ +FSL+E Q 
Sbjct: 359 RDTVCRRLNYRLEKVLKRLHILEGLLIAFLNIDEVIHIIRTEDEPKPVLMRQFSLSETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D+L  E++++ +LL S ++  N I  EI+   + +  
Sbjct: 419 EAILELKLRHLAKLEEMKIRGEQDDLAKERDQLQALLASDRKLSNLIKKEIQSDAQAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E S A KA  +   +  EP+T+V+S  GW+RS K H +D + L +K G
Sbjct: 479 D-----RRSPLRERSEA-KAMSEHDFVPSEPVTIVLSEMGWVRSAKGHDIDPTGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           DS +      +   ++ + + G++Y L    L S RG GE +   +       I    + 
Sbjct: 533 DSFRAVAKGKSNQPVVFIDSTGRSYALDPITLPSARGQGEPLTGKLTPPPGATIEQVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH---VAVVG 665
                LL+ S  G  F+   ++++A  R GK  + +    K    +++ GD    +A+  
Sbjct: 593 ADDQPLLMASDAGYGFVCTFNDLVARNRAGKAIITLPDNAKALAPIEIKGDDNLLMAITA 652

Query: 666 ENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWI------DSAGRSY 719
             R +L+F +  +P++S+GKG ++ S     IS     +  + LTW+       S    +
Sbjct: 653 AGR-MLLFPVSDLPQLSKGKGNKIVS-----ISSADFAEGKDRLTWLYLLPPQASVTLYF 706

Query: 720 NRSE-----NDLLGWLGKRGGVGSLVPKGFPR 746
            + +     N+L  + G+RG  G+L+ +G  R
Sbjct: 707 GKRKLVLRPNELQKYQGERGRKGTLL-RGLQR 737


>gi|229527036|ref|ZP_04416431.1| topoisomerase IV subunit A [Vibrio cholerae 12129(1)]
 gi|229335433|gb|EEO00915.1| topoisomerase IV subunit A [Vibrio cholerae 12129(1)]
          Length = 761

 Score =  533 bits (1374), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 288/744 (38%), Positives = 454/744 (61%), Gaps = 23/744 (3%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + V+ + LR   E+ YL Y++  I +RA+P + DG KPV RRII+AMSE+GL   A +KK
Sbjct: 8   DGVEQLPLRKFTEDAYLNYSMYVIMDRALPYIGDGLKPVQRRIIYAMSELGLSASAKYKK 67

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE
Sbjct: 68  SARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTE 127

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           A++++ AE++L  + +  VD++  ++    EP + P++ P++L NG +GIAVGMAT IP 
Sbjct: 128 AKLSKFAEILLSELGQGTVDWQPNFDGTMQEPKMLPARLPHILLNGVTGIAVGMATDIPP 187

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV+E+ +A + LIDNP   +  L++Y+ GPDFPT   I+     + + YR GRG  ++R
Sbjct: 188 HNVREVADATIHLIDNPNAPLTDLMQYVKGPDFPTEAEIITPTVELEKIYRSGRGSIKMR 247

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           A WC E    GS  IV+T +P+QV  ++L+E+IA  + AK++P++ED+RDES  +   RI
Sbjct: 248 AVWCKE----GS-DIVITALPHQVSGAKLLEQIAAQMRAKKLPMVEDLRDESDHENPTRI 302

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ P++  +D DLLM  +F  +D+E  F +N+N++ +   PQV  L  IL EW++ RRE 
Sbjct: 303 VIVPRSNRVDCDLLMNHLFASTDLEKSFRVNLNMIGLDNRPQVKGLVQILSEWISFRRET 362

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           +  R  +R+  +  R+ IL+GLLIAYLN+DE+I IIRNED PK V+++RF LT+ Q DAI
Sbjct: 363 VRSRLQYRLDKVLARLHILQGLLIAYLNLDEVIEIIRNEDDPKAVLMARFDLTDLQADAI 422

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L+ +LR L KLEE +I+ E D L  E++K++ LL S ++  N +  EI+   + F     
Sbjct: 423 LDTKLRHLAKLEEMKIRGEQDELEKERKKLEELLGSERRLNNLLKKEIKADADKFGDD-- 480

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
              RR+   E   A KA  ++ ++  E ITVV+S +GWIR  K H VD  +L++K GD+ 
Sbjct: 481 ---RRSPLVEREEA-KALTERDLMPSEAITVVLSEKGWIRHAKGHDVDCQSLNYKAGDNY 536

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
                  +  + + L +DG++Y+L +  L S RG GE I   +++     I    + +  
Sbjct: 537 LTHACGKSNQQAVFLGSDGRSYSLESHTLPSARGQGEPITGRLNVAEGTTIRQVVMGEED 596

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENR 668
              LV S  G  F+ +  ++++  R GK  + +    ++   +++  +  D +  +    
Sbjct: 597 QLWLVGSDAGYGFVCKGDDLLSKNRSGKALINLPENSEVMTPQVIADLDNDEILAITNQG 656

Query: 669 KLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVIC--FKICEGLTWIDSAG-RSYNRS 722
           ++L+F I  +P++S+GKG   + + + K     +V+     + +G +    AG R     
Sbjct: 657 RMLLFPIKDLPQLSKGKGNKIINIPAAKAKTREEVLSNLMVLPQGASITLYAGKRKLGLK 716

Query: 723 ENDLLGWLGKRGGVGSLVPKGFPR 746
            +DL  + G+RG  G+L+P+G  R
Sbjct: 717 VSDLDNFRGERGRRGALLPRGLQR 740


>gi|254291774|ref|ZP_04962559.1| topoisomerase IV, subunit A [Vibrio cholerae AM-19226]
 gi|150422286|gb|EDN14248.1| topoisomerase IV, subunit A [Vibrio cholerae AM-19226]
          Length = 761

 Score =  533 bits (1374), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 285/745 (38%), Positives = 453/745 (60%), Gaps = 25/745 (3%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + V+ + LR   E+ YL Y++  I +RA+P + DG KPV RRII+AMSE+GL   A +KK
Sbjct: 8   DGVEQLPLRKFTEDAYLNYSMYVIMDRALPYIGDGLKPVQRRIIYAMSELGLSASAKYKK 67

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE
Sbjct: 68  SARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTE 127

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           A++++ AE++L  + +  VD++  ++    EP + P++ P++L NG +GIAVGMAT IP 
Sbjct: 128 AKLSKFAEILLSELGQGTVDWQPNFDGTMQEPKMLPARLPHILLNGVTGIAVGMATDIPP 187

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV+E+ +A + LIDNP   +  L++Y+ GPDFPT   I+     + + YR GRG  ++R
Sbjct: 188 HNVREVADATIHLIDNPNAPLTDLMQYVKGPDFPTEAEIITPTVDLEKIYRSGRGSIKMR 247

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           A WC E    GS  IV+T +P+QV  ++L+E+IA  + AK++P++ED+RDES  +   RI
Sbjct: 248 AVWCKE----GS-DIVITALPHQVSGAKLLEQIAAQMRAKKLPMVEDLRDESDHENPTRI 302

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ P++  +D DLLM  +F  +D+E  F +N+N++ +   PQV  L  IL EW++ RRE 
Sbjct: 303 VIVPRSNRVDCDLLMNHLFASTDLEKSFRVNLNMIGLDNRPQVKGLVQILSEWISFRRET 362

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           +  R  +R+  +  R+ IL+GLLIAYLN+DE+I IIRNED PK V+++RF LT+ Q DAI
Sbjct: 363 VRSRLQYRLDKVLARLHILQGLLIAYLNLDEVIEIIRNEDDPKAVLMARFDLTDIQADAI 422

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L+ +LR L KLEE +I+ E D L  E+ K++ LL S ++  N +  EI+   + F     
Sbjct: 423 LDTKLRHLAKLEEMKIRGEQDELEKERNKLEELLGSERRLNNLLKKEIKADADKFGDD-- 480

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
              RR+   E   A KA  ++ ++  E ITVV+S +GWIR  K H VD  +L++K GD+ 
Sbjct: 481 ---RRSPLVEREEA-KALTERDLMPSEAITVVLSEKGWIRHAKGHDVDCQSLNYKAGDNY 536

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
                  +  + + L +DG++Y+L +  L S RG GE I   +++     I    + +  
Sbjct: 537 LTHACGKSNQQAVFLGSDGRSYSLESHTLPSARGQGEPITGRLNVAEGTTIRQVVMGEED 596

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENR 668
              LV S  G  F+ +  ++++  R GK  + +    ++   +++  +  D +  +    
Sbjct: 597 QLWLVGSDAGYGFVCKGDDLLSKNRSGKALINLPENSEVMTPQVIADLDNDEILAITNQG 656

Query: 669 KLLIFSIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSYNR 721
           ++L+F I  +P++S+GKG ++          ++  +S+++       +T + +  R    
Sbjct: 657 RMLLFPIKDLPQLSKGKGNKIINIPAAKAKTREEVLSNLMVLPQGASIT-LYAGKRKLGL 715

Query: 722 SENDLLGWLGKRGGVGSLVPKGFPR 746
             +DL  + G+RG  G+L+P+G  R
Sbjct: 716 KVSDLDNFRGERGRRGALLPRGLQR 740


>gi|15642427|ref|NP_232060.1| DNA topoisomerase IV subunit A [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|147674657|ref|YP_001217931.1| DNA topoisomerase IV subunit A [Vibrio cholerae O395]
 gi|153823960|ref|ZP_01976627.1| topoisomerase IV, subunit A [Vibrio cholerae B33]
 gi|229507510|ref|ZP_04397015.1| topoisomerase IV subunit A [Vibrio cholerae BX 330286]
 gi|229512294|ref|ZP_04401773.1| topoisomerase IV subunit A [Vibrio cholerae B33]
 gi|229519431|ref|ZP_04408874.1| topoisomerase IV subunit A [Vibrio cholerae RC9]
 gi|229607016|ref|YP_002877664.1| DNA topoisomerase IV subunit A [Vibrio cholerae MJ-1236]
 gi|254849554|ref|ZP_05238904.1| topoisomerase IV [Vibrio cholerae MO10]
 gi|255746898|ref|ZP_05420843.1| topoisomerase IV subunit A [Vibrio cholera CIRS 101]
 gi|262168410|ref|ZP_06036107.1| topoisomerase IV subunit A [Vibrio cholerae RC27]
 gi|297581054|ref|ZP_06942979.1| topoisomerase IV [Vibrio cholerae RC385]
 gi|9657005|gb|AAF95573.1| topoisomerase IV, subunit A [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|126518519|gb|EAZ75742.1| topoisomerase IV, subunit A [Vibrio cholerae B33]
 gi|146316540|gb|ABQ21079.1| topoisomerase IV, subunit A [Vibrio cholerae O395]
 gi|227014322|gb|ACP10532.1| topoisomerase IV, subunit A [Vibrio cholerae O395]
 gi|229344120|gb|EEO09095.1| topoisomerase IV subunit A [Vibrio cholerae RC9]
 gi|229352259|gb|EEO17200.1| topoisomerase IV subunit A [Vibrio cholerae B33]
 gi|229355015|gb|EEO19936.1| topoisomerase IV subunit A [Vibrio cholerae BX 330286]
 gi|229369671|gb|ACQ60094.1| topoisomerase IV subunit A [Vibrio cholerae MJ-1236]
 gi|254845259|gb|EET23673.1| topoisomerase IV [Vibrio cholerae MO10]
 gi|255735300|gb|EET90700.1| topoisomerase IV subunit A [Vibrio cholera CIRS 101]
 gi|262023302|gb|EEY42006.1| topoisomerase IV subunit A [Vibrio cholerae RC27]
 gi|297534880|gb|EFH73716.1| topoisomerase IV [Vibrio cholerae RC385]
          Length = 761

 Score =  533 bits (1374), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 288/744 (38%), Positives = 454/744 (61%), Gaps = 23/744 (3%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + V+ + LR   E+ YL Y++  I +RA+P + DG KPV RRII+AMSE+GL   A +KK
Sbjct: 8   DGVEQLPLRKFTEDAYLNYSMYVIMDRALPYIGDGLKPVQRRIIYAMSELGLSASAKYKK 67

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE
Sbjct: 68  SARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTE 127

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           A++++ AE++L  + +  VD++  ++    EP + P++ P++L NG +GIAVGMAT IP 
Sbjct: 128 AKLSKFAEILLSELGQGTVDWQPNFDGTMQEPKMLPARLPHILLNGVTGIAVGMATDIPP 187

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV+E+ +A + LIDNP   +  L++Y+ GPDFPT   I+     + + YR GRG  ++R
Sbjct: 188 HNVREVADATIHLIDNPNAPLTDLMQYVKGPDFPTEAEIITPTVELEKIYRSGRGSIKMR 247

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           A WC E    GS  IV+T +P+QV  ++L+E+IA  + AK++P++ED+RDES  +   RI
Sbjct: 248 AVWCKE----GS-DIVITALPHQVSGAKLLEQIAAQMRAKKLPMVEDLRDESDHENPTRI 302

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ P++  +D DLLM  +F  +D+E  F +N+N++ +   PQV  L  IL EW++ RRE 
Sbjct: 303 VIVPRSNRVDCDLLMNHLFASTDLEKSFRVNLNMIGLDNRPQVKGLVQILSEWISFRRET 362

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           +  R  +R+  +  R+ IL+GLLIAYLN+DE+I IIRNED PK V+++RF LT+ Q DAI
Sbjct: 363 VRSRLQYRLDKVLARLHILQGLLIAYLNLDEVIEIIRNEDDPKAVLMARFDLTDIQADAI 422

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L+ +LR L KLEE +I+ E D L  E++K++ LL S ++  N +  EI+   + F     
Sbjct: 423 LDTKLRHLAKLEEMKIRGEQDELEKERKKLEELLGSERRLNNLLKKEIKADADKFGDD-- 480

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
              RR+   E   A KA  ++ ++  E ITVV+S +GWIR  K H VD  +L++K GD+ 
Sbjct: 481 ---RRSPLVEREEA-KALTERDLMPSEAITVVLSEKGWIRHAKGHDVDCQSLNYKAGDNY 536

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
                  +  + + L +DG++Y+L +  L S RG GE I   +++     I    + +  
Sbjct: 537 LTHACGKSNQQAVFLGSDGRSYSLESHTLPSARGQGEPITGRLNVAEGTTIRQVVMGEED 596

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENR 668
              LV S  G  F+ +  ++++  R GK  + +    ++   +++  +  D +  +    
Sbjct: 597 QLWLVGSDAGYGFVCKGDDLLSKNRSGKALINLPENSEVMTPQVIADLDNDEILAITNQG 656

Query: 669 KLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVIC--FKICEGLTWIDSAG-RSYNRS 722
           ++L+F I  +P++S+GKG   + + + K     +V+     + +G +    AG R     
Sbjct: 657 RMLLFPIKDLPQLSKGKGNKIINIPAAKAKTREEVLSNLMVLPQGASITLYAGKRKLGLK 716

Query: 723 ENDLLGWLGKRGGVGSLVPKGFPR 746
            +DL  + G+RG  G+L+P+G  R
Sbjct: 717 VSDLDNFRGERGRRGALLPRGLQR 740


>gi|229524415|ref|ZP_04413820.1| topoisomerase IV subunit A [Vibrio cholerae bv. albensis VL426]
 gi|229337996|gb|EEO03013.1| topoisomerase IV subunit A [Vibrio cholerae bv. albensis VL426]
          Length = 761

 Score =  533 bits (1372), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 287/744 (38%), Positives = 454/744 (61%), Gaps = 23/744 (3%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + V+ + LR   E+ YL Y++  I +RA+P + DG KPV RRII+AMSE+GL   A +KK
Sbjct: 8   DGVEQLPLRKFTEDAYLNYSMYVIMDRALPYIGDGLKPVQRRIIYAMSELGLSASAKYKK 67

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE
Sbjct: 68  SARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTE 127

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           A++++ AE++L  + +  VD++  ++    EP + P++ P++L NG +GIAVGMAT IP 
Sbjct: 128 AKLSKFAEILLSELGQGTVDWQPNFDGTMQEPKMLPARLPHILLNGVTGIAVGMATDIPP 187

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV+E+ +A + LIDNP   +  L++Y+ GPDFPT   I+     + + YR GRG  ++R
Sbjct: 188 HNVREVADATIHLIDNPNAPLTDLMQYVKGPDFPTEAEIITPTVELEKIYRSGRGSIKMR 247

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           A WC E    GS  IV+T +P+QV  ++L+E+IA  + AK++P++ED+RDES  +   RI
Sbjct: 248 AVWCKE----GS-DIVITALPHQVSGAKLLEQIAAQMRAKKLPMVEDLRDESDHENPTRI 302

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ P++  +D DLLM  +F  +D+E  F +N+N++ +   PQV  L  IL EW++ RRE 
Sbjct: 303 VIVPRSNRVDCDLLMNHLFASTDLEKSFRVNLNMIGLDNRPQVKGLVQILSEWISFRRET 362

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           +  R  +R+  +  R+ +L+GLLIAYLN+DE+I IIRNED PK V+++RF LT+ Q DAI
Sbjct: 363 VRSRLQYRLDKVLARLHVLQGLLIAYLNLDEVIEIIRNEDDPKAVLMARFDLTDIQADAI 422

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L+ +LR L KLEE +I+ E D L  E++K++ LL S ++  N +  EI+   + F     
Sbjct: 423 LDTKLRHLAKLEEMKIRGEQDELEKERKKLEELLGSERRLNNLLKKEIKADADKFGDD-- 480

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
              RR+   E   A KA  ++ ++  E ITVV+S +GWIR  K H VD  +L++K GD+ 
Sbjct: 481 ---RRSPLVEREEA-KALTERDLMPSEAITVVLSEKGWIRHAKGHDVDCQSLNYKAGDNY 536

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
                  +  + + L +DG++Y+L +  L S RG GE I   +++     I    + +  
Sbjct: 537 LTHACGKSNQQAVFLGSDGRSYSLESHTLPSARGQGEPITGRLNVAEGTTIRQVVMGEED 596

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENR 668
              LV S  G  F+ +  ++++  R GK  + +    ++   +++  +  D +  +    
Sbjct: 597 QLWLVGSDAGYGFVCKGDDLLSKNRSGKALINLPENSEVMTPQVIADLDNDEILAITNQG 656

Query: 669 KLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVIC--FKICEGLTWIDSAG-RSYNRS 722
           ++L+F I  +P++S+GKG   + + + K     +V+     + +G +    AG R     
Sbjct: 657 RMLLFPIKDLPQLSKGKGNKIINIPAAKAKTREEVLSNLMVLPQGASITLYAGKRKLGLK 716

Query: 723 ENDLLGWLGKRGGVGSLVPKGFPR 746
            +DL  + G+RG  G+L+P+G  R
Sbjct: 717 VSDLDNFRGERGRRGALLPRGLQR 740


>gi|229514056|ref|ZP_04403518.1| topoisomerase IV subunit A [Vibrio cholerae TMA 21]
 gi|229349237|gb|EEO14194.1| topoisomerase IV subunit A [Vibrio cholerae TMA 21]
          Length = 761

 Score =  533 bits (1372), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 285/745 (38%), Positives = 454/745 (60%), Gaps = 25/745 (3%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + V+ + LR   E+ YL Y++  I +RA+P + DG KPV RRII+AMSE+GL   A +KK
Sbjct: 8   DGVEQLPLRKFTEDAYLNYSMYVIMDRALPYIGDGLKPVQRRIIYAMSELGLSASAKYKK 67

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE
Sbjct: 68  SARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTE 127

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           A++++ AE++L  + +  VD++  ++    EP + P++ P++L NG +GIAVGMAT IP 
Sbjct: 128 AKLSKFAEILLSELGQGTVDWQPNFDGTMQEPKMLPARLPHILLNGVTGIAVGMATDIPP 187

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV+E+ +A + LIDNP   +  L++Y+ GPDFPT   I+     + + YR GRG  ++R
Sbjct: 188 HNVREVADATIHLIDNPNAPLTDLMQYVKGPDFPTEAEIITPTVELEKIYRSGRGSIKMR 247

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           A WC E    GS  IV+T +P+QV  ++L+E+IA  + AK++P++ED+RDES  +   RI
Sbjct: 248 AVWCKE----GS-DIVITALPHQVSGAKLLEQIAAQMRAKKLPMVEDLRDESDHENPTRI 302

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ P++  +D DLLM  +F  +D+E  F +N+N++ +   PQV  L  IL EW++ RRE 
Sbjct: 303 VIVPRSNRVDCDLLMNHLFASTDLEKSFRVNLNMIGLDNRPQVKGLVQILSEWISFRRET 362

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           +  R  +R+  +  R+ IL+GLLIAYLN+DE+I IIRNED PK V+++RF LT+ Q DAI
Sbjct: 363 VRSRLQYRLDKVLARLHILQGLLIAYLNLDEVIEIIRNEDDPKAVLMARFDLTDLQADAI 422

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L+ +LR L KLEE +I+ E D L  E++K++ LL S ++  N +  EI+   + F     
Sbjct: 423 LDTKLRHLAKLEEMKIRGEQDELERERKKLEELLGSERRLNNLLKKEIKADADKFGDD-- 480

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
              RR+   E   A KA  ++ ++  E ITVV+S +GWIR  K H VD  +L++K GD+ 
Sbjct: 481 ---RRSPLVEREEA-KALTERDLMPSEAITVVLSEKGWIRHAKGHDVDCQSLNYKAGDNY 536

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
                  +  + + L +DG++Y+L +  L S RG GE I   +++     I    + +  
Sbjct: 537 LTHACGKSNQQAVFLGSDGRSYSLESHTLPSARGQGEPITGRLNVAEGTTIRQVVMGEED 596

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENR 668
              LV S  G  F+ +  ++++  R GK  + +    ++   +++  +  D +  +    
Sbjct: 597 QLWLVGSDAGYGFVCKGDDLLSKNRSGKALINLPENSEVMTPQVIADLDNDEILAITNQG 656

Query: 669 KLLIFSIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSYNR 721
           ++L+F I  +P++S+GKG ++          ++  +S+++       +T + +  R    
Sbjct: 657 RMLLFPIKDLPQLSKGKGNKIINIPAAKAKTREEVLSNLMVLPQGASIT-LYAGKRKLGL 715

Query: 722 SENDLLGWLGKRGGVGSLVPKGFPR 746
             +DL  + G+RG  G+L+P+G  R
Sbjct: 716 KVSDLDNFRGERGRRGALLPRGLQR 740


>gi|253686737|ref|YP_003015927.1| DNA topoisomerase IV, A subunit [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251753315|gb|ACT11391.1| DNA topoisomerase IV, A subunit [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 756

 Score =  532 bits (1370), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 284/752 (37%), Positives = 458/752 (60%), Gaps = 35/752 (4%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           +  +  ++++LR   E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A 
Sbjct: 4   MTHDGAESLALRTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEILLSELGQGTVDYTPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+E+  AA+ L++NP+ S++ LL+++ GPDFPT   I+  R+ + + Y+ GRG  
Sbjct: 184 IPPHNVREVAAAAVMLLENPKASLDDLLQHVQGPDFPTEAEIITPRDEVRKLYQNGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+       +V+T +P+QV  ++++E+IA  + AK++P++ED+RDES  +  
Sbjct: 244 RMRAVWKKED-----GDVVITALPHQVSGAKVLEQIASQMRAKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+VL P++  +D D +M  +F  +D+E  + +NMN++ +   P V  L  IL EWL  R
Sbjct: 299 TRLVLVPRSNRIDMDQVMNHLFATTDLEKSYRVNMNMIGLDGRPSVKGLVEILSEWLVFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ + RR ++R++ + +R+ IL+GLLIA+LNIDE+I IIR ED+PKPV++ +FSL+E Q 
Sbjct: 359 RDTVCRRLNYRLEKVLKRLHILEGLLIAFLNIDEVIHIIRTEDEPKPVLMRQFSLSETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D+L  E++++ +LL S ++  N I  EI+   + +  
Sbjct: 419 EAILELKLRHLAKLEEMKIRGEQDDLAKERDQLQALLASDRKLSNLIKKEIQADAQTYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E S A KA  +   +  EP+T+V+S  GW+RS K H +D + L +K G
Sbjct: 479 D-----RRSPLYERSEA-KAMSEHDFVPSEPVTIVLSEMGWVRSAKGHDIDPAGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           DS + A    +   ++ + + G++Y L    L S RG GE +   +       I    + 
Sbjct: 533 DSFRAAAKGKSNQPVVFIDSTGRSYALDPITLPSARGQGEPLTGKLTPPPGATIEQVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH---VAVVG 665
                LL+ S  G  F+   ++++A  R GK  + +    K    +++ GD    +A+  
Sbjct: 593 ADDQPLLMASDAGYGFVCTFNDLVARNRAGKAIITLPDNAKALAPMEIHGDDNLLMAITA 652

Query: 666 ENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWI------DSAGRSY 719
             R +L+F +  +P++S+GKG ++ S     IS     +  + LTW+       S    +
Sbjct: 653 AGR-MLLFPVSDLPQLSKGKGNKIVS-----ISSADFAEGKDRLTWLYLLPPQASVTLYF 706

Query: 720 NRSE-----NDLLGWLGKRGGVGSLVPKGFPR 746
            + +     N+L  + G+RG  G+L+ +G  R
Sbjct: 707 GKRKLVLRPNELQKYQGERGRKGTLL-RGLQR 737


>gi|227112793|ref|ZP_03826449.1| DNA topoisomerase IV subunit A [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 756

 Score =  531 bits (1369), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 283/752 (37%), Positives = 458/752 (60%), Gaps = 35/752 (4%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           +  +  ++++LR   E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A 
Sbjct: 4   MTHDGAESLALRTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLSELGQGTVDYTPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+E+  AA+ L++NP+ S+++LL+++ GPDFPT   I+  R+ + + Y+ GRG  
Sbjct: 184 IPPHNVREVAAAAVMLLENPKASLDELLQHVQGPDFPTEAEIITPRDEVRKLYQNGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+       +V+T +P+QV  ++++E+IA  + AK++P++ED+RDES  +  
Sbjct: 244 RMRAVWKKED-----GDVVITALPHQVSGAKVLEQIASQMRAKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+VL P++  +D D +M  +F  +D+E  + +NMN++ +   P V  L  IL EWL  R
Sbjct: 299 TRLVLVPRSNRIDMDQVMNHLFATTDLEKSYRVNMNMIGLDGRPSVKGLVEILSEWLVFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ + RR ++R++ + +R+ IL+GLLIA+LNIDE+I IIR ED+PKPV++ +FSL+E Q 
Sbjct: 359 RDTVCRRLNYRLEKVLKRLHILEGLLIAFLNIDEVIHIIRTEDEPKPVLMRQFSLSETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D+L  E++++ +LL S ++  N I  EI+   + +  
Sbjct: 419 EAILELKLRHLAKLEEMKIRGEQDDLAKERDQLQALLASDRKLSNLIKKEIQADAQAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E   A KA  +   +  EP+T+V+S  GW+RS K H +D + L +K G
Sbjct: 479 E-----RRSPLHERGEA-KAMSEHDFVPSEPVTIVLSEMGWVRSAKGHDIDPAGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           DS + A    +   ++ + + G++Y L    L S RG GE +   +       I    + 
Sbjct: 533 DSFRAAAKGKSNQPVVFIDSTGRSYALDPITLPSARGQGEPLTGKLTPPPGATIEQVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH---VAVVG 665
                LL+ S  G  F+   ++++A  R GK  + +    K    +++ GD    +A+  
Sbjct: 593 ADDQPLLMASDAGYGFVCTFNDLVARNRAGKAIITLPDNAKAFAPIEIKGDDNLLMAITA 652

Query: 666 ENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWI------DSAGRSY 719
             R +L+F +  +P++S+GKG ++ S     IS     +  + LTW+       S    +
Sbjct: 653 AGR-MLLFPVSDLPQLSKGKGNKIVS-----ISSADFAEGKDRLTWLYLLPPQASVTLYF 706

Query: 720 NRSE-----NDLLGWLGKRGGVGSLVPKGFPR 746
            + +     N+L  + G+RG  G+L+ +G  R
Sbjct: 707 GKRKLVLRPNELQKYQGERGRKGTLL-RGLQR 737


>gi|332162974|ref|YP_004299551.1| DNA topoisomerase IV subunit A [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325667204|gb|ADZ43848.1| DNA topoisomerase IV subunit A [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330862272|emb|CBX72433.1| DNA topoisomerase 4 subunit A [Yersinia enterocolitica W22703]
          Length = 758

 Score =  531 bits (1367), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 288/746 (38%), Positives = 446/746 (59%), Gaps = 22/746 (2%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L  +  + + L    E  YL Y++  I +RA+P + DG KPV RRII+AMSE+GL+  A 
Sbjct: 4   LTHDGAERLPLHTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIIYAMSELGLNNSAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLGELGQGTVDWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+EI +A LALID P  S+E+LLE++ GPDFPT   I+  R  I + Y+ GRG  
Sbjct: 184 IPPHNVREIAQAVLALIDKPTSSLEELLEFVQGPDFPTEAEIITPRNEIRKIYQSGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+   GS   V+T +P+QV  ++++E+IA  + AK++P++ED+RDES  +  
Sbjct: 244 RMRALWKKED---GS--AVITALPHQVSGAKVLEQIASQMRAKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P+   +D D +M  +F  +D+E  + +NMN++ +   P V  L  IL EWL  R
Sbjct: 299 TRLVIVPRTNRVDLDQVMNHLFATTDLERSYRINMNMIGLDHRPTVKGLVEILTEWLVFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ +  R ++R++ + +R+ IL+GLLIA+LNIDE+I IIR ED+PKP+++ RF+++E Q 
Sbjct: 359 RQTVRNRLNYRLEKVLKRLHILEGLLIAFLNIDEVIHIIRTEDEPKPLLMQRFAISETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D L  E++++ +LL S ++    I  EI+     +  
Sbjct: 419 EAILELKLRHLAKLEEMKIRGEQDELAKERDQLQALLASERKLNTLIKKEIQADAAAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E   A KA  +  ++  EP+T+V+S  GW+RS K H +D S L +K G
Sbjct: 479 D-----RRSPLTEREEA-KAMSEHDIVPSEPVTIVLSEMGWVRSAKGHDIDPSGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           DS + A    +   ++ + + G++Y L    L S RG GE +   + L    +I    + 
Sbjct: 533 DSFRAAARGKSNQPVVFMDSTGRSYALDPLTLPSARGQGEPLTGKLTLPPGANIEHVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG--DHVAVVGE 666
               KLL+ S  G  F+   ++++A  R GKT + +    K    +++ G  D +  +  
Sbjct: 593 ADDQKLLMASDAGYGFVCTFNDLVAKNRAGKTMITLPENAKALPPLEIYGSDDMLLSITA 652

Query: 667 NRKLLIFSIDQIPEMSRGKGVRLQSYK----DGGISDVICFKICEGLTWI--DSAGRSYN 720
             ++L+F +  +PE+S+GKG ++ S        G   ++   +    T I      R   
Sbjct: 653 AGRMLMFPVADLPELSKGKGNKIVSIPAADAAAGKDRLVWLFVLPPQTSITLHFGKRKLT 712

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPR 746
               DL  +  +RG  GS +P+G  R
Sbjct: 713 LRPEDLQKFRAERGRKGSPLPRGLQR 738


>gi|261855829|ref|YP_003263112.1| DNA topoisomerase IV, subunit alpha [Halothiobacillus neapolitanus
           c2]
 gi|261836298|gb|ACX96065.1| DNA topoisomerase IV, A subunit [Halothiobacillus neapolitanus c2]
          Length = 758

 Score =  531 bits (1367), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 287/727 (39%), Positives = 436/727 (59%), Gaps = 20/727 (2%)

Query: 27  EERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIGKL 86
           E+ YL YA+  I +RA+P + DG KPV RRI++AMSE+GL   +  KKSAR VG+VIGK 
Sbjct: 36  EQAYLNYAMYVILDRALPSVCDGLKPVQRRIVYAMSELGLTAASKHKKSARTVGDVIGKF 95

Query: 87  HPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMTQVAELILQ 145
           HPHGD + Y+++V +AQPF  RYPLI GQGNFG+ D   S AA RYTE+R+T  A  +L 
Sbjct: 96  HPHGDSACYEAMVLMAQPFSYRYPLIDGQGNFGSPDDPKSFAAMRYTESRLTAYAHSLLA 155

Query: 146 GVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAALA 205
             ++  VD++  ++    EP + P++ PN+L NG  GIAVG++T IP HN++E+  A +A
Sbjct: 156 EAEQGTVDWQPNFDGTLEEPTLLPARLPNVLLNGGMGIAVGLSTDIPPHNLREVVAATIA 215

Query: 206 LIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRGS 265
           L+D PE +++ L  ++ GPDFPT   I+   + I++ YR G G  R RAR+ VE+     
Sbjct: 216 LLDEPESTVDDLCRHLRGPDFPTEAEIITPPDEIMQMYRTGTGSVRQRARYEVEQ----- 270

Query: 266 WCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIVLFPKNRSLDPD 323
             I++T +P+QV  S+++E+IA  + AK++PL+ D+RDES  +   R+V+ P++R +D +
Sbjct: 271 GEIIITALPFQVSGSKILEQIAAQMNAKKLPLVTDLRDESDHEAPTRLVIIPRSRQVDAE 330

Query: 324 LLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAI 383
            LM  +F  +D+E  + +NMNV+++   P+VM L  +L EWL  RR+ L RR  +R+  +
Sbjct: 331 ALMAHLFATTDLEKSYRVNMNVIALDGRPRVMNLKDLLSEWLQFRRQTLTRRIQWRLAKV 390

Query: 384 DRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLE 443
           + R+EIL GLLIA+LNIDE+IA+IR  D+PK  +++RF LTE Q +AIL +RLR L KLE
Sbjct: 391 ENRLEILAGLLIAFLNIDEVIAVIREADEPKAELIARFDLTERQAEAILEIRLRQLAKLE 450

Query: 444 EYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVS 503
           E  IK E   L+AE E +  LL    +  N +  E+++  + +  +     RR+    V+
Sbjct: 451 EIAIKKEQGELMAESEILRGLLADESRLRNLLRDELQDDAQKYGDA-----RRSRL--VT 503

Query: 504 R-ADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDR 562
           R A +A  + A+I  EP+TVV+S  GWIR+ K H VD  AL +K GD   + ++  +T  
Sbjct: 504 RGAAQALAETALISSEPVTVVLSKNGWIRAAKGHDVDPVALSYKAGDGYLVHMNGKSTQS 563

Query: 563 ILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGN 622
           ++LL   G+AYTL A +L S RG GE +   +            + D    +L+  S G 
Sbjct: 564 VILLDDTGRAYTLAAHSLPSARGQGEPLTGRLSPPTGAQFNQMVMADDKDAVLLWQSGGY 623

Query: 623 AFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG--DHVAVVGENRKLLIFSIDQIPE 680
            FI    E+++  R GK  + +     +   +++      +A    +  +LI    +IP+
Sbjct: 624 GFITPFEELLSRQRAGKVMVSLQDGATLGAPIRLDDQVQRIAFASSDGHVLILERAEIPQ 683

Query: 681 MSRGKGVRLQSYKDGGISDVICFKI-CEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSL 739
           +S+G+G +L   K G      C  +  EGL  + S  RS    + D   + G R   G +
Sbjct: 684 LSKGRGNKLMGLKSGFTLIAACALVEGEGLK-VQSGARSVTLRDVDFDNYGGARASRGRI 742

Query: 740 VPKGFPR 746
           +P+GF R
Sbjct: 743 LPRGFQR 749


>gi|192362361|ref|YP_001983586.1| DNA topoisomerase IV subunit A [Cellvibrio japonicus Ueda107]
 gi|190688526|gb|ACE86204.1| DNA topoisomerase IV, A subunit [Cellvibrio japonicus Ueda107]
          Length = 752

 Score =  530 bits (1366), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 281/743 (37%), Positives = 452/743 (60%), Gaps = 23/743 (3%)

Query: 20  VSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIV 79
           +SL+   E+ YL Y++  I +RA+P + DG KPV RRI++AMSE+GL   A +KKSAR V
Sbjct: 14  ISLKDYTEKAYLDYSMYVILDRALPHIGDGLKPVQRRIVYAMSELGLKASAKYKKSARTV 73

Query: 80  GEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMTQ 138
           G+VIGK HPHGD + Y+++V +AQPF  RY L+ GQGN+G+ D   S AA RYTE+R+T+
Sbjct: 74  GDVIGKFHPHGDSAAYEAMVLMAQPFSYRYTLVDGQGNWGSPDDPKSFAAMRYTESRLTK 133

Query: 139 VAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQE 198
            +E++L  + +  VD++  ++    EP VFP++ PNLL NGT+GIAVGMAT IP HN++E
Sbjct: 134 YSEVLLDELGQGTVDWQPNFDGTLDEPTVFPARVPNLLLNGTTGIAVGMATDIPPHNLRE 193

Query: 199 ICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCV 258
           +  A + L+DNP+ S+  L ++++GPD PT   I+  R+ +++ Y  GRG  R+RA W  
Sbjct: 194 VVNACVHLLDNPQASVTDLCQFVLGPDMPTEAEIISPRDELIKMYETGRGSVRMRAVWQK 253

Query: 259 EEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIVLFPK 316
           +E    S  IV+T +P+QV  ++++E+IA  + AK++P++ D+RDES  +   R+V+ P+
Sbjct: 254 DE---ESGDIVITALPHQVSGAKILEQIAAQMQAKKLPMVADLRDESDHENPTRLVVVPR 310

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           +  +D + +M+ +F  +++E  + +NMNV+ +   P V  L  IL EWL+ R     RR 
Sbjct: 311 SNRVDLEQVMQHLFATTELERTYRVNMNVIGIDGRPAVKSLSKILGEWLSFRTVTTRRRL 370

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
            +R+  ++RR+ +L+GLLIA+LN+DE+I IIR ED PK  ++ RF LTE+Q + IL  +L
Sbjct: 371 QYRLDKVERRLHLLQGLLIAFLNLDEVIRIIREEDDPKAELMKRFGLTEDQTEYILETKL 430

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           R L +LEE +I+ E  +L  E++++ S+L S  +  N +  E+ +  E +        RR
Sbjct: 431 RQLARLEEMKIRGEQSDLEKERDQLQSVLGSAVKLKNLVRKELLQAAEQYGDD-----RR 485

Query: 497 TTFCEVSRADKATLQQA-MIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           +    V RA+   L +  ++  EPITVVIS++GWIRS K H +D + L +K GDS K A+
Sbjct: 486 SPI--VVRAEAQALSETELMSVEPITVVISDKGWIRSAKGHDIDPTGLSYKAGDSFKFAV 543

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
           H  +   ++LL + G++Y +PA NL S RG GE +   I+           +     ++L
Sbjct: 544 HGKSNQNVILLDSTGRSYAIPAHNLPSARGQGEPLSGRINPPSGATFEGVLMGADDQRVL 603

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENRKLLI 672
           + S  G  FI +  ++ +  + GK  L +    ++   +L+       +A V  + +LL+
Sbjct: 604 LASDAGYGFIAKLDDLASKNKSGKALLTLPDNAQVLPPQLINDPAQALLAAVSNDGRLLV 663

Query: 673 FSIDQIPEMSRGKGVRLQSYKDGGISD-----VICFKICEG-LTWIDSAGRSYNRSENDL 726
           F + ++PE++RGKG ++ +      +      V    I  G +  + S  R+      DL
Sbjct: 664 FPVTELPELARGKGNKIMNIPSARAAAREEFVVAVSVILPGQVLTLYSGKRTITLKLGDL 723

Query: 727 LGWLGKRGGVGSLVPKGFPRSGK 749
             + G+RG  G+ +P+GF +  K
Sbjct: 724 EHYKGERGRRGNKLPRGFQKVDK 746


>gi|123443841|ref|YP_001007812.1| DNA topoisomerase IV subunit A [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122090802|emb|CAL13684.1| DNA topoisomerase IV subunit A [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 758

 Score =  530 bits (1366), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 290/747 (38%), Positives = 448/747 (59%), Gaps = 24/747 (3%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L  +  + + L    E  YL Y++  I +RA+P + DG KPV RRII+AMSE+GL+  A 
Sbjct: 4   LTHDGAERLPLHTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIIYAMSELGLNNSAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLGELGQGTVDWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+EI +A LALID P  S+E+LLE++ GPDFPT   I+  R  I + Y+ GRG  
Sbjct: 184 IPPHNVREIAQAVLALIDKPTSSLEELLEFVQGPDFPTEAEIITPRNEIRKIYQSGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+   GS   V+T +P+QV  ++++E+IA  + AK++P++ED+RDES  +  
Sbjct: 244 RMRALWKKED---GS--AVITALPHQVSGAKVLEQIASQMRAKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P+   +D D +M  +F  +D+E  + +NMN++ +   P V  L  IL EWL  R
Sbjct: 299 TRLVIVPRTNRVDLDQVMNHLFATTDLERSYRINMNMIGLDHRPTVKGLVEILTEWLVFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ +  R ++R++ + +R+ IL+GLLIA+LNIDE+I IIR ED+PKP+++ RF+++E Q 
Sbjct: 359 RQTVRNRLNYRLEKVLKRLHILEGLLIAFLNIDEVIHIIRTEDEPKPLLMQRFAISETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D L  E++++ +LL S ++    I       KEI + 
Sbjct: 419 EAILELKLRHLAKLEEMKIRGEQDELAKERDQLQALLASERKLNTLIK------KEILAD 472

Query: 489 STDLG-RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKE 547
           +   G  RR+   E   A KA  +  ++  EP+T+V+S  GW+RS K H +D S L +K 
Sbjct: 473 AAAYGDDRRSPLTEREEA-KAMSEHDIVPSEPVTIVLSEMGWVRSAKGHDIDPSGLSYKA 531

Query: 548 GDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFV 607
           GDS + A    +   ++ + + G++Y L    L S RG GE +   + L    +I    +
Sbjct: 532 GDSFRAAACGKSNQPVVFMDSTGRSYALDPLTLPSARGQGEPLTGKLTLPPGANIEHVLM 591

Query: 608 YDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG--DHVAVVG 665
                KLL+ S  G  F+   ++++A  R GKT + +    K    +++ G  D +  + 
Sbjct: 592 AADDQKLLMASDAGYGFVCTFNDLVAKNRAGKTMITLPENAKALPPLEIYGPDDMLLSIT 651

Query: 666 ENRKLLIFSIDQIPEMSRGKGVRLQSYKDG----GISDVICFKICEGLTWI--DSAGRSY 719
              ++L+F +  +PE+S+GKG ++ S        G   ++   +    T I      R  
Sbjct: 652 AAGRMLMFPVADLPELSKGKGNKIVSIPAADAATGKDRLVWLFVLPPQTSITLHFGKRKL 711

Query: 720 NRSENDLLGWLGKRGGVGSLVPKGFPR 746
                DL  +  +RG  GS +P+G  R
Sbjct: 712 TLRPEDLQKFRAERGRKGSPLPRGLQR 738


>gi|94500373|ref|ZP_01306905.1| DNA topoisomerase IV subunit A [Oceanobacter sp. RED65]
 gi|94427408|gb|EAT12386.1| DNA topoisomerase IV subunit A [Oceanobacter sp. RED65]
          Length = 748

 Score =  530 bits (1366), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 285/746 (38%), Positives = 452/746 (60%), Gaps = 21/746 (2%)

Query: 8   NSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLD 67
           N   + E+ V+  SLR   E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL 
Sbjct: 2   NDIVIGEDGVERQSLRDYTENAYLNYSMYVIMDRALPHIGDGLKPVQRRIVYAMSELGLK 61

Query: 68  FGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSA 126
            G+ +KKSAR VG+VIGK HPHGD + Y+++V +AQ F  RYPL+ GQGN+G+ D   S 
Sbjct: 62  AGSKYKKSARTVGDVIGKFHPHGDSACYEAMVLMAQSFSYRYPLVDGQGNWGSPDDPKSF 121

Query: 127 AAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVG 186
           AA RYTE+++T+ AE++L  + +  VD++  ++    EP   PS+ PN+L NGT+GIAVG
Sbjct: 122 AAMRYTESKLTKYAEVLLSELGQGTVDWQPNFDGTMDEPCTLPSRLPNVLLNGTTGIAVG 181

Query: 187 MATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLG 246
           MAT IP HN++E+  A + ++DNP+   E+LL+YI GPDFPT   I+  +  + + Y  G
Sbjct: 182 MATDIPQHNLREVANACIHMLDNPKADTEELLQYIPGPDFPTDAEIITPKADLQKMYHSG 241

Query: 247 RGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESA 306
           RG  ++RA +  E+       IV+T +P+Q   ++++E+IA+ +  K++P++ D+RDES 
Sbjct: 242 RGSVKMRAVYTRED-----GDIVITALPHQASGAKVLEQIADQMQKKKLPMVSDLRDESD 296

Query: 307 ED--VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEW 364
            +   R+V+ PK+  +D + LM  +F  +D+E  + +N+N++ +  +PQV  LD I+KEW
Sbjct: 297 HENPTRLVITPKSNRVDVNQLMSHLFATTDLEKSYRVNLNMIGIDGLPQVKSLDMIIKEW 356

Query: 365 LAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLT 424
           L +R   + RR   R+  +  R+ IL GLL+A+LNIDE+I IIR+ED+PK  ++ RF L+
Sbjct: 357 LEYRITTVRRRLQHRLDKVLARLHILDGLLVAFLNIDEVIEIIRHEDEPKQELIKRFGLS 416

Query: 425 ENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKE 484
           + Q +AIL L+LR L KLEE +IK E D L  E+++++  L S ++    +  EI    E
Sbjct: 417 DKQAEAILELKLRHLAKLEEMKIKGEQDELSKERDQLEKTLGSERRLKTLVKKEITADAE 476

Query: 485 IFSKSTDLGRRRTTFCEVSRADKATLQQA-MIEKEPITVVISNRGWIRSLKSHSVDLSAL 543
            +        RR+    VSR +   L +  ++  +P+TVV+S +GWIR+ K H VD + L
Sbjct: 477 TYGDD-----RRSPI--VSRDEAQALSEIDLMGADPVTVVMSEKGWIRAAKGHDVDGTGL 529

Query: 544 HFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIV 603
            +K GD   I  +A T  + + L T G+AY++    L   RG+GE +   I+L   Q I 
Sbjct: 530 QYKSGDKFLIQANAKTNQQAIFLDTGGRAYSVNIHGLPGARGYGEPVTGSINLASGQKIS 589

Query: 604 TAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG---DH 660
           T  +     + L+ S  G  FI +  ++++  + GK  L    ++ +   VKV+    D 
Sbjct: 590 TMVIGQPKDQYLMASEAGYGFITQYEDMVSKNKAGKALLNKPDDKAIHSPVKVSDVEQDW 649

Query: 661 VAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKIC-EGLTWIDSAGRSY 719
           V  V    +LL F +  +P M++GKG ++ +    G   +I   +  EG   I +AG+ +
Sbjct: 650 VVAVSNEGRLLTFPVADLPVMAKGKGNKIINLGTSGDEVLIGISLMKEGDMLIVNAGKRH 709

Query: 720 NRSE-NDLLGWLGKRGGVGSLVPKGF 744
            + + +DL  + G+RG  G+ +P+GF
Sbjct: 710 VKMKFSDLEHYQGERGRRGNKLPRGF 735


>gi|318604202|emb|CBY25700.1| topoisomerase IV subunit A [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 758

 Score =  530 bits (1365), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 288/746 (38%), Positives = 446/746 (59%), Gaps = 22/746 (2%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L  +  + + L    E  YL Y++  I +RA+P + DG KPV RRII+AMSE+GL+  A 
Sbjct: 4   LTHDGAERLPLHTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIIYAMSELGLNNSAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLGELGQGTVDWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+EI +A LALID P  S+E+LLE++ GPDFPT   I+  R  I + Y+ GRG  
Sbjct: 184 IPPHNVREIAQAVLALIDKPTSSLEELLEFVQGPDFPTEAEIITPRNEIRKIYQSGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+   GS   V+T +P+QV  ++++E+IA  + AK++P++ED+RDES  +  
Sbjct: 244 RMRALWKKED---GS--AVITALPHQVSGAKVLEQIASQMRAKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P+   +D D +M  +F  +D+E  + +NMN++ +   P V  L  IL EWL  R
Sbjct: 299 TRLVIVPRTNRVDLDQVMNHLFATTDLERSYRINMNMIGLDHRPTVKGLVEILTEWLVFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ +  R ++R++ + +R+ IL+GLLIA+LNIDE+I IIR ED+PKP+++ RF+++E Q 
Sbjct: 359 RQTVRNRLNYRLEKVLKRLHILEGLLIAFLNIDEVIHIIRTEDEPKPLLMQRFAISETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D L  E++++ +LL S ++    I  EI+     +  
Sbjct: 419 EAILELKLRHLAKLEEMKIRGEQDELAKERDQLQALLASERKLNTLIKKEIQADAAAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E   A KA  +  ++  EP+T+V+S  GW+RS K H +D S L +K G
Sbjct: 479 D-----RRSPLTEREEA-KAMSEHDIVPSEPVTIVLSEMGWVRSAKGHDIDPSGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           DS + A    +   ++ + + G++Y L    L S RG GE +   + L    +I    + 
Sbjct: 533 DSFRAAARGKSNQPVVFMDSTGRSYALDPLTLPSARGQGEPLTGKLTLPPGANIEHVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG--DHVAVVGE 666
               KLL+ S  G  F+   ++++A  R GKT + +    K    +++ G  D +  +  
Sbjct: 593 ADDQKLLMASDVGYGFVCTFNDLVAKNRAGKTMITLPENAKALPPLEIYGSDDMLLSITA 652

Query: 667 NRKLLIFSIDQIPEMSRGKGVRLQSYK----DGGISDVICFKICEGLTWI--DSAGRSYN 720
             ++L+F +  +PE+S+GKG ++ S        G   ++   +    T I      R   
Sbjct: 653 AGRMLMFPVADLPELSKGKGNKIVSIPAADAAAGKDRLVWLFVLPPQTSITLHFGKRKLT 712

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPR 746
               DL  +  +RG  GS +P+G  R
Sbjct: 713 LRPEDLQKFRAERGRKGSPLPRGLQR 738


>gi|261819693|ref|YP_003257799.1| DNA topoisomerase IV subunit A [Pectobacterium wasabiae WPP163]
 gi|261603706|gb|ACX86192.1| DNA topoisomerase IV, A subunit [Pectobacterium wasabiae WPP163]
          Length = 756

 Score =  530 bits (1365), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 283/752 (37%), Positives = 458/752 (60%), Gaps = 35/752 (4%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           +  +  ++++LR   E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A 
Sbjct: 4   MTHDGAESLALRTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLSELGQGTVDYTPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+EI  AA+ L++NP+ S++ LL+++ GPDFPT   I+  R+ + + Y+ GRG  
Sbjct: 184 IPPHNVREIAAAAVMLLENPKASLDDLLQHVQGPDFPTEAEIITPRDEVRKLYQNGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+       +V+T +P+QV  ++++E+IA  + AK++P++ED+RDES  +  
Sbjct: 244 RMRAVWKKED-----GDVVITALPHQVSGAKVLEQIASQMRAKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+VL P++  +D D +M  +F  +D+E  + +NMN++ +   P V  L  IL EWL  R
Sbjct: 299 TRLVLVPRSNRIDMDQVMNHLFATTDLEKSYRVNMNMIGLDGRPSVKGLVEILSEWLVFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ + RR ++R++ + +R+ IL+GLLIA+LNIDE+I IIR ED+PKPV++ +FSL+E Q 
Sbjct: 359 RDTVCRRLNYRLEKVLKRLHILEGLLIAFLNIDEVIHIIRTEDEPKPVLMRQFSLSETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D+L  E++++ +LL S ++  N I  EI+   + +  
Sbjct: 419 EAILELKLRHLAKLEEMKIRGEQDDLAKERDQLQALLASERKLSNLIKKEIQSDAQAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E S + KA  +   +  EP+T+V+S  GW+RS K H +D + L +K G
Sbjct: 479 D-----RRSPLHERSES-KAMSEHDFVPSEPVTIVLSEMGWVRSAKGHDIDPTGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           DS +      +   ++ + + G++Y L   +L S RG GE +   +       I    + 
Sbjct: 533 DSFRAVAKGKSNQPVVFIDSTGRSYALDPISLPSARGQGEPLTGKLTPPPGATIEQVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH---VAVVG 665
                LL+ S  G  F+   ++++A  R GK  + +    K    +++ GD    +A+  
Sbjct: 593 ADDQPLLMASDAGYGFVCTFNDLVARNRAGKAIITLPDNAKALTPIEIKGDDNLLMAITA 652

Query: 666 ENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWI------DSAGRSY 719
             R +L+F +  +P++S+GKG ++ S     IS     +  + LTW+       S    +
Sbjct: 653 AGR-MLLFPVSDLPQLSKGKGNKIVS-----ISSADFAEGKDRLTWLYLLPPQASVTLYF 706

Query: 720 NRSE-----NDLLGWLGKRGGVGSLVPKGFPR 746
            + +     N+L  + G+RG  G+L+ +G  R
Sbjct: 707 GKRKLVLRPNELQKYQGERGRKGTLL-RGLQR 737


>gi|83648063|ref|YP_436498.1| DNA topoisomerase IV subunit A [Hahella chejuensis KCTC 2396]
 gi|83636106|gb|ABC32073.1| DNA topoisomerase IV, A subunit [Hahella chejuensis KCTC 2396]
          Length = 759

 Score =  530 bits (1365), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 276/749 (36%), Positives = 455/749 (60%), Gaps = 23/749 (3%)

Query: 10  NTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFG 69
           + + EE ++   L+   E+ YL Y++  I +RA+P + DG KPV RRI++AMSE+GL   
Sbjct: 2   SMMFEEGIERRPLKEYTEKAYLDYSMYVILDRALPHIGDGLKPVQRRIVYAMSELGLSAA 61

Query: 70  AAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAA 128
           A  KKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPLI GQGN+G+ D   S AA
Sbjct: 62  AKHKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYPLIDGQGNWGSADDPKSFAA 121

Query: 129 YRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMA 188
            RYTEAR+ + AE++L  + +  VD+   ++    EP + P++ PNLL NGT+GIAVGMA
Sbjct: 122 MRYTEARLAKYAEVLLSEIGQGTVDWVPNFDGSLDEPSLLPARLPNLLLNGTTGIAVGMA 181

Query: 189 TSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRG 248
           T IP HN++E+ +A + ++D+P+ ++E+L EYI GPDFP+GG IV SR  + + Y  GRG
Sbjct: 182 TDIPPHNLREVTQACIHMLDHPKATVEELCEYIEGPDFPSGGEIVTSRSDLRQIYETGRG 241

Query: 249 GFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED 308
             ++RA++  E        IVVTE+P+QV  +R++E+IA+ + AK++P++ D+RDES  +
Sbjct: 242 SVKMRAKYTKE-----GQDIVVTELPHQVSGARIMEQIAQQMQAKKLPMVADLRDESDHE 296

Query: 309 --VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLA 366
              R+V+ P++  +D + LM  +F  +D+E  + +N+NV+ +   P V  L  +L+EWL 
Sbjct: 297 NPTRLVIIPRSNRIDAEPLMAHLFATTDLEKNYRVNLNVVGLDGRPAVKDLRVLLQEWLT 356

Query: 367 HRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTEN 426
            R + + RR  +R+Q +  R+ IL+GLL+A+LNIDE+IAIIR+EDKPKPV++ RF L++ 
Sbjct: 357 FRTQTVRRRLEYRLQKVLARLHILEGLLVAFLNIDEVIAIIRSEDKPKPVLMERFGLSDV 416

Query: 427 QVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIF 486
           Q + +L+ +LR L +LEE +I++E D L  E++K++ +L S  +    +  E+++  E F
Sbjct: 417 QAEYVLDTKLRQLARLEEMKIRAEQDELEKERKKLEDILGSEAKLRKLVKTELKQDMETF 476

Query: 487 SKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFK 546
                   RR+   E   A +A  +  +I  EP+TVV+S +GW+R+ K H +D   L +K
Sbjct: 477 GDE-----RRSPIVERKEA-QAFSETDLIASEPVTVVLSEKGWVRAAKGHDIDAQGLSYK 530

Query: 547 EGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAF 606
            GD    A    +    + L   G++Y + A +L S RG GE +   ++           
Sbjct: 531 AGDKFLAAAKGRSHQNAIFLDDTGRSYCVAAHSLPSARGQGEPLTGRVNPPSGAGFTHVL 590

Query: 607 VYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMK---LVVKVTGDHVAV 663
           +   + K+++ S  G  F+    ++ +  R GK  + +     +    L+ +    H+  
Sbjct: 591 MGPDSMKVVLASDAGYGFVARLEDLQSKNRAGKALISLPKGACVSPPILLERQNNPHLVA 650

Query: 664 VGENRKLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVIC--FKICEGLTWIDSAGRS 718
           +    ++L+F + ++PE+++GKG   + + S +     +V+     + E  T +  AG+ 
Sbjct: 651 ISNEGRMLVFPVSELPELAKGKGNKIIGIPSARAQAREEVMSNLAVVGEKDTLVLHAGKR 710

Query: 719 YNR-SENDLLGWLGKRGGVGSLVPKGFPR 746
           + + + +DL  +LG+RG  G  +P+G  R
Sbjct: 711 FLKLTFDDLSHYLGERGRRGHKLPRGLQR 739


>gi|307129113|ref|YP_003881129.1| Topoisomerase IV subunit A [Dickeya dadantii 3937]
 gi|306526642|gb|ADM96572.1| Topoisomerase IV subunit A [Dickeya dadantii 3937]
          Length = 758

 Score =  529 bits (1363), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 287/746 (38%), Positives = 452/746 (60%), Gaps = 22/746 (2%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           +  +  + ++L    E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL   A 
Sbjct: 4   MTHDGAERLALHTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLSASAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLGELGQGTVDYVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+E+  AA+ALID P+  ++ LL Y+ GPDFPT   I+  R+ I + Y  GRG  
Sbjct: 184 IPPHNVREVAAAAVALIDEPDTQLDALLRYVQGPDFPTEAEIITPRDEIRKMYESGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+   GS  +V+T +P+QV  +R++E+IA  + AK++P+++D+RDES  +  
Sbjct: 244 RMRAVWKKED---GS--VVITALPHQVSGARVLEQIASQMRAKKLPMIDDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+VL P++  +D DL+M  +F  +D+E  + +NMN++ +   P V  L  IL EWLA R
Sbjct: 299 TRLVLVPRSNRIDLDLVMNHLFATTDLEKSYRINMNMIGLDGRPSVKGLREILTEWLAFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ + RR +FR+  + +R+ IL+GLLIA+LNIDE+I IIRNED+PKPV++++F L++ Q 
Sbjct: 359 RDTVRRRLNFRLDKVLKRLHILEGLLIAFLNIDEVIHIIRNEDEPKPVLMAKFGLSDTQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D+L  E+++I +LL S ++  + +  EI+E  + +  
Sbjct: 419 EAILELKLRHLAKLEEMKIRGEQDDLAKERDQIQALLASERKMNSLLKKEIQEDAKAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E   A KA  +  +   EP+T+V+S  GW+RS K H +D S L +K G
Sbjct: 479 E-----RRSPLHERGEA-KAMSEHDLSPSEPVTIVLSEMGWVRSAKGHDIDPSGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           D+ + A    +   ++ + + G++Y L    L S RG GE +   + L     I    + 
Sbjct: 533 DAYRAAARGKSNQPVVFMDSTGRSYALDPLTLPSARGQGEPLTGKLTLPPGATIEQVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGDHVAVVGE 666
               +LL+ S  G  FI   ++++A  R GK  L +     +   L ++   D +  V  
Sbjct: 593 ADNQRLLLASDAGYGFICTFADLVARNRVGKAVLTLPDNAHVLPPLELQRDDDLLLTVTA 652

Query: 667 NRKLLIFSIDQIPEMSRGKGVRLQSYKDGGIS---DVICFKIC---EGLTWIDSAGRSYN 720
             ++L+F +  +PE+S+GKG ++ S     ++   D I + +         + +  R Y+
Sbjct: 653 AGRMLLFPVADLPELSKGKGNKIVSIPAAQLASGDDRILWLLAIAPHSSVTLYAGKRKYS 712

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPR 746
               +L  +   RG  G+ +P+G  R
Sbjct: 713 LRPEELQKYQASRGCKGTALPRGLQR 738


>gi|261211526|ref|ZP_05925814.1| topoisomerase IV subunit A [Vibrio sp. RC341]
 gi|260839481|gb|EEX66107.1| topoisomerase IV subunit A [Vibrio sp. RC341]
          Length = 761

 Score =  528 bits (1361), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 284/745 (38%), Positives = 452/745 (60%), Gaps = 25/745 (3%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + V+ + LR   E+ YL Y++  I +RA+P + DG KPV RRII+AMSE+GL   A +KK
Sbjct: 8   DGVEQLPLRKFTEDAYLNYSMYVIMDRALPYIGDGLKPVQRRIIYAMSELGLSASAKYKK 67

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE
Sbjct: 68  SARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTE 127

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           A++++ AE++L  + +  VD++  ++    EP + P++ P++L NG +GIAVGMAT IP 
Sbjct: 128 AKLSKFAEILLSELGQGTVDWQPNFDGTMQEPKMLPARLPHILLNGVTGIAVGMATDIPP 187

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV+E+ EA + LID+P   +  L++Y+ GPDFPT   I+     + + YR GRG  R+R
Sbjct: 188 HNVREVAEATIHLIDHPSAPLTDLMQYVKGPDFPTEAEIITPTVELEKIYRSGRGSVRMR 247

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           A WC E    GS  IV+T +P+QV  ++L+E+IA  + AK++P++ED+RDES  +   RI
Sbjct: 248 AVWCKE----GS-DIVITALPHQVSGAKLLEQIAAQMRAKKLPMVEDLRDESDHENPTRI 302

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ P++  +D DLLM  +F  +D+E  F +N+N++ +   PQV  L  IL EW+  RRE 
Sbjct: 303 VIVPRSNRVDCDLLMNHLFASTDLEKSFRVNLNMIGLDNRPQVKGLVQILSEWITFRRET 362

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           +  R  +R+  +  R+ +L+GLLIAYLN+DE+I IIR ED PK V+++RF+LT+ Q DAI
Sbjct: 363 VRSRLQYRLDKVLARLHVLQGLLIAYLNLDEVIEIIRTEDDPKAVLMARFNLTDIQADAI 422

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L+ +LR L KLEE +I+ E D L  E++K++ LL S ++  N +  EI+   + F     
Sbjct: 423 LDTKLRHLAKLEEMKIRGEQDELEKERKKLEELLGSERRLNNLLKKEIKADADKFGDD-- 480

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
              RR+   E   A KA  ++ ++  E ITVV+S +GWIR  K H VD  +L +K GD+ 
Sbjct: 481 ---RRSPLVEREEA-KALTERDLMPSEAITVVLSEKGWIRHAKGHDVDGQSLSYKAGDNY 536

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
                  +  + + L +DG++Y+L +  L S RG GE I   +++     I    + +  
Sbjct: 537 LTHACGKSNQQAVFLGSDGRSYSLESHTLPSARGQGEPITGRLNVAEGTTIRQVVMGEED 596

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENR 668
              LV S  G  F+ +  ++++  R GK  + +    ++   +++  +  D +  +    
Sbjct: 597 QLWLVGSDAGYGFVCKGDDLLSKNRSGKALINLPENSEVMTPQVIADLDKDEILAITNQG 656

Query: 669 KLLIFSIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSYNR 721
           ++L+F I  +P++S+GKG ++          ++  +S+++       +T + +  R    
Sbjct: 657 RMLLFPIKDLPQLSKGKGNKIINIPAAKAKTREEVLSNLMVLPQGASIT-LYAGKRKLGL 715

Query: 722 SENDLLGWLGKRGGVGSLVPKGFPR 746
             +DL  + G+RG  G+L+P+G  R
Sbjct: 716 KVSDLDNFRGERGRRGALLPRGLQR 740


>gi|254522337|ref|ZP_05134392.1| DNA topoisomerase IV, A subunit [Stenotrophomonas sp. SKA14]
 gi|219719928|gb|EED38453.1| DNA topoisomerase IV, A subunit [Stenotrophomonas sp. SKA14]
          Length = 747

 Score =  528 bits (1361), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 285/735 (38%), Positives = 440/735 (59%), Gaps = 21/735 (2%)

Query: 20  VSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIV 79
           + LR   E  YL Y++  + +RA+P + DG KPV RRII++MSE+GL+  +  KKSAR V
Sbjct: 15  LPLREYAERAYLDYSMYVVLDRALPFIGDGLKPVQRRIIYSMSELGLNAASKPKKSARTV 74

Query: 80  GEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMTQ 138
           G+VIGK HPHGD + Y++LV +AQPF  RYPLI GQGNFG+ D   S AA RYTE+++T 
Sbjct: 75  GDVIGKYHPHGDSACYEALVLMAQPFSYRYPLIEGQGNFGSSDDPKSFAAMRYTESKLTP 134

Query: 139 VAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQE 198
           +AE++L  + +   D+   ++    EP   P++ P+LL NGT+GIAVGMAT +P HN+ E
Sbjct: 135 IAEVLLGELGQGTTDWAPNFDGTLQEPTWMPARLPHLLLNGTTGIAVGMATDVPPHNLNE 194

Query: 199 ICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCV 258
           I  A L L+DNPE S+  L E++ GPD+P+   I+ +   +   Y  G G  R RA +  
Sbjct: 195 IVSALLHLLDNPEASVRDLCEHVQGPDYPSSAEIITAASDLRNMYETGNGSVRARATFTK 254

Query: 259 EEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDES--AEDVRIVLFPK 316
           E     +  IVVT +P+QV  S++IE+IA  + AK++P LEDIRDES  A  VR+VL P+
Sbjct: 255 E-----ANNIVVTALPFQVSPSKVIEQIAAQMRAKKLPWLEDIRDESDHANPVRVVLVPR 309

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           +  +D + LM  +F  +DME  + +N+NV+ +   PQV  L  +L EWL  R   + RR 
Sbjct: 310 SNRVDAEQLMGHLFATTDMERSYRVNLNVIGLDGRPQVKNLKMLLSEWLTFRSNTVTRRL 369

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
             R+Q ++RR+ +L+GLL+A+LN+DE+I IIR ED+PK  +++RF L+++Q + IL  +L
Sbjct: 370 QHRLQKVERRLHLLEGLLVAFLNLDEVIHIIRTEDEPKAALIARFGLSDDQAEYILETKL 429

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           + L +LEE +I+ E D L  E+EKI  +L+S K +  ++   IR+  E+ + +   G  R
Sbjct: 430 KQLARLEEMKIRGEQDELAKEREKILGILDS-KAKLKKL---IRD--ELTADAKKFGDAR 483

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
            +     +A +A  +  ++  EP+TVV+S +GWIR+ K H VD SAL +++GD+L+ A+ 
Sbjct: 484 RSPLVQRQAAQAIDETELVPSEPMTVVLSEKGWIRAAKGHDVDASALSYRDGDALQGAVR 543

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
           A +T ++  L ++G+AY+ P   L S RG+GE +            VT    +   + ++
Sbjct: 544 ARSTQQVAFLDSEGRAYSTPVHTLPSARGNGEPLTGRFSPAPGTSFVTLASAEPETRFVL 603

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENRKLLIF 673
            SS G  F+     +I   + GK  L +S+   +    +V  V  D +  V  +  LL  
Sbjct: 604 ASSHGYGFVTRFENLIGRNKAGKAMLNLSAGSSVLIPSVVANVATDRIVAVTSSGNLLAI 663

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISD---VICFKICEGLTW-IDSAGRSYNRSENDLLGW 729
           + + +PE+ +GKG ++       ++    V    I  G T  + S  R+     N+L  +
Sbjct: 664 AANDLPELDKGKGNKIIEIPKAKLATERVVAIVAISPGQTLQVRSGQRTMGLKFNELDAY 723

Query: 730 LGKRGGVGSLVPKGF 744
           LG R   G L+P+G+
Sbjct: 724 LGARATRGHLLPRGW 738


>gi|330817902|ref|YP_004361607.1| DNA topoisomerase IV, A subunit [Burkholderia gladioli BSR3]
 gi|327370295|gb|AEA61651.1| DNA topoisomerase IV, A subunit [Burkholderia gladioli BSR3]
          Length = 774

 Score =  528 bits (1360), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 283/691 (40%), Positives = 418/691 (60%), Gaps = 32/691 (4%)

Query: 27  EERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIGKL 86
           E  YL YA+S +K RA+PD+ DG KPV RRI++AM+EMGL   A   KSAR+VG+V+GK 
Sbjct: 29  ERAYLDYAVSVVKGRALPDVCDGQKPVQRRILYAMNEMGLGNNAKPVKSARVVGDVLGKY 88

Query: 87  HPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELILQG 146
           HPHGDQS YD+LVRLAQ F  RYPLI GQGNFG+ DGD AAA RYTEAR+T +A+L+L  
Sbjct: 89  HPHGDQSAYDALVRLAQDFSMRYPLIDGQGNFGSRDGDGAAAMRYTEARLTPIAQLLLDE 148

Query: 147 VDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAALAL 206
           +D+  VDF   Y+    EP + P++ P  L NG SGIAVG+AT IPSHN++E+  AA+AL
Sbjct: 149 IDQGTVDFMPNYDGSFEEPKLLPARLPFALLNGASGIAVGLATEIPSHNLREVAAAAVAL 208

Query: 207 IDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRGSW 266
           I NP+++   L++ + GPDFP GG I+ S   I  +Y +GRG  +VRARW +EE+ RG W
Sbjct: 209 IRNPKLTHADLMQLVPGPDFPGGGQIISSDAEISAAYEVGRGSLKVRARWKIEELARGQW 268

Query: 267 CIVVTEIPYQVQKSRLIEKIAELIIAK------------------RIPLLEDIRDESAED 308
            +VV E+P      +++E+I EL   K                   + LL+ +RDES +D
Sbjct: 269 QLVVNELPPNTSCQKVLEEIEELTNPKIKAGKKTLTQEQANTKKTLLDLLDAVRDESGKD 328

Query: 309 --VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLA 366
             VR+V  PK+R+LD +  ++S+   + +E+  PLN+ ++     P    L  IL EW+ 
Sbjct: 329 APVRLVFEPKSRALDQNEFVQSLLAHTSLESNAPLNLVMIGNDGRPAQKGLGAILGEWVG 388

Query: 367 HRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTEN 426
            R+  + RR   R+  +D R+ IL+G +I +LNIDE+I IIR  D+PK  ++S F L+E 
Sbjct: 389 FRQLTVTRRCRHRLGKVDDRIHILEGRMIVFLNIDEVIRIIRESDEPKAALMSAFGLSER 448

Query: 427 QVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIF 486
           Q + IL +RLR L +LE+ +I+ EL+ L AEK K++ LL       N+ A +   +KEI 
Sbjct: 449 QAEDILEIRLRQLARLEKIKIEKELEELRAEKAKLEDLLA------NESAMKRLLIKEIE 502

Query: 487 SKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFK 546
             +   G  R T   + +  +AT +  +I+ EP+TVV+S +GW+R+LK H +D ++  FK
Sbjct: 503 GDARQFGDDRRTL--IQQEKRATFEARVID-EPVTVVVSQKGWVRALKGHGLDPASFSFK 559

Query: 547 EGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAF 606
            GD L  A    T D ++   + G+ +++P   L  GRG G  +  LI+L     ++  F
Sbjct: 560 AGDGLYAAFQCRTPDTLIAWGSKGRVHSVPVQVLPGGRGDGVPVTSLIELESGTHLMHYF 619

Query: 607 VYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKV--SSEEKMKLVVKVTGDHVAVV 664
              +   LL+ SS G  FI +  ++I+  + GK F+ +   +     + V      VA +
Sbjct: 620 AAGAEQPLLLASSNGFGFIAKVGDMISRQKTGKAFMTIDEGAVPLAPMPVMPLATQVACL 679

Query: 665 GENRKLLIFSIDQIPEMSR-GKGVRLQSYKD 694
               +LL+F +D++  +S  G+GV L + +D
Sbjct: 680 SAQGRLLVFGLDEMKTLSAGGRGVILMALED 710


>gi|190573519|ref|YP_001971364.1| DNA topoisomerase IV subunit A [Stenotrophomonas maltophilia K279a]
 gi|190011441|emb|CAQ45059.1| putative DNA topoisomerase IV subunit A [Stenotrophomonas
           maltophilia K279a]
          Length = 747

 Score =  528 bits (1360), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 285/735 (38%), Positives = 439/735 (59%), Gaps = 21/735 (2%)

Query: 20  VSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIV 79
           + LR   E  YL Y++  + +RA+P + DG KPV RRII++MSE+GL+  +  KKSAR V
Sbjct: 15  LPLREYAERAYLDYSMYVVLDRALPFIGDGLKPVQRRIIYSMSELGLNAASKPKKSARTV 74

Query: 80  GEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMTQ 138
           G+VIGK HPHGD + Y++LV +AQPF  RYPLI GQGNFG+ D   S AA RYTE+++T 
Sbjct: 75  GDVIGKYHPHGDSACYEALVLMAQPFSYRYPLIEGQGNFGSSDDPKSFAAMRYTESKLTP 134

Query: 139 VAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQE 198
           +AE++L  + +   D+   ++    EP   P++ P+LL NGT+GIAVGMAT +P HN+ E
Sbjct: 135 IAEVLLGELGQGTTDWAPNFDGTLQEPTWMPARLPHLLLNGTTGIAVGMATDVPPHNLNE 194

Query: 199 ICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCV 258
           I  A L L+DNP+ ++  L E++ GPD+P+   I+ +   +   Y  G G  R RA +  
Sbjct: 195 IVSALLHLLDNPDATVRDLCEHVQGPDYPSSAEIITAANDLRNIYETGNGSVRARATFNK 254

Query: 259 EEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDES--AEDVRIVLFPK 316
           E     +  IVVT +P+QV  S++IE+IA  + AK++P LEDIRDES  A  VR+VL P+
Sbjct: 255 E-----ANNIVVTALPFQVSPSKVIEQIAAQMRAKKLPWLEDIRDESDHANPVRVVLVPR 309

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           +  +D D LM  +F  +D+E  + +N+NV+ +   PQV  L  +L EWL  R   + RR 
Sbjct: 310 SNRVDADQLMGHLFATTDLERSYRVNLNVIGLDGRPQVKNLKMLLSEWLTFRSNTVTRRL 369

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
             R+Q ++RR+ +L+GLL+A+LN+DE+I IIR ED+PK  +++RF L+E Q + IL  +L
Sbjct: 370 QHRLQKVERRLHLLEGLLVAFLNLDEVIHIIRTEDEPKAALIARFGLSEEQAEYILETKL 429

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           + L +LEE +I+ E D L  E+EKI  +L+S K +  ++   IR+  E+ + +   G  R
Sbjct: 430 KQLARLEEMKIRGEQDELAKEREKILGILDS-KAKLKKL---IRD--ELTADAKKFGDAR 483

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
            +     +A +A  +  ++  EP+TVV+S +GWIR+ K H VD SAL +++GD+L+ A+ 
Sbjct: 484 RSPLVQRQAAQAIDETELVPSEPMTVVLSEKGWIRAAKGHDVDASALSYRDGDALQGAVR 543

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
           A +T ++  L ++G+AY+ P   L S RG+GE +            VT    +   + ++
Sbjct: 544 ARSTQQVAFLDSEGRAYSTPVHTLPSARGNGEPLTGRFSPAAGTSFVTLASAEPDARFVL 603

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENRKLLIF 673
            SS G  F+     +I   + GK  L +SS   +    +V  V  D +  V  +  LL  
Sbjct: 604 ASSHGYGFVTRFENLIGRNKAGKAMLNLSSGSSVLTPSMVANVATDRIVAVTSSGNLLAI 663

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISD---VICFKICEGLTW-IDSAGRSYNRSENDLLGW 729
           + + +PE+ +GKG ++       ++    V    I  G T  + S  R+     N+L  +
Sbjct: 664 AANDLPELDKGKGNKIIEIPKAKLATERVVAIVAISPGQTLQVRSGQRTMGLKFNELDAY 723

Query: 730 LGKRGGVGSLVPKGF 744
           LG R   G L+P+G+
Sbjct: 724 LGARATRGHLLPRGW 738


>gi|115499625|dbj|BAF33487.1| Type II Topoisomerase IV, subunit A [Listonella anguillarum]
          Length = 758

 Score =  528 bits (1359), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 284/751 (37%), Positives = 452/751 (60%), Gaps = 25/751 (3%)

Query: 9   SNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDF 68
           S  +  + V+ + LR   E+ YL Y++  I +RA+P + DG KPV RRII+AMSE+GL  
Sbjct: 2   STEITFDGVEKLPLRKFTEDAYLNYSMYVIMDRALPYIGDGLKPVQRRIIYAMSELGLSA 61

Query: 69  GAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAA 127
            A +KKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S A
Sbjct: 62  SAKYKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFA 121

Query: 128 AYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGM 187
           A RYTEA++++ AE++L  + +  VD++  ++    EP + P++ P++L NG +GIAVGM
Sbjct: 122 AMRYTEAKLSKFAEVLLGELGQGNVDWQPNFDGTMQEPQMLPARLPHILLNGVTGIAVGM 181

Query: 188 ATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGR 247
           AT IP HNV+EI +A + LIDNPE  +  +++Y+ GPD+PT   I+  R  I + YR GR
Sbjct: 182 ATDIPPHNVREIADATIHLIDNPEAQLHDVMQYVQGPDYPTEAEIISPRIEIEKIYRSGR 241

Query: 248 GGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAE 307
           G  ++RA W  E    GS  +V+T +P+QV  ++L+E+IA  + AK++P++ED+RDES  
Sbjct: 242 GSIKMRAVWHKE----GS-DVVITALPHQVSGAKLLEQIANQMRAKKLPMVEDLRDESDH 296

Query: 308 D--VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWL 365
           +   RIV+ P++  +D DLLM  +F  +D+E  F +N+N++ +   P+V  L  IL EW+
Sbjct: 297 ENPTRIVIVPRSNRVDCDLLMSHLFASTDLEKSFRVNLNMIGLNNRPEVKGLVTILSEWI 356

Query: 366 AHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTE 425
             RR  + RR  +R+  +  R+ IL+GLLIAYLNIDE+I IIR ED+PK V+++RF ++ 
Sbjct: 357 EFRRTTVRRRLQYRLDKVMARLHILEGLLIAYLNIDEVIEIIRTEDEPKAVLMARFGISA 416

Query: 426 NQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEI 485
            Q DAIL+ +LR L KLEE +I+ E D L  E+EK++ LL S ++    +  EI+   E 
Sbjct: 417 IQADAILDTKLRHLAKLEEMKIRGEQDELAKEREKLEQLLGSERRLNTLLKKEIKADAEK 476

Query: 486 FSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHF 545
           +        RR+   E + + KA  ++ ++  E ITVV+S +GW+R  K H VD  +L +
Sbjct: 477 YGDD-----RRSPLIERAES-KALTERDLVPSEAITVVLSEKGWVRHAKGHDVDCQSLSY 530

Query: 546 KEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTA 605
           K GD         +  +++ L +DG++Y+L A +L S R  GE I   +++     I   
Sbjct: 531 KSGDQYLAHACGKSNQQVVFLGSDGRSYSLEAHSLPSARTQGEPITGRLNITEGSSIRQV 590

Query: 606 FVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVA 662
            + +     LV S  G  F+ +  E+++  R GK  + +    ++   +  V +  D + 
Sbjct: 591 VMGEEEQLWLVGSDAGYGFVCKGGELLSKNRSGKALVNLPENSEVMTPQASVNLESDDIL 650

Query: 663 VVGENRKLLIFSIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSA 715
            +    ++L+F I  +P++++GKG ++          ++  +S +I       +T + + 
Sbjct: 651 AITNQGRMLLFPIKDLPQLTKGKGNKIINIPAAKSKEREEFVSHLISLPQGAAIT-LYAG 709

Query: 716 GRSYNRSENDLLGWLGKRGGVGSLVPKGFPR 746
            R      +DL  + G+RG  GSL+P+G  R
Sbjct: 710 KRKLGLKASDLENFRGERGRRGSLLPRGLQR 740


>gi|242241010|ref|YP_002989191.1| DNA topoisomerase IV subunit A [Dickeya dadantii Ech703]
 gi|242133067|gb|ACS87369.1| DNA topoisomerase IV, A subunit [Dickeya dadantii Ech703]
          Length = 757

 Score =  528 bits (1359), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 280/746 (37%), Positives = 454/746 (60%), Gaps = 22/746 (2%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           +  +  + ++L    E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL   A 
Sbjct: 4   MTHDGAERLALHTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLSASAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLGELGQGTVDYVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+E+  AA+ALIDNP+ +++ LL+++  PDFPT   I+ SR+ + + Y  GRG  
Sbjct: 184 IPPHNVREVAAAAVALIDNPDATLDALLQHVQAPDFPTEAEIITSRDELRKMYETGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+   GS  +V+T +P+QV  +R++E+IA  + AK++P+++D+RDES  +  
Sbjct: 244 RMRAVWKKED---GS--VVITALPHQVSGARVLEQIASQMRAKKLPMIDDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+VL P++  +D D++M  +F  +D+E  + +NMN++ +   P V  L  IL EWLA R
Sbjct: 299 TRLVLVPRSNRIDLDMVMNHLFATTDLEKSYRINMNMIGLDGRPGVKGLQEILTEWLAFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ + RR SFR+  + +R+ +L+GLL+A+LNIDE+I IIR+ED+PKPV+++RF L++ Q 
Sbjct: 359 RDTVRRRLSFRLDKVLKRLHVLEGLLVAFLNIDEVIHIIRSEDEPKPVLMARFGLSDTQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D L  E+++I  +L S ++  + +  EI+   + +  
Sbjct: 419 EAILELKLRHLAKLEEVKIRGEQDELAKERDQIQDILASERKMSSLLKKEIQADAKAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E + A KA  +  +   EP+T+V+S  GW+RS K H +D S L++K G
Sbjct: 479 D-----RRSPLQERAEA-KAMSEHDLSPSEPVTIVLSEMGWVRSAKGHDIDPSGLNYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           D+ + A    +   ++ + + G++Y L    L S RG GE +   + L     +    + 
Sbjct: 533 DNYRAAARGKSNQPVVFIDSTGRSYALDPLTLPSARGQGEPLTGKLTLPPGATVEQVLMT 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH--VAVVGE 666
               +LL+ S  G  FI   S+++A  R GK  L +    K+   ++V+ D   +  +  
Sbjct: 593 ADEQRLLLASDAGYGFICTFSDLVARNRVGKAVLALPDNAKVLPPLEVSHDDDLLLTITA 652

Query: 667 NRKLLIFSIDQIPEMSRGKGVRL----QSYKDGGISDVICFKICE--GLTWIDSAGRSYN 720
             ++L+F +  +P++S+GKG ++     +    G   ++  ++        + S  R Y 
Sbjct: 653 AGRMLLFPVADLPQLSKGKGNKIVAIPAAQAASGEDRILWLQVISPRATVTLHSGKRKYA 712

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPR 746
               +L  +   RG  G+ +P+G  R
Sbjct: 713 LRPEELQKFTASRGCKGTTLPRGLQR 738


>gi|262404742|ref|ZP_06081297.1| topoisomerase IV subunit A [Vibrio sp. RC586]
 gi|262349774|gb|EEY98912.1| topoisomerase IV subunit A [Vibrio sp. RC586]
          Length = 761

 Score =  527 bits (1358), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 274/681 (40%), Positives = 427/681 (62%), Gaps = 17/681 (2%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + V+ + LR   E+ YL Y++  I +RA+P + DG KPV RRII+AMSE+GL   A +KK
Sbjct: 8   DGVEQLPLRKFTEDAYLNYSMYVIMDRALPYIGDGLKPVQRRIIYAMSELGLSASAKYKK 67

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE
Sbjct: 68  SARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTE 127

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           A++++ AE++L  + +  VD++  ++    EP + P++ P++L NG +GIAVGMAT IP 
Sbjct: 128 AKLSKFAEILLSELGQGTVDWQPNFDGTMQEPKMLPARLPHILLNGVTGIAVGMATDIPP 187

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV+E+ EA + LIDNP   +  L++Y+ GPDFPT   I+     + + YR GRG  R+R
Sbjct: 188 HNVREVAEATIHLIDNPNAPLTDLMQYVKGPDFPTEAEIITPTVELEKIYRSGRGSVRMR 247

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           A WC E    GS  IV+T +P+QV  ++L+E+IA  + AK++P++ED+RDES  +   RI
Sbjct: 248 AVWCKE----GS-DIVITALPHQVSGAKLLEQIAAQMRAKKLPMVEDLRDESDHENPTRI 302

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ P++  +D DLLM  +F  +D+E  F +N+N++ +   PQV  L  IL EW++ RRE 
Sbjct: 303 VIVPRSNRVDCDLLMNHLFASTDLEKSFRVNLNMIGLDNRPQVKGLVQILSEWISFRRET 362

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           +  R  +R+  +  R+ IL+GLLIAYLN+DE+I IIRNED PK V+++RF LT+ Q DAI
Sbjct: 363 VRSRLQYRLDKVLARLHILQGLLIAYLNLDEVIEIIRNEDDPKAVLMARFDLTDIQADAI 422

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L+ +LR L KLEE +I+ E D L  E++K++ LL S ++  N +  EI+   + F     
Sbjct: 423 LDTKLRHLAKLEEMKIRGEQDELEKERKKLEELLGSERRLNNLLKKEIKADADKFGDD-- 480

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
              RR+   E   A KA  ++ ++  E ITVV+S +GWIR  K H VD  +L++K GD+ 
Sbjct: 481 ---RRSPLVEREEA-KALTERDLMPSEAITVVLSEKGWIRHAKGHDVDCQSLNYKAGDNY 536

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
                  ++ + + L +DG++Y+L +  L S RG GE I   +++     I    + +  
Sbjct: 537 LTHACGKSSQQAVFLGSDGRSYSLESHTLPSARGQGEPITGRLNVAEGTTIRQVVMGEED 596

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENR 668
              LV S  G  F+ +  ++++  R GK  + +    ++   +++  +  D +  +    
Sbjct: 597 QLWLVGSDAGYGFVCKGDDLLSKNRSGKALINLPENSEVMTPQVIADLDKDEILAITNQG 656

Query: 669 KLLIFSIDQIPEMSRGKGVRL 689
           ++L+F I  +P++S+GKG ++
Sbjct: 657 RMLLFPIKDLPQLSKGKGNKI 677


>gi|262274993|ref|ZP_06052804.1| topoisomerase IV subunit A [Grimontia hollisae CIP 101886]
 gi|262221556|gb|EEY72870.1| topoisomerase IV subunit A [Grimontia hollisae CIP 101886]
          Length = 759

 Score =  527 bits (1358), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 283/746 (37%), Positives = 459/746 (61%), Gaps = 27/746 (3%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + V+ + LR   E+ YL Y++  I +RA+P + DG KPV RRII+AMSE+GL   A +KK
Sbjct: 7   DGVEQLPLRKFTEDAYLNYSMYVIMDRALPFIGDGLKPVQRRIIYAMSELGLSATAKYKK 66

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE
Sbjct: 67  SARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTE 126

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           +R+++ +E++L  + +  VD++  ++    EP   PS+ P++L NG +GIAVGMAT IP 
Sbjct: 127 SRLSRFSEVLLSELGQGTVDWQPNFDGTMKEPKALPSRLPHILLNGVTGIAVGMATDIPP 186

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN +E+  A +ALID+P + ++ LLE++ GPD+PT   I+  +  + + YR GRG  ++R
Sbjct: 187 HNAREVANALVALIDSPTLDLDGLLEHVKGPDYPTEAEIITPQVELKKLYRDGRGSIKMR 246

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           ARW      + +  IV+T +P+QV  ++L+E+IA  + AK++P+++D+RDES  +   RI
Sbjct: 247 ARWH-----KDNGDIVITALPHQVSGAKLLEQIANQMRAKKLPMVDDLRDESDHENPTRI 301

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ P++  +D + LM  +F+ +D+E  + +N+N++ +   PQV  L  IL EWL  RRE 
Sbjct: 302 VIVPRSNRVDCEQLMNHLFVSTDLEKSYRVNLNMIGLDGRPQVKGLLKILTEWLEFRRET 361

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           + RR  +R+  +  R+ IL+GLL+AYLNIDE+I IIR ED+PK  ++SRF L+E Q +AI
Sbjct: 362 VRRRLQYRLDKVLARLHILEGLLVAYLNIDEVIEIIRTEDEPKKELMSRFGLSEKQAEAI 421

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L ++LR L KLEE +I+ E D L  E+E+++ +L S ++    +       KEI + +  
Sbjct: 422 LEIKLRQLAKLEEIKIRGEQDELNKEREQLEKVLGSERRMNTLLK------KEILADAEK 475

Query: 492 LG-RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDS 550
            G  RR+   E + A KA  ++ +I  EPITVV+S +GWIR  K H VD ++L +K GDS
Sbjct: 476 YGDERRSPLVERAEA-KAMTERDLIPSEPITVVLSEKGWIRHAKGHDVDPTSLSYKSGDS 534

Query: 551 LKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDS 610
              +    +   ++ + +DG++Y L +  L S R  GE I   +++     +    + ++
Sbjct: 535 YLASARGKSNQPVVFIGSDGRSYALESHTLPSARSQGEPITGRLNITAGTAVRHVMMGEN 594

Query: 611 TCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKV----TGDHVAVVGE 666
              +L+ S  G  F+ ++ ++++  R GK  L +    ++    +V    T D VA+  E
Sbjct: 595 DNLVLMASDAGYGFVCKQDDLLSKNRSGKALLSLPQAAEVMPPQRVADIETDDIVAITNE 654

Query: 667 NRKLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVIC--FKICEGLTWIDSAG-RSYN 720
            R +L+F + ++P++ +GKG   + + S +     +++   F I +G +    AG R  +
Sbjct: 655 GR-MLVFPVKELPQLGKGKGNKIINIPSARAKAREELLTQLFVIPQGASVTLHAGKRKLS 713

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPR 746
               D+  + G+RG  GS++P+G  R
Sbjct: 714 LKPTDIDNFRGERGRRGSMLPRGLQR 739


>gi|311695410|gb|ADP98283.1| DNA topoisomerase IV subunit A [marine bacterium HP15]
          Length = 769

 Score =  527 bits (1358), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 290/749 (38%), Positives = 447/749 (59%), Gaps = 28/749 (3%)

Query: 13  VEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAF 72
            +E  + VSLR   E+ YL Y++  I +RA+P++ DG KPV RRI++AMSE+GL   + +
Sbjct: 7   TDEGFERVSLRDYTEKAYLDYSMYVILDRALPNVGDGLKPVQRRIVYAMSELGLKSTSKY 66

Query: 73  KKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRY 131
           KKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G+ D   S AA RY
Sbjct: 67  KKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGSPDDPKSFAAMRY 126

Query: 132 TEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSI 191
           TE+R+   AE++L  + +  VD+   ++    EP V P++ P++L NGT+GIAVGMAT I
Sbjct: 127 TESRLAPFAEVLLGELGQGTVDWVPNFDGTMDEPSVLPARLPHVLLNGTTGIAVGMATDI 186

Query: 192 PSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFR 251
           P HNV+E+  A + L+D PE ++++L E+I GPDFPT   I+  R+ I + Y  GRG  R
Sbjct: 187 PPHNVREVTAACIRLLDQPESTVDELCEHIKGPDFPTQAEIITPRKDIRQMYETGRGSLR 246

Query: 252 VRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--V 309
           +RARW      R S  IVVT++P+QV  +R++E+IA  +  K++P++ D+RDES  +   
Sbjct: 247 MRARWI-----RESGEIVVTDLPHQVSGNRVLEQIAHQMQTKKLPMVADLRDESDHENPT 301

Query: 310 RIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRR 369
           R+V+ P++  +D D LM  +F  +D+E  + +N+NV+     P V  L  IL EWL  RR
Sbjct: 302 RLVIVPRSNRVDLDGLMAHLFASTDLEKTYRVNINVIGNDGRPGVKGLHQILTEWLTFRR 361

Query: 370 EVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVD 429
             + RR   R+  +  R+ IL+GLLIAYLNIDE+I IIR EDKPK  +++RF L+ +Q +
Sbjct: 362 TTVIRRLQHRLDKVLARLHILEGLLIAYLNIDEVIEIIRTEDKPKAELMARFGLSADQAE 421

Query: 430 AILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKS 489
           AIL L+LR L KLEE +I+ E D L AE++++ S+L S  +    I  E++   E F   
Sbjct: 422 AILELKLRHLAKLEEMKIRGEQDELAAERDELQSILGSEDRLRELIKSEMQADAETFGDD 481

Query: 490 TDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGD 549
                RR+   E   A KA  +  +I  +P+TVV+S +GW+R+ K H ++   L +K GD
Sbjct: 482 -----RRSPIVEREEA-KAFSEVDLISNDPVTVVLSEKGWVRAAKGHDIEPEGLSYKAGD 535

Query: 550 SLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYD 609
              +A       + + L + G+AY+L A +  S RG GE +   I+           + D
Sbjct: 536 RFSLAARGRNNQQTIFLDSTGRAYSLMAHSFPSARGQGEPLTGRINPPSGASFSGLLMGD 595

Query: 610 STCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGD--HVAVVG 665
            + K L+V+  G  F+   +++I+  R GK  + V    ++   L +  T    ++  V 
Sbjct: 596 PSRKALLVTDGGYGFVTSLNDMISKNRNGKAVVSVPKGARIMPPLTIPTTEKTLYLGAVS 655

Query: 666 ENRKLLIFSIDQIPEMSRGKG--------VRLQSYKDGGISDVICFKICEGLTWIDSAGR 717
              ++L+F + ++PE+++GKG         R+QS ++  ++ V  F   + L  I +  R
Sbjct: 656 NEGRMLVFPLSELPELAKGKGNKIISIPSARVQSREEYVVA-VAVFAEDDQLE-IRAGKR 713

Query: 718 SYNRSENDLLGWLGKRGGVGSLVPKGFPR 746
                 +DL  +LG+RG  G  +P+G  R
Sbjct: 714 KMGLQFSDLEHYLGERGRRGHKLPRGLQR 742


>gi|257454137|ref|ZP_05619410.1| DNA topoisomerase IV, A subunit [Enhydrobacter aerosaccus SK60]
 gi|257448465|gb|EEV23435.1| DNA topoisomerase IV, A subunit [Enhydrobacter aerosaccus SK60]
          Length = 749

 Score =  527 bits (1357), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 284/756 (37%), Positives = 453/756 (59%), Gaps = 27/756 (3%)

Query: 9   SNTLVEENVKAVSLRFAL-------EERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAM 61
           S+TLV +  KA  L           E  YL YA+  I +RA+P + DG KPV RRI++AM
Sbjct: 2   SDTLVAKTTKANDLNNPTRSVAEFTENAYLNYAMYVIMDRALPHIADGLKPVQRRIVYAM 61

Query: 62  SEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNI 121
           SE+GL   A  KKSAR +G+VIGK HPHGD + Y+++V ++QPF  RYPLISGQGNFG+ 
Sbjct: 62  SELGLKNTAKPKKSARTIGDVIGKYHPHGDSACYEAMVLMSQPFSYRYPLISGQGNFGSP 121

Query: 122 DG-DSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGT 180
           D   S AA RYTEA+++  A  +L  + +  VD++D ++    EPV  P++ PN+L NGT
Sbjct: 122 DDPKSFAAMRYTEAKLSAYANTLLNELGQGTVDWQDNFDGTLQEPVTLPARLPNILLNGT 181

Query: 181 SGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIV 240
           +GIAVGMAT IP HN+ E+ +  +AL+  P ++ ++L +YI  PD PT   I+ S E ++
Sbjct: 182 TGIAVGMATDIPPHNLSEVVKGCIALLKKPTMTEKELAKYIPAPDLPTKAEIITSPEDLL 241

Query: 241 ESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLED 300
           + Y+ GRG +++RA + V++  +    +++  +PYQ+  +++IE+IA LI AK++P + D
Sbjct: 242 QLYKTGRGSYKMRATYHVDDKEKN--LVIIDALPYQISGNKIIEQIANLINAKKLPWVTD 299

Query: 301 IRDESAED--VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLD 358
           I DES      RIVL  ++  +D + +M  +F  +D+E+ + +N+N++     PQV  L 
Sbjct: 300 IHDESDHQNACRIVLELRSSRVDIEPMMSHLFASTDLESNYRVNLNMIGTNGKPQVKSLL 359

Query: 359 GILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMV 418
            IL EWL+ RR+ + RR  +R+  I++R+ IL GLLIAYL+IDE+I IIR E+ PK  ++
Sbjct: 360 TILTEWLSVRRDTVTRRLQYRLDKIEQRLHILAGLLIAYLHIDEVIRIIREEEDPKAELM 419

Query: 419 SRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACE 478
           +R+ LTE+Q +AIL++RLR L +LEE ++K E  +L AEK +I+  LN+  +    +   
Sbjct: 420 TRYDLTESQANAILDIRLRQLARLEEIELKREQSDLEAEKAQIEGYLNNPDKLTGLM--- 476

Query: 479 IREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQA-MIEKEPITVVISNRGWIRSLKSHS 537
              ++E+ +   + G +R +   V R +   L++  +   EP+TV++S  GWIRS K H 
Sbjct: 477 ---IEELTADMKEHGDKRQSPI-VERTEATALKETDLAPSEPVTVIVSKSGWIRSAKGHD 532

Query: 538 VDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLN 597
           VD + ++++ GD+        + +++ L+   G++Y L A  L S RG GE +  L+   
Sbjct: 533 VDAANMNYRSGDAYLAHAQGKSNEKVYLMDNTGRSYRLDAHTLPSARGQGEPLTSLLKPT 592

Query: 598 HNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVT 657
                V   +     KL++ SS+G  FI   +++  N + GK    ++ ++   L+    
Sbjct: 593 GGASFVNVLMGQDDSKLIMASSQGYGFINTFADLDTNQKAGKNV--INFDDAFSLITHQI 650

Query: 658 GDH---VAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDG-GISDVICFKICEGLTWID 713
           G+    V VV     LL++ + ++P M +GKG +L   KDG  +  +  F   + L+ +D
Sbjct: 651 GEQDTLVGVVSSAGHLLVYPLTELPMMKKGKGNKLIDLKDGDSVVAITTFSEGDSLS-LD 709

Query: 714 SAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGK 749
           S  R+      D+  ++G RG  G L+PKGF +  K
Sbjct: 710 SGKRTLTLKPMDIANFMGARGKRGGLLPKGFQKVSK 745


>gi|308188118|ref|YP_003932249.1| topoisomerase IV subunit A [Pantoea vagans C9-1]
 gi|308058628|gb|ADO10800.1| topoisomerase IV subunit A [Pantoea vagans C9-1]
          Length = 757

 Score =  526 bits (1356), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 280/746 (37%), Positives = 453/746 (60%), Gaps = 26/746 (3%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L ++  + ++L    E+ YL Y++  I +RA+P + DG KPV RRII+AMSE+GL+  A 
Sbjct: 4   LTQDGAERLALHTFTEDAYLKYSMYVIMDRALPYIGDGLKPVQRRIIYAMSELGLNASAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AEL+L  + +  V+++  ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAELLLGELGQGTVEYQPNFDGTLQEPKILPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HN++E+ +AA+ALID P+ ++E+LL+ + GPD+PT   I+  R+ I + Y+ GRG  
Sbjct: 184 IPPHNLREVAQAAIALIDAPKTTLEQLLDIVQGPDYPTEAEIITPRDEIRKIYQTGRGSI 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R RA W  EE       +V+T +P+QV  +R++E+IA  +  K++P++ED+RDES  +  
Sbjct: 244 RQRAVWKKEE-----GEVVITALPHQVSGARVLEQIANQMRNKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P++  +D D +M  +F  +D+E  + +N+N++ +   P V  L  IL EWL  R
Sbjct: 299 TRLVIVPRSNRVDLDQVMNHLFATTDLEKSYRVNLNMIGLDNRPAVKNLHEILTEWLVFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ + RR ++R+  + RR+ IL+GLL+A+LNIDE+I IIR ED+PKPV++SRF ++E Q 
Sbjct: 359 RDTVKRRLNYRLDRVLRRLHILEGLLVAFLNIDEVIEIIRTEDEPKPVLMSRFGISETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           ++IL L+LR L KLEE +I+ E  +L  E++++ + L S ++    +       KE+ + 
Sbjct: 419 ESILELKLRHLAKLEEMKIRGEQADLEKERDQLQATLASERKMNTLLK------KELQAD 472

Query: 489 STDLG-RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKE 547
           S   G  RR+  CE   A KA  +  ++  EP+T+V+S  GW+RS K H +D + L +K 
Sbjct: 473 SASYGDERRSPLCEREEA-KALSETELVPSEPVTIVLSQMGWVRSAKGHDIDPAGLSYKA 531

Query: 548 GDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFV 607
           GDS   A    +   +  + + G++YTL   +L S RG GE +   +       +    +
Sbjct: 532 GDSYLAAARGKSNQPVAFIDSTGRSYTLDPTSLPSARGQGEPLTGKLTPPPGAVVEQVLM 591

Query: 608 YDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGDHVAVVG 665
                +LL+ S  G  FI   S++I+  R GK  L +    ++   + V    D +  + 
Sbjct: 592 EPDDQRLLMASDAGYGFICTFSDLISRNRAGKALLTLPDNARVMTPMAVHHEDDMLLAIT 651

Query: 666 ENRKLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVICFKIC----EGLTWIDSAGRS 718
           +  ++L+F + ++P+MS+GKG   + + S +     D + + +       +T      + 
Sbjct: 652 QAGRMLMFPVGELPQMSKGKGNKIISIPSAEAAAGQDKLAWLMILPPGSAITLHVGKRKM 711

Query: 719 YNRSENDLLGWLGKRGGVGSLVPKGF 744
             RSE +L  +   RG  G+L+P+G 
Sbjct: 712 LLRSE-ELQKFRADRGRRGTLLPRGL 736


>gi|22127381|ref|NP_670804.1| DNA topoisomerase IV subunit A [Yersinia pestis KIM 10]
 gi|45442750|ref|NP_994289.1| DNA topoisomerase IV subunit A [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51597690|ref|YP_071881.1| DNA topoisomerase IV subunit A [Yersinia pseudotuberculosis IP
           32953]
 gi|108809111|ref|YP_653027.1| DNA topoisomerase IV subunit A [Yersinia pestis Antiqua]
 gi|108810694|ref|YP_646461.1| DNA topoisomerase IV subunit A [Yersinia pestis Nepal516]
 gi|150260297|ref|ZP_01917025.1| DNA topoisomerase IV subunit A [Yersinia pestis CA88-4125]
 gi|153948943|ref|YP_001399574.1| DNA topoisomerase IV subunit A [Yersinia pseudotuberculosis IP
           31758]
 gi|162419004|ref|YP_001604893.1| DNA topoisomerase IV subunit A [Yersinia pestis Angola]
 gi|165924871|ref|ZP_02220703.1| DNA topoisomerase IV, A subunit [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165939881|ref|ZP_02228420.1| DNA topoisomerase IV, A subunit [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166008853|ref|ZP_02229751.1| DNA topoisomerase IV, A subunit [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166212201|ref|ZP_02238236.1| DNA topoisomerase IV, A subunit [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|167399465|ref|ZP_02304989.1| DNA topoisomerase IV, A subunit [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167419083|ref|ZP_02310836.1| DNA topoisomerase IV, A subunit [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167425150|ref|ZP_02316903.1| DNA topoisomerase IV, A subunit [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|167469330|ref|ZP_02334034.1| DNA topoisomerase IV, A subunit [Yersinia pestis FV-1]
 gi|170022913|ref|YP_001719418.1| DNA topoisomerase IV subunit A [Yersinia pseudotuberculosis YPIII]
 gi|186896831|ref|YP_001873943.1| DNA topoisomerase IV subunit A [Yersinia pseudotuberculosis PB1/+]
 gi|218927864|ref|YP_002345739.1| DNA topoisomerase IV subunit A [Yersinia pestis CO92]
 gi|229837354|ref|ZP_04457517.1| DNA topoisomerase IV subunit A [Yersinia pestis Pestoides A]
 gi|229840565|ref|ZP_04460724.1| DNA topoisomerase IV subunit A [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229842886|ref|ZP_04463038.1| DNA topoisomerase IV subunit A [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229900892|ref|ZP_04516016.1| DNA topoisomerase IV subunit A [Yersinia pestis Nepal516]
 gi|270487736|ref|ZP_06204810.1| DNA topoisomerase IV, A subunit [Yersinia pestis KIM D27]
 gi|294502738|ref|YP_003566800.1| DNA topoisomerase IV subunit A [Yersinia pestis Z176003]
 gi|21960467|gb|AAM87055.1|AE013953_11 DNA topoisomerase IV subunit A [Yersinia pestis KIM 10]
 gi|45437616|gb|AAS63166.1| DNA topoisomerase IV subunit A [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51590972|emb|CAH22630.1| DNA topoisomerase IV subunit A [Yersinia pseudotuberculosis IP
           32953]
 gi|108774342|gb|ABG16861.1| DNA topoisomerase IV subunit A [Yersinia pestis Nepal516]
 gi|108781024|gb|ABG15082.1| DNA topoisomerase IV subunit A [Yersinia pestis Antiqua]
 gi|115346475|emb|CAL19348.1| DNA topoisomerase IV subunit A [Yersinia pestis CO92]
 gi|149289705|gb|EDM39782.1| DNA topoisomerase IV subunit A [Yersinia pestis CA88-4125]
 gi|152960438|gb|ABS47899.1| DNA topoisomerase IV, A subunit [Yersinia pseudotuberculosis IP
           31758]
 gi|162351819|gb|ABX85767.1| DNA topoisomerase IV, A subunit [Yersinia pestis Angola]
 gi|165912192|gb|EDR30830.1| DNA topoisomerase IV, A subunit [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165923071|gb|EDR40222.1| DNA topoisomerase IV, A subunit [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165992192|gb|EDR44493.1| DNA topoisomerase IV, A subunit [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166206947|gb|EDR51427.1| DNA topoisomerase IV, A subunit [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|166963077|gb|EDR59098.1| DNA topoisomerase IV, A subunit [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167051969|gb|EDR63377.1| DNA topoisomerase IV, A subunit [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167055913|gb|EDR65694.1| DNA topoisomerase IV, A subunit [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|169749447|gb|ACA66965.1| DNA topoisomerase IV, A subunit [Yersinia pseudotuberculosis YPIII]
 gi|186699857|gb|ACC90486.1| DNA topoisomerase IV, A subunit [Yersinia pseudotuberculosis PB1/+]
 gi|229682231|gb|EEO78323.1| DNA topoisomerase IV subunit A [Yersinia pestis Nepal516]
 gi|229690153|gb|EEO82210.1| DNA topoisomerase IV subunit A [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229696931|gb|EEO86978.1| DNA topoisomerase IV subunit A [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229705477|gb|EEO91487.1| DNA topoisomerase IV subunit A [Yersinia pestis Pestoides A]
 gi|262360770|gb|ACY57491.1| DNA topoisomerase IV subunit A [Yersinia pestis D106004]
 gi|262364715|gb|ACY61272.1| DNA topoisomerase IV subunit A [Yersinia pestis D182038]
 gi|270336240|gb|EFA47017.1| DNA topoisomerase IV, A subunit [Yersinia pestis KIM D27]
 gi|294353197|gb|ADE63538.1| DNA topoisomerase IV subunit A [Yersinia pestis Z176003]
 gi|320016766|gb|ADW00338.1| DNA topoisomerase IV subunit A [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 757

 Score =  526 bits (1356), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 285/746 (38%), Positives = 446/746 (59%), Gaps = 22/746 (2%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L  +  + + L    E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A 
Sbjct: 4   LTHDGAERLPLHTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNNSAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLGELAQGTVDWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+EI +A LALID P  S+++LLE++ GPDFPT   I+  R+ I + Y+ GRG  
Sbjct: 184 IPPHNVREIAQAVLALIDKPTTSLDELLEFVQGPDFPTEAEIITPRDDIRKIYQNGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+   GS   V+T +P+QV  ++++E+IA  + AK++P++ED+RDES  +  
Sbjct: 244 RMRAVWKKED---GS--AVITALPHQVSGAKVLEQIANQMRAKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P+   +D D +M  +F  +D+E  + +NMN++ +   P V  L  IL EWL  R
Sbjct: 299 TRLVIVPRTNRVDLDQVMSHLFATTDLERSYRINMNMIGLDNRPSVKGLLEILTEWLVFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ +  R +FR++ + +R+ IL+GLLIA+LNIDE+I IIR ED PKP+++ RFS++E Q 
Sbjct: 359 RQTVRNRLNFRLEKVLKRLHILEGLLIAFLNIDEVIHIIRTEDDPKPLLMQRFSISETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D L  E++++ +LL S ++    I  EI+     +  
Sbjct: 419 EAILELKLRHLAKLEEVKIRGEQDELAKERDQLQALLASERKLNTLIKKEIQADAAAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E   A KA  +  ++  EP+T+V+S  GW+RS K H +D S L +K G
Sbjct: 479 D-----RRSPLTERGEA-KAMSEHDIVPSEPVTIVLSEMGWVRSAKGHDIDPSGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           DS + A    +   ++ + + G++Y L    L S RG GE +   +       I    + 
Sbjct: 533 DSFRAAARGMSNQPVVFIDSTGRSYALDPLTLPSARGQGEPLTGKLTPPPGATIEHVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG--DHVAVVGE 666
             + KLL+ S  G  F+   ++++A  R GKT + +    K+   +++ G  D +  +  
Sbjct: 593 PDSQKLLMASDAGYGFVCTFNDLVAKNRAGKTMITLPENAKVLPPLEIYGPDDMLLSITA 652

Query: 667 NRKLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVICFKIC---EGLTWIDSAGRSYN 720
             ++L+F +  +PE+S+GKG   V + + +     D + +      +    +    R   
Sbjct: 653 VGRMLMFPVADLPELSKGKGNKIVSIPAAQAAAGEDRLAWLFVLPPQTSITLHFGKRKLT 712

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPR 746
               DL  +  +RG  GS +P+G  R
Sbjct: 713 LRPEDLQKFRAERGRKGSPLPRGLQR 738


>gi|194365062|ref|YP_002027672.1| DNA topoisomerase IV subunit A [Stenotrophomonas maltophilia
           R551-3]
 gi|194347866|gb|ACF50989.1| DNA topoisomerase IV, A subunit [Stenotrophomonas maltophilia
           R551-3]
          Length = 747

 Score =  525 bits (1353), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 282/735 (38%), Positives = 439/735 (59%), Gaps = 21/735 (2%)

Query: 20  VSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIV 79
           + LR   E  YL Y++  + +RA+P + DG KPV RRII++MSE+GL+  +  KKSAR V
Sbjct: 15  LPLREYAERAYLDYSMYVVLDRALPFIGDGLKPVQRRIIYSMSELGLNAASKPKKSARTV 74

Query: 80  GEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMTQ 138
           G+VIGK HPHGD + Y++LV +AQPF  RYPLI GQGNFG+ D   S AA RYTE+++T 
Sbjct: 75  GDVIGKYHPHGDSACYEALVLMAQPFSYRYPLIEGQGNFGSSDDPKSFAAMRYTESKLTP 134

Query: 139 VAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQE 198
           +AE++L  + +   D+   ++    EP   P++ P+LL NGT+GIAVGMAT +P HN+ E
Sbjct: 135 IAEVLLGELGQGTTDWAPNFDGTLQEPTWMPARLPHLLLNGTTGIAVGMATDVPPHNLNE 194

Query: 199 ICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCV 258
           I  A L L+DNPE S+  L E++ GPD+P+   I+ +   +   Y  G G  R RA +  
Sbjct: 195 IVSALLHLLDNPEASVRDLCEHVQGPDYPSSAEIITAANDLRNMYETGNGSVRARATFTK 254

Query: 259 EEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDES--AEDVRIVLFPK 316
           E     +  IVVT +P+QV  S++IE+IA  + AK++P LEDIRDES  A  VR+VL P+
Sbjct: 255 E-----ANNIVVTALPFQVSPSKVIEQIAAQMRAKKLPWLEDIRDESDHANPVRVVLVPR 309

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           +  +D + LM  +F  +DME  + +N+NV+ +   PQV  L  +L EWL  R   + RR 
Sbjct: 310 SNRVDAEQLMGHLFATTDMERSYRVNLNVIGLDGRPQVKNLKMLLSEWLTFRSNTVTRRL 369

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
             R+Q ++RR+ +L+GLL+A+LN+DE+I IIR ED+PK  +++RF L+++Q + IL  +L
Sbjct: 370 QHRLQKVERRLHLLEGLLVAFLNLDEVIHIIRTEDEPKAALIARFGLSDDQAEYILETKL 429

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           + L +LEE +I+ E D L  E+EKI  +L+S K +  ++   IR+  E+ + +   G  R
Sbjct: 430 KQLARLEEMKIRGEQDELAKEREKILGILDS-KTKLKKL---IRD--ELTADAKKFGDAR 483

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
            +     +A +A  +  ++  EP+TVV+S +GWIR+ K H +D S L +++GD+L+ A+ 
Sbjct: 484 RSPLVQRQAAQAIDETELVPSEPMTVVMSEKGWIRAAKGHDIDASTLSYRDGDALQGAVR 543

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
           A +T ++  L ++G+AY+ P   L S RG+GE +            VT    +   + ++
Sbjct: 544 ARSTQQVAFLDSEGRAYSTPVHTLPSARGNGEPLTGRFSPAAGTSFVTLASAEPETRFVL 603

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENRKLLIF 673
            S+ G  F+     +I   + GK  L +S+   +    +V  V  D +  V  +  LL  
Sbjct: 604 ASTHGYGFVTRFENLIGRNKAGKAMLNLSAGSTVLTPSVVANVATDRIVAVTSSGNLLAI 663

Query: 674 SIDQIPEMSRGKGVRLQSYKDGGISD---VICFKICEGLTW-IDSAGRSYNRSENDLLGW 729
           + + +PE+ +GKG ++       ++    V    I  G T  + S  R+     N+L  +
Sbjct: 664 AANDLPELDKGKGNKIIEIPKAKLATERVVAIVAISPGQTLQVRSGQRTMGLKFNELDAY 723

Query: 730 LGKRGGVGSLVPKGF 744
           LG R   G L+P+G+
Sbjct: 724 LGARATRGHLLPRGW 738


>gi|157372492|ref|YP_001480481.1| DNA topoisomerase IV subunit A [Serratia proteamaculans 568]
 gi|157324256|gb|ABV43353.1| DNA topoisomerase IV, A subunit [Serratia proteamaculans 568]
          Length = 757

 Score =  525 bits (1353), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 286/746 (38%), Positives = 450/746 (60%), Gaps = 22/746 (2%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L  + V+ + L    E  YL Y++  I +RA+P + DG KPV RRII+AMSE+GL+  A 
Sbjct: 4   LTHDGVERLPLHTFTENAYLNYSMYVIMDRALPYIGDGLKPVQRRIIYAMSELGLNNSAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLAELGQGTVDWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+E+  AA+ALID P  S+E+LLE++ GPD+PT   I+  RE I + Y+ GRG  
Sbjct: 184 IPPHNVREVAAAAVALIDKPGASLEELLEFVQGPDYPTEAEIITPREEIRKIYQNGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+   GS   V+T +P+QV  ++++E+IA  + AK++P++ED+RDES  +  
Sbjct: 244 RMRAVWSKED---GS--AVITALPHQVSGAKVLEQIASQMRAKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P++  +D D +M  +F  +D+E  + +NMN++ +   PQV  L  IL EWLA R
Sbjct: 299 TRLVIVPRSNRIDLDQVMNHLFATTDLERSYRINMNMIGLDNRPQVKGLVEILTEWLAFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ + RR ++R++ + +R+ IL+GLL+A+LNIDE+I IIR+ED+PKPV++ RF +++ Q 
Sbjct: 359 RDTVRRRLNYRLEKVLKRLHILEGLLVAFLNIDEVIHIIRSEDEPKPVLMQRFGISDTQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE++I+ E D L  E++++ +LL S ++    I  EI+   + +  
Sbjct: 419 EAILELKLRHLAKLEEFKIRGEQDELAKERDQLQALLASERKLNTLIKKEIQADAQAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E + A KA  +   +  EP+T+V+S  GW+RS K H +D S L +K G
Sbjct: 479 D-----RRSPITERAEA-KAMSEHDFVPSEPVTIVLSEMGWVRSAKGHDIDPSGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           DS + A    T   ++ + + G++Y L    L S RG GE +   +       I    + 
Sbjct: 533 DSFRSAARGKTNQPVVFIDSTGRSYALDPLTLPSARGQGEPLTGKLTPPPGATIEQVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG--DHVAVVGE 666
               KLL+ S  G  F+   ++++A  R GK  + +    K    +++ G  D +  +  
Sbjct: 593 ADDQKLLMASDAGYGFVCTFNDLVARNRAGKVMITLPDNAKALAPMEIHGEDDMLLSITA 652

Query: 667 NRKLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVICFKIC---EGLTWIDSAGRSYN 720
             ++L F +  +P++S+GKG   V + S +     D + +      +    +    R   
Sbjct: 653 AGRMLFFPVADLPQLSKGKGNKIVSIPSAQAASGEDKLAWLFVLPPQTSVTLHVGKRKLT 712

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPR 746
               DL  +  +RG  G+ +P+G  R
Sbjct: 713 LRPEDLQKFRAERGRKGTSLPRGLQR 738


>gi|238793643|ref|ZP_04637266.1| DNA topoisomerase 4 subunit A [Yersinia intermedia ATCC 29909]
 gi|238727058|gb|EEQ18589.1| DNA topoisomerase 4 subunit A [Yersinia intermedia ATCC 29909]
          Length = 755

 Score =  525 bits (1353), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 284/746 (38%), Positives = 444/746 (59%), Gaps = 22/746 (2%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L  +  + + L    E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A 
Sbjct: 4   LTHDGAERLPLHTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNNSAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLGELGQGTVDWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+EI +A LALID P  S+E+LLE++ GPDFPT   I+  R+ I + Y+ GRG  
Sbjct: 184 IPPHNVREIAQAVLALIDKPTASLEELLEFVQGPDFPTEAEIITPRDEIRKIYQNGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+   GS   V+T +P+QV  ++++E+IA  + AK++P++ED+RDES  +  
Sbjct: 244 RMRALWKKED---GS--AVITALPHQVSGAKVLEQIASQMRAKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P+   +D D +M  +F  +D+E  + +NMN++ +   P V  L  IL EWL  R
Sbjct: 299 TRLVIVPRTNRVDLDQVMNHLFATTDLERSYRINMNMIGLDHRPSVKGLLEILTEWLVFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ +  R ++R++ + +R+ IL+GLLIA+LNIDE+I IIR ED+PKP+++  F+++E Q 
Sbjct: 359 RQTVRNRLNYRLEKVLKRLHILEGLLIAFLNIDEVIHIIRTEDEPKPLLMQHFAISETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D L  E++++ +LL S ++    I  EI+     +  
Sbjct: 419 EAILELKLRHLAKLEEVKIRGEQDELAKERDQLQALLASERKLNTLIKKEIQADAAAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E   A KA  +  ++  EP+T+V+S  GW+RS K H +D S L +K G
Sbjct: 479 D-----RRSPLTERGEA-KAMSEHDIVPSEPVTIVLSEMGWVRSAKGHDIDPSGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           DS + A    +   ++ + + G++Y L    L S RG GE +   +       I    + 
Sbjct: 533 DSFRAAARGMSNQPVVFIDSTGRSYALDPLTLPSARGQGEPLTGKLTPPPGATIEQVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG--DHVAVVGE 666
               KLL+ S  G  F+   ++++A  R GKT + +    K    +++ G  D +  +  
Sbjct: 593 PDDQKLLMASDAGYGFVCTFNDLVAKNRAGKTMITLPENAKALTPLEIHGPDDMLLSITA 652

Query: 667 NRKLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVICFKIC---EGLTWIDSAGRSYN 720
             ++L+F +  +PE+S+GKG   V + S +     D + +      +    +    R   
Sbjct: 653 AGRMLMFPVADLPELSKGKGNKIVSIPSAQAAAGEDRLAWLFVLPPQTSITLHFGKRKLT 712

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPR 746
               DL  +  +RG  GS +P+G  R
Sbjct: 713 LRPEDLQKFRAERGRKGSPLPRGLQR 738


>gi|52424930|ref|YP_088067.1| DNA topoisomerase IV subunit A [Mannheimia succiniciproducens
           MBEL55E]
 gi|52306982|gb|AAU37482.1| GyrA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 748

 Score =  525 bits (1353), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 281/742 (37%), Positives = 446/742 (60%), Gaps = 24/742 (3%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           E ++ + LR   E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A +KK
Sbjct: 7   EGIEQMPLRTFTESAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNATAKYKK 66

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE
Sbjct: 67  SARTVGDVLGKFHPHGDTACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTE 126

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           +R+++ AEL+L  + +  VD++  ++    EP   P++ P++L NGT+GIAVGMAT IP 
Sbjct: 127 SRLSKFAELLLGELGQGTVDYQPNFDGTILEPQYLPARLPHILLNGTTGIAVGMATDIPP 186

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN+ EI +AA+ L+DNP+ +++ +L  + GPDFPT   I+  +E I + Y  GRG  ++R
Sbjct: 187 HNLNEIADAAVMLLDNPKATLDDILTLVQGPDFPTEAEIISPKEEIRKIYENGRGSVKMR 246

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           A W  E+       I++T +P+Q   S++I +IAE + AK++P++EDIRDE+  +  VRI
Sbjct: 247 AVWKKED-----GEIIITALPHQASPSKVIAQIAEQMTAKKLPMVEDIRDEADHENPVRI 301

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           VL P++  +D + LM  +F  +D+E  + +NMN++ +   P V  L  IL EWL+ RR  
Sbjct: 302 VLVPRSNRVDSEALMAHLFATTDLEKNYRVNMNMIGLDNKPAVKNLLQILTEWLSFRRST 361

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           + RR  +R+  +  R+ IL+GL+IAYLNIDE+I IIRNED+PKPV+++RF L++ Q +AI
Sbjct: 362 VTRRLQYRLDKVLSRLHILQGLMIAYLNIDEVIHIIRNEDEPKPVLMARFELSDEQAEAI 421

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           LNLRLR L KLEE+++++E D L  E+ +++ +L+S ++    I  EI++  + ++    
Sbjct: 422 LNLRLRHLAKLEEHELQAEKDQLEQERAQLEQILSSERRLNTLIKKEIQQDAKTYASP-- 479

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
              RR+   E + A KA  +  MI  EP+TV++S  GW+R  K H +D   L++K GD  
Sbjct: 480 ---RRSPIVERAEA-KAISESEMIPAEPVTVILSEMGWVRCAKGHDIDPQGLNYKAGDKY 535

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
                  ++   + + + G++Y L   +L S R  GE +   + L     +    + +  
Sbjct: 536 LAHACGKSSQPAVFIDSSGRSYALDPLSLPSARSQGEPLTGKLTLPAGASVDYLLIENEN 595

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENR 668
            +LL+ S  G  FI +  ++IA  + GK  + +    K+   K +   T   VA+    R
Sbjct: 596 QQLLMASDAGYGFICKFEDLIARNKAGKAVISLPENAKVLPPKNIENSTALLVALTAAGR 655

Query: 669 KLLIFSIDQIPEMSRGKGVRLQSYKDGGISD-----VICFKICEGLTWIDSAG-RSYNRS 722
            +LIF +  +P +S+GKG ++ +       +     V    I E  + +  +G R     
Sbjct: 656 -MLIFPVKDLPSLSKGKGNKIVTIPAASAKERTDLLVKLLLISENSSLVFHSGKRKITLK 714

Query: 723 ENDLLGWLGKRGGVGSLVPKGF 744
             DL  +  +RG  G+ +P+G 
Sbjct: 715 PEDLQKYRAERGRKGTQLPRGL 736


>gi|50119304|ref|YP_048471.1| DNA topoisomerase IV subunit A [Pectobacterium atrosepticum
           SCRI1043]
 gi|49609830|emb|CAG73264.1| topoisomerase IV subunit A [Pectobacterium atrosepticum SCRI1043]
          Length = 756

 Score =  525 bits (1353), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 280/752 (37%), Positives = 457/752 (60%), Gaps = 35/752 (4%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           +  +  ++++LR   E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A 
Sbjct: 4   MTHDGAESLALRTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLSELGQGTVDYTPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+E+  AA+ L++NP+ S++ LL+++ GPDFPT   I+  R+ + + Y+ GRG  
Sbjct: 184 IPPHNVREVAAAAVMLLENPKASLDDLLQHVQGPDFPTEAEIITPRDEVRKLYQNGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+       +V+T +P+QV  ++++E+IA  + AK++P++ED+RDES  +  
Sbjct: 244 RMRAVWKKED-----GDVVITALPHQVSGAKVLEQIASQMRAKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+VL P++  +D D +M  +F  +D+E  + +NMN++ +   P V  L  IL EWL  R
Sbjct: 299 TRLVLVPRSNRIDMDQVMNHLFATTDLEKSYRVNMNMIGLDGRPSVKGLVEILSEWLVFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ + RR ++R++ + +R+ IL+GLLIA+LNIDE+I IIR ED+PKPV++ +FSL+E Q 
Sbjct: 359 RDTVCRRLNYRLEKVLKRLHILEGLLIAFLNIDEVIHIIRTEDEPKPVLMRQFSLSETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E  +L  E++++ +LL S ++  N I  EI+   + +  
Sbjct: 419 EAILELKLRHLAKLEEMKIRGEQGDLAKERDQLQALLASERKLSNLIKKEIQSDAQAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E   A KA  +   +  EP+T+V+S  GW+RS K H +D + L +K G
Sbjct: 479 D-----RRSPLHERGEA-KAMSEHDFVPSEPVTIVLSEMGWVRSAKGHDIDPTGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           DS + A    +   ++ + + G++Y L   ++ S RG GE +   +       I    + 
Sbjct: 533 DSFRAAAKGKSNQPVVFIDSTGRSYALDPISMPSARGQGEPLTGKLTPPPGATIEQVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH---VAVVG 665
                LL+ S  G  F+   ++++A  R GK  + +    K    +++ G+    +A+  
Sbjct: 593 ADDQPLLMASDAGYGFVCTFNDLVARNRAGKAIITLPDNAKALAPIEIKGEDNLLMAITA 652

Query: 666 ENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWI------DSAGRSY 719
             R +L+F +  +P++S+GKG ++ S     IS     +  + LTW+       S    +
Sbjct: 653 AGR-MLLFPVSDLPQLSKGKGNKIVS-----ISSADFSEGKDRLTWLYLLPPQASVTLYF 706

Query: 720 NRSE-----NDLLGWLGKRGGVGSLVPKGFPR 746
            + +     N+L  + G+RG  G+L+ +G  R
Sbjct: 707 GKRKLVLRPNELQKYQGERGRKGTLL-RGLQR 737


>gi|332968503|gb|EGK07566.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Psychrobacter sp.
           1501(2011)]
          Length = 766

 Score =  525 bits (1352), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 289/763 (37%), Positives = 456/763 (59%), Gaps = 31/763 (4%)

Query: 3   VDNISNSNTLV-EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAM 61
           + NI  S T++  E +   S+    E+ YL YA+  I +RA+P + DG KPV RRII+AM
Sbjct: 4   ISNIPPSATVIPTEAMDTRSVAEFTEQAYLNYAMYVIMDRALPHIADGLKPVQRRIIYAM 63

Query: 62  SEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNI 121
           SE+GL      KKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPLI+GQGN+G+ 
Sbjct: 64  SELGLKSTTKPKKSARTVGDVLGKYHPHGDTACYEAMVLMAQPFSYRYPLITGQGNWGSP 123

Query: 122 DG-DSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGT 180
           D   S AA RYTEA+M+  A  +L  + +  VD++D ++    EPV  P++ PN+L NGT
Sbjct: 124 DDPKSFAAMRYTEAKMSAYANTLLAELAQGTVDWQDNFDGSMQEPVTLPARLPNILLNGT 183

Query: 181 SGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIV 240
           +GIAVGMAT IP HN+ E+  AA+ L+ NPE+S+++L + I  PD PT   I+ S++ + 
Sbjct: 184 TGIAVGMATDIPPHNLNEVVRAAVRLLKNPELSVKQLTQSIPAPDLPTPAEIITSKKDLQ 243

Query: 241 ESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLED 300
             Y  GRG +++RA + V++  +    +++  +PYQV  +++ E+IA+L+I K++P + D
Sbjct: 244 AMYESGRGSYKMRAVYHVDKQEKN--LVIIDALPYQVSGNKIQEQIAKLMIEKKLPWVVD 301

Query: 301 IRDESAED--VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLD 358
           I DES  +   RIVL  ++  +D D +M  +F  +D+ET + +NMN++ +   PQV  L 
Sbjct: 302 IHDESDHENACRIVLELRSTRVDVDRVMSHLFASTDLETSYRVNMNMIGLNGKPQVKNLK 361

Query: 359 GILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMV 418
            IL+EWL  RR+V+ RR  FR+  ID+R+ IL GLLIAYL+IDE+I IIR ED PK  ++
Sbjct: 362 EILEEWLVSRRQVVTRRLLFRLDKIDKRLHILAGLLIAYLHIDEVIRIIREEDDPKTELM 421

Query: 419 SRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACE 478
           +R+ L+E Q +AIL++RLR L +L+E ++++E D L AE+  I  LL++ +   N +   
Sbjct: 422 NRYDLSEVQANAILDIRLRQLARLQEIELRTEKDELEAERAIIQELLDNPESLTNLM--- 478

Query: 479 IREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQA-MIEKEPITVVISNRGWIRSLKSHS 537
              ++E+ +   + G  R +   V R +   L+++ ++  EPIT ++S  GWIR+ K H 
Sbjct: 479 ---IEELEADMKEHGNNRVSPV-VERNEATALKESDLVPSEPITAILSKAGWIRAAKGHD 534

Query: 538 VDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLN 597
           VD + + ++ GDS +  + + + ++I ++ + G++Y + A  L S RG G+ +  ++   
Sbjct: 535 VDAAGMSYRSGDSYQAHIRSKSNEKIYIMDSTGRSYNIDAHTLASARGQGDPLTSVLKPA 594

Query: 598 HNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKV- 656
                      +   ++++ SS+G  FI     +  N + GK  +    + K+  V  + 
Sbjct: 595 SGASFEQLLAGEDEQRIILASSQGYGFINTLGNLETNQKAGKNVINFDQDAKLLKVAYID 654

Query: 657 --------TG------DHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDG-GISDVI 701
                   TG      D +AVV     LLIF ID++PE  RGKG +L + KDG  +  V 
Sbjct: 655 AKPISDEDTGSEAQAQDQIAVVTSAGYLLIFDIDELPEQQRGKGNKLINLKDGEQVIAVT 714

Query: 702 CFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGF 744
                + LT + +  R       DL  + GKRG  G  +P+GF
Sbjct: 715 PIHHSDSLT-VTAGKRHVTLKPMDLANYTGKRGNRGGQLPRGF 756


>gi|238762429|ref|ZP_04623400.1| DNA topoisomerase 4 subunit A [Yersinia kristensenii ATCC 33638]
 gi|238699414|gb|EEP92160.1| DNA topoisomerase 4 subunit A [Yersinia kristensenii ATCC 33638]
          Length = 757

 Score =  525 bits (1352), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 285/746 (38%), Positives = 444/746 (59%), Gaps = 22/746 (2%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L  +  + + L    E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A 
Sbjct: 4   LTHDGAERLPLHTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNNSAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLGELGQGTVDWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+EI +A LALID P  S+E+LLE++ GPDFPT   I+  R+ I + Y+ GRG  
Sbjct: 184 IPPHNVREIAQAVLALIDKPTSSLEELLEFVQGPDFPTEAEIITPRDEIRKIYQNGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+   GS   V+T +P+QV  ++++E+IA  + AK++P++ED+RDES  +  
Sbjct: 244 RMRALWKKED---GS--AVITALPHQVSGAKVLEQIANQMRAKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P+   +D D +M  +F  +D+E  + +NMN++ +   P V  L  IL EWL  R
Sbjct: 299 TRLVIVPRTNRVDLDQVMNHLFATTDLERSYRINMNMIGLDHRPTVKGLVEILTEWLVFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ +  R ++R++ + +R+ IL+GLLIA+LNIDE+I IIR ED+PKP+++  F+++E Q 
Sbjct: 359 RQTVRNRLNYRLEKVLKRLHILEGLLIAFLNIDEVIHIIRTEDEPKPLLMQHFAISETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D L  E++++ +LL S ++    I  EI+     +  
Sbjct: 419 EAILELKLRHLAKLEEVKIRGEQDELAKERDQLQALLASERKLNTLIKKEIQADAAAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E   A KA  +  ++  EP+T+V+S  GW+RS K H +D S L +K G
Sbjct: 479 D-----RRSPLTERGEA-KAMSEHDIVPSEPVTIVLSEMGWVRSAKGHDIDPSGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           DS + A    +   ++ + + G++Y L    L S RG GE +   +       I    + 
Sbjct: 533 DSFRAAARGKSNQPVVFIDSTGRSYALDPLTLPSARGQGEPLTGKLTPPPGATIEQVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG--DHVAVVGE 666
               KLL+ S  G  F+   ++++A  R GKT + +    K    +++ G  D +  +  
Sbjct: 593 PDDQKLLMASDAGYGFVCTFNDLVAKNRAGKTMITLPENAKALPPLEIYGPDDMLLSITA 652

Query: 667 NRKLLIFSIDQIPEMSRGKGVRLQSYK----DGGISDVICFKICEGLTWI--DSAGRSYN 720
             ++L+F +  +PE+S+GKG ++ S        G   ++   +    T I      R   
Sbjct: 653 AGRMLMFPVADLPELSKGKGNKIVSIPAADAAAGKDRLVWLFVLPPQTSITLHFGKRKLT 712

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPR 746
               DL  +  +RG  GS +P+G  R
Sbjct: 713 LRPEDLQKFRAERGRKGSPLPRGLQR 738


>gi|226946369|ref|YP_002801442.1| DNA topoisomerase IV subunit A [Azotobacter vinelandii DJ]
 gi|226721296|gb|ACO80467.1| DNA topoisomerase IV, A subunit [Azotobacter vinelandii DJ]
          Length = 752

 Score =  525 bits (1351), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 280/749 (37%), Positives = 452/749 (60%), Gaps = 23/749 (3%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + V+  SL    E+ YL Y++  I +RA+P + DG KPV RRI++AMSE+GLD  A  KK
Sbjct: 10  DGVERRSLADFTEQAYLNYSMYVIMDRALPHIGDGLKPVQRRIVYAMSELGLDADAKHKK 69

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPLI GQGN+G  D   S AA RYTE
Sbjct: 70  SARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYPLIDGQGNWGAPDDPKSFAAMRYTE 129

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           AR+++ AE++L  + +   D+   ++    EP V P++ PNLL NGT+GIAVGMAT +P 
Sbjct: 130 ARLSRYAEVLLAELGQGTADWVPNFDGTLDEPAVLPARLPNLLLNGTTGIAVGMATDVPP 189

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN++E+  A + L+D P+ ++ +L E+I GPDFPT   IV  R  +++ Y  GRG  R+R
Sbjct: 190 HNLREVAAACVRLLDEPQATVAQLCEHIPGPDFPTEAEIVTPRAELLKIYESGRGTLRMR 249

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           A + VE+       +V+T +P+QV  ++++E+IA  + AK++P++ D+RDES  +   RI
Sbjct: 250 ALYRVED-----GDVVITALPHQVSGAKVLEQIAAQMQAKKLPMVADLRDESDHENPCRI 304

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ P++  +D + LM+ +F  +D+ET + +N+N++ +   PQV  L  +L EWL  R   
Sbjct: 305 VIIPRSNRVDVEGLMQHLFATTDLETSYRVNLNIIGLDGRPQVKNLRALLSEWLEFRVRT 364

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           + RR  FR+  ++RR+ +L+GLLIA+LN+DE+I IIR+ED+PKPV++ RF+L+E Q D I
Sbjct: 365 VRRRLQFRLDKVERRLHLLEGLLIAFLNLDEVIRIIRSEDQPKPVLIERFALSEAQADYI 424

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L+ RLR L +LEE +I+ E + L  E++K+  LL S  +    +  E+    E +  +  
Sbjct: 425 LDTRLRQLARLEEMKIRGEQEALAKERDKLLGLLGSEARLKKLVRKELLADAETYGDA-- 482

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
              RR+   E + A +A  +  ++  EP+TVV+S +GW+R  K H +D +AL +K GD+ 
Sbjct: 483 ---RRSPIVERAEA-RALSETELLPTEPVTVVLSEKGWVRCAKGHDIDPAALSYKSGDTF 538

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
           K A    +    + + + G++Y+L A +L S RG GE +   +            + D  
Sbjct: 539 KAAAQGRSNQYAVFIDSSGRSYSLAAHSLPSARGQGEPLTGRLAPPPGAGFECVLLPDDE 598

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENR 668
              ++ S  G  F+ +  ++ A  + GK  L + +  ++   + +     D +A V    
Sbjct: 599 ALYVLASDAGYGFVAKGEDLQAKNKAGKALLSLPAGARVMAPRPLGDAGSDWLAAVTSEG 658

Query: 669 KLLIFSIDQIPEMSRGKGVRLQSYKDGGIS---DVIC--FKICEGLTWIDSAG-RSYNRS 722
           +LL+F + ++P++++GKG R+ +     ++   + +C    + E  T    AG R+ +  
Sbjct: 659 RLLLFRVAELPQLAKGKGNRIIAIPGARVASREEYLCDFVVLSERATLQLQAGKRTLSLK 718

Query: 723 ENDLLGWLGKRGGVGSLVPKGFPRSGKFL 751
             DL  + G+RGG G+ +P+GF R    L
Sbjct: 719 PADLEHYRGERGGRGNKLPRGFQRVDALL 747


>gi|288940944|ref|YP_003443184.1| DNA topoisomerase IV subunit A [Allochromatium vinosum DSM 180]
 gi|288896316|gb|ADC62152.1| DNA topoisomerase IV, A subunit [Allochromatium vinosum DSM 180]
          Length = 748

 Score =  524 bits (1350), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 288/754 (38%), Positives = 441/754 (58%), Gaps = 25/754 (3%)

Query: 6   ISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMG 65
           + ++     E ++   L+   E+ YL Y++  I +RA+P + DG KPV RRI++AMSE+G
Sbjct: 1   MPDTAIYTAEGLERRPLKDFTEKAYLDYSMYVILDRALPHIGDGLKPVQRRILYAMSELG 60

Query: 66  LDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-D 124
           L   A FKKSAR VG+V+GK HPHGD + Y+++V +AQ F  RYPLI GQGN+G+ D   
Sbjct: 61  LSATAKFKKSARTVGDVLGKFHPHGDSACYEAMVLMAQSFSYRYPLIDGQGNWGSPDDPK 120

Query: 125 SAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIA 184
           S AA RYTE+R+T  AEL+L   D+  +D++  ++    EP + P++ PNLL NG +GIA
Sbjct: 121 SFAAMRYTESRLTPYAELLLAEADQGTIDWQPNFDGTLDEPRLLPARLPNLLLNGATGIA 180

Query: 185 VGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYR 244
           VGMAT IP+HN++E+  A + L+++P+ ++E L+  I  PDFPT   IV   + I++ YR
Sbjct: 181 VGMATDIPAHNLREVARACIHLLEHPDATLEDLVRIIPAPDFPTEAEIVTPADEILKLYR 240

Query: 245 LGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDE 304
            G G  R RAR+  E+       IV+T +PYQV  SR++E+IA    AK++P++ED RDE
Sbjct: 241 TGNGSLRQRARYTREQ-----GDIVITALPYQVSGSRVLEQIAAQFNAKKLPMIEDFRDE 295

Query: 305 SAED--VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILK 362
           S  +   R+V+ P++  +D + LM  +F  +D+E  + +N+N++++   P+VM L  IL 
Sbjct: 296 SDHEYPTRLVIVPRSNRVDVERLMSHLFATTDLERSYRVNLNLIALNGRPRVMDLREILS 355

Query: 363 EWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFS 422
           EWL +R E + RR   R++ +  R+ +L GLLIA+LN+DE+I I+R ED+P+PV++ RF 
Sbjct: 356 EWLIYRTETVRRRLQHRLEKVLERLHLLDGLLIAFLNLDEVIRIVRTEDEPRPVLMERFG 415

Query: 423 LTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREV 482
           LTE Q D +LN RLR L +LEE +I++E   L AE++ +  LL   +     +  EI   
Sbjct: 416 LTEPQADYVLNTRLRQLARLEEMKIRAEQAELAAERDGLQRLLGDERALKGLVRDEIAAD 475

Query: 483 KEIFSKSTDLGRRRTTFCEVSRADKATLQQA-MIEKEPITVVISNRGWIRSLKSHSVDLS 541
            E +  +     RR+   E  RA  A + +  +   EP+TVV+S +GW+R+ K H VD +
Sbjct: 476 AERYGDA-----RRSPLVE--RAAAAAIDETELTPSEPLTVVLSEKGWVRAAKGHEVDAT 528

Query: 542 ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQD 601
            L ++ GD+        +    + L + G++Y LPA    S RG GE +   +D      
Sbjct: 529 TLSYRAGDAFLSLARLRSNQTAVFLDSTGRSYALPAHTFPSARGQGEPLTGRLDPPPGAR 588

Query: 602 IVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVT---G 658
            VT    ++  + L+ S  G  FIV   E+IA  + GK  L +    ++   V++    G
Sbjct: 589 FVTVLGDNAETRYLLASDAGYGFIVRFDELIAKPKGGKAVLTLPDGARLLDPVRIAGIEG 648

Query: 659 DHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDG-----GISDVICFKICEGLTW-I 712
             VA V     LL+F + ++PEM+RGKG ++     G     G   +    + EG    +
Sbjct: 649 SSVAAVTTAGHLLLFPLAELPEMARGKGNKIIGIPAGRAGAEGERLIAVAVVGEGANLTV 708

Query: 713 DSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPR 746
            S  R       DL  + G+RG  G L+P+GF R
Sbjct: 709 LSGKRELTLKPADLALYRGERGRRGKLLPRGFQR 742


>gi|167035954|ref|YP_001671185.1| DNA topoisomerase IV subunit A [Pseudomonas putida GB-1]
 gi|166862442|gb|ABZ00850.1| DNA topoisomerase IV, A subunit [Pseudomonas putida GB-1]
          Length = 752

 Score =  524 bits (1350), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 287/755 (38%), Positives = 452/755 (59%), Gaps = 27/755 (3%)

Query: 6   ISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMG 65
           +S+S  L  + V+  SL    E+ YL Y++  I +RA+P + DG KPV RRI++AMSE+G
Sbjct: 1   MSDSLELSLDGVERRSLADFTEQAYLNYSMYVIMDRALPHIGDGLKPVQRRIVYAMSELG 60

Query: 66  LDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-D 124
           LD  +  KKSAR VG+V+GK HPHGD + Y+++V +AQPF  RY L+ GQGN+G  D   
Sbjct: 61  LDADSKHKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYTLVDGQGNWGAPDDPK 120

Query: 125 SAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIA 184
           S AA RYTEAR+++ AE++L  V +  VD+   ++    EP V P++ PN+L NGT+GIA
Sbjct: 121 SFAAMRYTEARLSRYAEVLLSEVGQGTVDWVPNFDGTLQEPAVLPARLPNILLNGTTGIA 180

Query: 185 VGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYR 244
           VGMAT +P HN++E+  A + L+D P+ +IE+L E+I GPD+PT   IV  R  I++ Y 
Sbjct: 181 VGMATDVPPHNLREVASACVRLLDEPKATIEQLCEHIQGPDYPTEAEIVTPRAEILKMYE 240

Query: 245 LGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDE 304
            GRG  R+RA + VE+       +VVT +P+QV  ++++E+IA  + AK++P++ D+RDE
Sbjct: 241 SGRGSIRMRAVYRVED-----GDVVVTALPHQVSGAKVLEQIAAQMQAKKLPMVADLRDE 295

Query: 305 SAED--VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILK 362
           S  +   RIV+ P++  +D D LM+ +F  +D+E+ + +N+N++ +   PQ+  L  IL 
Sbjct: 296 SDHENPCRIVIIPRSNRVDADELMQHLFATTDLESTYRVNVNIIGLDGRPQLKNLRTILV 355

Query: 363 EWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFS 422
           EWL  R   + RR   R+  +++R+ +L GLL A+LN+DE+I IIR E+ PK  +++RF 
Sbjct: 356 EWLEFRTNTVRRRLQHRLDKVEKRLHLLDGLLTAFLNLDEVIHIIRTEEHPKQALIARFE 415

Query: 423 LTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREV 482
           LTE Q D IL  RLR L +LEE +I+ E D LL E+ K+ +LL S  +    +  E+ + 
Sbjct: 416 LTEIQADYILETRLRQLARLEEMKIRGEQDELLKEQAKLQALLGSEAKLRKLVRSELIKD 475

Query: 483 KEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSA 542
            E +        RR+   E + A KA  +  ++  EP+TVV+S +GW+R  K H +D + 
Sbjct: 476 AETYGDD-----RRSPIVERAEA-KALSENELMPTEPVTVVLSEKGWVRCAKGHDIDATG 529

Query: 543 LHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDI 602
           L +K GD  K A    +    +L+ + G++Y+LPA +L S RG GE +   +        
Sbjct: 530 LSYKAGDGFKAAAAGRSNQFAVLIDSTGRSYSLPAHSLPSARGQGEPLTGRLTPPPGATF 589

Query: 603 VTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGD 659
               + D     +V S  G  F+V+  ++ A  + GK  L + +  K+   + V     D
Sbjct: 590 ECVLLPDDDALYVVASDAGYGFVVKGEDLQAKNKAGKGLLSLPNGAKVMTPRPVADREQD 649

Query: 660 HVAVVGENRKLLIFSIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWI 712
            +A V    +LL+F +  +P++ +GKG ++        + ++  ++D+    I EG T +
Sbjct: 650 WLAAVTTEGRLLVFKVSDLPQLGKGKGNKIIGVPGDRVASREEFVTDLAV--IPEGATLV 707

Query: 713 DSAG-RSYNRSENDLLGWLGKRGGVGSLVPKGFPR 746
             AG R+ +   +DL  + G+RG  GS +P+GF R
Sbjct: 708 LQAGKRTLSLKGDDLEHYKGERGRRGSKLPRGFQR 742


>gi|53805051|ref|YP_113320.1| DNA topoisomerase IV subunit A [Methylococcus capsulatus str. Bath]
 gi|53758812|gb|AAU93103.1| DNA topoisomerase IV, A subunit [Methylococcus capsulatus str.
           Bath]
          Length = 744

 Score =  524 bits (1350), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 294/743 (39%), Positives = 442/743 (59%), Gaps = 23/743 (3%)

Query: 16  NVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKS 75
           N + + LR   E+ YL YA+  I +RA+P + DG KPV RRI++AMSE+GL   +  KKS
Sbjct: 6   NYERIPLRDFTEKAYLDYAMYVILDRALPHIADGLKPVQRRIVYAMSELGLSAQSKPKKS 65

Query: 76  ARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEA 134
           AR VG+V+GK HPHGD + Y+++V +AQPF  RYPLI GQGN+G+ D   S AA RYTEA
Sbjct: 66  ARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLIDGQGNWGSPDDPKSFAAMRYTEA 125

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           R+T  A+ +L  +D   VD+   ++    EP + P++ PNLL NG +GIAVGMAT IP H
Sbjct: 126 RLTPYAQSLLSELDLGTVDWVPNFDGTLEEPQLLPARLPNLLLNGATGIAVGMATDIPPH 185

Query: 195 NVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
           N++E+ EA + LID PE ++E+L   I GPDFP    ++  RE +++ Y+ G G  R+RA
Sbjct: 186 NLREVVEACILLIDRPEATVEELCGCIRGPDFPNEAELITPREELLKLYQTGSGAVRLRA 245

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIV 312
           R+ +E+       IVVT +PYQV  ++L+E+IA  + AK++PL+ED+RDES  +   R+V
Sbjct: 246 RYELED-----GNIVVTALPYQVSGAKLMEQIAAQMQAKKLPLVEDLRDESDHENPTRLV 300

Query: 313 LFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVL 372
           + PK+R ++ + LM  +F  +D+E  + +N+N++ +   PQV  L  IL EWL+ R E +
Sbjct: 301 IMPKSRRVEVEPLMSHLFATTDLERSYRVNLNIIGLNGRPQVKNLREILTEWLSFRTETV 360

Query: 373 FRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAIL 432
            RR   R+  +  R+ IL+GLL+A+L+IDE+IAIIR ED+PKPV+++RF LT+ Q +AIL
Sbjct: 361 RRRLQHRLDKVLARLHILEGLLLAFLDIDEVIAIIRGEDEPKPVLMTRFGLTDLQAEAIL 420

Query: 433 NLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDL 492
            LRLR L +LEE +I+ E + L  E+ +++  L S  +    I  E+R+  E F  +   
Sbjct: 421 ELRLRHLARLEEIKIRGEQEALEQERARLERTLGSRAELDALIKQELRQDAEKFGDA--- 477

Query: 493 GRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLK 552
             RR+      +A +A    A+I  EP+TVV+S +GWIRS K H VD + L ++ GD   
Sbjct: 478 --RRSPIV-ARQASQALDTTALIASEPVTVVLSEKGWIRSAKGHEVDPATLSYRAGDGFL 534

Query: 553 IALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTC 612
            A    +T     L + G++Y+L   +L S RG GE +   ++       V         
Sbjct: 535 CAALGRSTQPAYFLDSTGRSYSLAVHDLPSARGQGEPLTGRLNPPPGAIFVAVLAGSEED 594

Query: 613 KLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVT---GDHVAVVGENRK 669
             L+ +  G  F+V+  E+ +  R GKT L V    K+   ++V    GD +A V    +
Sbjct: 595 WYLLATDGGYGFLVQLGELGSKNRSGKTLLTVPDHAKVMPPLRVANPDGDRLAFVSAQGR 654

Query: 670 LLIFSIDQIPEMSRGKGVRLQSYKDGGISD-----VICFKICEGLTWIDSAG-RSYNRSE 723
           LL++  ++IP +++GKG +L       +       V    +  G     +AG R+     
Sbjct: 655 LLVYPAEEIPRLNKGKGSKLIQIPPADLEARQDYLVAMAALPAGAALRATAGKRTLTLQP 714

Query: 724 NDLLGWLGKRGGVGSLVPKGFPR 746
            DL  + G RG  G+ +P+GF R
Sbjct: 715 ADLDHYRGSRGRRGNPLPRGFQR 737


>gi|87119249|ref|ZP_01075147.1| DNA topoisomerase IV subunit A [Marinomonas sp. MED121]
 gi|86165640|gb|EAQ66907.1| DNA topoisomerase IV subunit A [Marinomonas sp. MED121]
          Length = 735

 Score =  524 bits (1349), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 279/724 (38%), Positives = 439/724 (60%), Gaps = 23/724 (3%)

Query: 35  LSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSV 94
           +  I +RA+P + DG KPV RRI++AMSE+GL   A +KKSAR VG+V+GK HPHGD + 
Sbjct: 1   MYVILDRALPHIGDGLKPVQRRIVYAMSELGLKATAKYKKSARTVGDVLGKFHPHGDSAC 60

Query: 95  YDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMTQVAELILQGVDEDAVD 153
           Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE+R+++ ++++L+ V +  VD
Sbjct: 61  YEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLSKYSDVLLREVSQGTVD 120

Query: 154 FRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAALALIDNPEIS 213
           +   ++    EP V P++ PNLL NGT+GIAVGMAT +P HN+ E+  A + L++NP   
Sbjct: 121 WVPNFDGTIKEPSVLPARLPNLLLNGTTGIAVGMATDVPPHNLTEVGNACIHLLNNPNSD 180

Query: 214 IEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEI 273
           ++ L+ ++ GPD+PTGG I   R  I + Y  G+G  + RAR+ +EE       IV+ E+
Sbjct: 181 LDDLMNFVQGPDYPTGGEITTPRNDIKKLYETGKGQIKARARYEMEE-----GDIVIKEL 235

Query: 274 PYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIVLFPKNRSLDPDLLMESIFM 331
           P+    S+++E+IA  + AK++P++ D+RDES  +   R+VL PK+  +D + +M  +F 
Sbjct: 236 PHYASGSKILEQIAAQMQAKKLPMIVDLRDESDHENPTRLVLVPKSNRVDVEAVMTHLFA 295

Query: 332 LSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILK 391
            +D+E  + +NMNV+ +  +P V  L   L EWL  R +V+ +R  FR+  +  R+ IL+
Sbjct: 296 STDLERSYRVNMNVIGLDGLPHVKGLKDFLTEWLKFRIDVVRKRLQFRLDKVLNRLHILE 355

Query: 392 GLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSEL 451
           GLL+A+LNIDE+I IIRNE+KPK  ++ RF LT+ Q +AIL L+LR L KLEE +IK E 
Sbjct: 356 GLLVAFLNIDEVIEIIRNEEKPKVELMLRFGLTDIQAEAILELKLRHLAKLEEMRIKGEQ 415

Query: 452 DNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQ 511
           D L  E++++++LL S ++    I+ EI+E  +          RRT   E  +  +A  +
Sbjct: 416 DELEKERKQLEALLGSDRKLKKLISEEIQEAVDAHGDE-----RRTPIVE-RKESQAFSE 469

Query: 512 QAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGK 571
           + ++  +P+TVVIS +GWIRS K H VD  AL++K GD   I+    +   ++LL+++G+
Sbjct: 470 EDLLSNDPVTVVISKQGWIRSAKGHDVDPLALNYKSGDEFSISCKGRSNQTLVLLASNGR 529

Query: 572 AYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEI 631
           +Y++ A  L S RG GE I   I L  +  IV A +       L+ S  G  FI +  ++
Sbjct: 530 SYSIKAHTLPSARGQGEPITGRISLEKDVTIVAAMLNADNTFYLIASDAGYGFIAKLGDL 589

Query: 632 IANTRKGKTFLKVSSEEKMKLVVKVT---GDHVAVVGENRKLLIFSIDQIPEMSRGKGVR 688
            A  + GK  L + +  K+   + V+     H+ V     ++L F  D +P+M++GKG +
Sbjct: 590 HAKNKAGKATLTLPTSAKVLTPISVSDPASSHIVVTSNEGRMLAFKADSLPQMAKGKGNK 649

Query: 689 LQSYKDGGISD------VICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPK 742
           + S +    +        +   + + L    S  R  + ++ DL  +LG+RG  G  +P+
Sbjct: 650 MISIQASRAASHEEYVVAMASVLADDLLQAHSGKRFMSFTQKDLNEYLGERGRRGLKLPR 709

Query: 743 GFPR 746
           GF R
Sbjct: 710 GFQR 713


>gi|270263145|ref|ZP_06191415.1| DNA topoisomerase 4 subunit A [Serratia odorifera 4Rx13]
 gi|270042833|gb|EFA15927.1| DNA topoisomerase 4 subunit A [Serratia odorifera 4Rx13]
          Length = 757

 Score =  524 bits (1349), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 287/752 (38%), Positives = 449/752 (59%), Gaps = 34/752 (4%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L  + V+ + L    E  YL Y++  I +RA+P + DG KPV RRII+AMSE+GL+  A 
Sbjct: 4   LTHDGVERLPLHTFTENAYLNYSMYVIMDRALPYIGDGLKPVQRRIIYAMSELGLNNSAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLAELGQGTVDWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+E+  A +ALID P   +E+LLE++ GPDFPT   I+  R+ I + Y+ GRG  
Sbjct: 184 IPPHNVREVAAAVVALIDKPGAGLEELLEFVQGPDFPTEAEIITPRDEIRKIYQNGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+   GS   V+T +P+QV  ++++E+IA  + AK++P++ED+RDES  +  
Sbjct: 244 RMRAIWKKED---GS--AVITALPHQVSGAKVLEQIASQMRAKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P++  +D D +M  +F  +D+E  + +NMN++ +   PQV  L  IL EWLA R
Sbjct: 299 TRLVIVPRSNRIDLDQVMNHLFATTDLERSYRINMNMIGLDNRPQVKGLVEILTEWLAFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ + RR ++R++ + +R+ IL+GLL+A+LNIDE+I IIR+ED+PKPV++ RF +++ Q 
Sbjct: 359 RDTVRRRLNYRLEKVLKRLHILEGLLVAFLNIDEVIHIIRSEDEPKPVLMQRFGISDTQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE++I+ E D L  E++ + +LL S ++    I  EI+   + +  
Sbjct: 419 EAILELKLRHLAKLEEFKIRGEQDELAKERDHLQALLASERKLNTLIKKEIQADAQAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E + A KA  +   +  EP+T+V+S  GW+RS K H +D S L +K G
Sbjct: 479 D-----RRSPITERAEA-KAMSEHDFVPSEPVTIVLSEMGWVRSAKGHDIDPSGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           DS + A    T   ++ + + G++Y L    L S RG GE +   +       I    + 
Sbjct: 533 DSYRSAARGKTNQPVVFIDSTGRSYALDPLTLPSARGQGEPLTGKLTPPPGATIEQVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH---VAVVG 665
               KLL+ S  G  F+   ++++A  R GK  + +    K    +++ GD    +++  
Sbjct: 593 ADDQKLLMASDAGYGFVCTFNDLVARNRAGKAMITLPDNAKALAPMEIHGDDDMLLSITA 652

Query: 666 ENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTW-----------IDS 714
             R +L+F +  +P++S+GKG ++ S     I         + LTW           +  
Sbjct: 653 AGR-MLLFPVADLPQLSKGKGNKIVS-----IPAAQAASGEDKLTWLFVLPPQTSVTLHV 706

Query: 715 AGRSYNRSENDLLGWLGKRGGVGSLVPKGFPR 746
             R       DL  +  +RG  G+ +P+G  R
Sbjct: 707 GKRKLTLRPEDLQKFRAERGRKGTSLPRGLQR 738


>gi|285018777|ref|YP_003376488.1| DNA topoisomerase iv subunit a protein [Xanthomonas albilineans GPE
           PC73]
 gi|283473995|emb|CBA16496.1| probable dna topoisomerase iv subunit a protein [Xanthomonas
           albilineans]
          Length = 747

 Score =  524 bits (1349), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 284/735 (38%), Positives = 439/735 (59%), Gaps = 21/735 (2%)

Query: 20  VSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIV 79
           + LR   E  YL Y++  + +RA+P L DG KPV RRI++AMSE+GL+  A  KKSAR V
Sbjct: 15  LPLREYAERAYLDYSMYVVLDRALPFLGDGLKPVQRRIVYAMSELGLNAAAKPKKSARTV 74

Query: 80  GEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMTQ 138
           G+VIGK HPHGD + Y++LV +AQPF  RYPLI GQGNFG+ D   S AA RYTE+++T 
Sbjct: 75  GDVIGKYHPHGDSACYEALVLMAQPFSYRYPLIEGQGNFGSTDDPKSFAAMRYTESKLTP 134

Query: 139 VAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQE 198
           +AE++L  + +  VD+   ++    EP   P++ P+LL NGT+GIAVGMAT +P HN+ E
Sbjct: 135 IAEVLLGELGQGTVDWSPNFDGTMDEPTWMPARLPHLLLNGTTGIAVGMATDVPPHNLNE 194

Query: 199 ICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCV 258
           I  A + L+D+P+ SI  L E++ GPD+P+   I+     +   Y  G G  R RA +  
Sbjct: 195 IVSALIRLLDDPDASISDLCEHVRGPDYPSTAEIITPIADLRTIYATGHGSVRARATYEK 254

Query: 259 EEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDES--AEDVRIVLFPK 316
           E        IVVT +PYQV  S++IE+IA+ + AK++P LEDIRDES  A  VR+VL P+
Sbjct: 255 ENAN-----IVVTALPYQVSPSKVIEQIAQQMRAKKLPWLEDIRDESDHANPVRVVLVPR 309

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           +  +D + LM  +F  +D+E  + +N+NV+ +   PQV  L  +L+EWL  R + + RR 
Sbjct: 310 SNRVDAEHLMGHLFATTDLERSYRINLNVIGLDGRPQVKNLKTLLEEWLRFRSDTVVRRL 369

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
           + R++ ++RR+ +L+GLL+A+LN+DE+I IIR+ED+PKP +++RF+L+E Q D IL  RL
Sbjct: 370 NHRLEKVERRLHLLEGLLVAFLNLDEVIRIIRSEDEPKPALIARFALSEEQTDYILETRL 429

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           R L +LEE +I+ E D L  E+E++ ++L S K +  ++  +     E+ + +   G  R
Sbjct: 430 RQLARLEEMKIRGEQDALAKEREQLQAVLAS-KTKLKKLIKD-----ELIADAKKFGDAR 483

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
            +      A +A  +  ++  EP+T+V+S +GWIR+ KSH VD + L +++GDSL  A+ 
Sbjct: 484 RSPLVQREAAQAIDETELVPSEPMTIVMSEKGWIRAAKSHDVDPAGLAYRDGDSLLAAVR 543

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
             +T ++  L ++G+AY+  A  L S RG+GE +                  ++  ++++
Sbjct: 544 GRSTQQVAFLDSEGRAYSTLAHTLPSARGNGEPLTGRFSPAAGAAFQALATGENDTRVVL 603

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENRKLLIF 673
            SS G  FI     + +  + GK  L ++   K+     V     D +  V     LL F
Sbjct: 604 ASSHGYGFITRFENLTSRNKAGKAMLNLTPNAKVLAPATVGNADTDRIVAVTSAGHLLAF 663

Query: 674 SIDQIPEMSRGKG---VRLQSYKDGGISDVICFKICEGLTWIDSAG-RSYNRSENDLLGW 729
            +  +PE+ +GKG   + +   K G    V    +  G T +  +G R+ + S  DL  +
Sbjct: 664 PVADLPELDKGKGNKIIDIPKAKLGTERVVAIAAVTPGNTLLVKSGQRTMSLSFKDLDAY 723

Query: 730 LGKRGGVGSLVPKGF 744
           LG R   G L+P+G+
Sbjct: 724 LGARASRGGLLPRGW 738


>gi|300311159|ref|YP_003775251.1| DNA topoisomerase IV subunit A [Herbaspirillum seropedicae SmR1]
 gi|300073944|gb|ADJ63343.1| DNA topoisomerase IV (subunit A) protein [Herbaspirillum
           seropedicae SmR1]
          Length = 771

 Score =  524 bits (1349), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 284/696 (40%), Positives = 417/696 (59%), Gaps = 34/696 (4%)

Query: 18  KAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSAR 77
           ++++L    E  YL YA+S +K RA+PD+ DG KPV RRI++AM+E+ L+  A  +KSA 
Sbjct: 18  ESLTLSTFAERAYLDYAISVVKGRALPDVADGQKPVQRRILYAMNELSLNSAAKPRKSAA 77

Query: 78  IVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMT 137
           +VG+V+GKLHPHGDQSVYD+LVR+AQ F  RYPLI G GNFG+ DGD AAA RYTEAR+T
Sbjct: 78  VVGDVLGKLHPHGDQSVYDALVRMAQDFSLRYPLIDGHGNFGSRDGDGAAAMRYTEARLT 137

Query: 138 QVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQ 197
            +++L+L  +D   V+F+  Y+    EP + P++ P LL NG SGIAVGMAT IPSHN+ 
Sbjct: 138 PISKLLLDEIDMGTVEFQPNYDGSTEEPRLLPARLPFLLLNGASGIAVGMATEIPSHNLT 197

Query: 198 EICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWC 257
           E+ +AA+A+I NP+IS  +L+E I GPDFP GG I+  + +I E Y+ GRG  +VRARW 
Sbjct: 198 EVAKAAVAMIRNPKISHAELMELIPGPDFPGGGQIITPQATIAEMYQSGRGSLKVRARWK 257

Query: 258 VEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELI-----IAKR-------------IPLLE 299
           +E++ RG W  V+TE+P  V   R++E+I EL      + K+             + LL+
Sbjct: 258 IEDLARGQWQAVITELPPGVSSQRVLEEIEELTNPKVKLGKKSLTPEQQAQKAAILGLLD 317

Query: 300 DIRDESAED--VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPL 357
            +RDES  D  VR+V  PK+++ D    M ++   + +ET   LN+ ++     P+   L
Sbjct: 318 AVRDESGRDAPVRLVFEPKSKNQDQTEFMNTLLAQTSLETSASLNLVMIGGDGRPRQKNL 377

Query: 358 DGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVM 417
             IL EW++ R E + RR+ FRMQ ++ R+ IL+G     LNID++I IIR  D+PKP +
Sbjct: 378 TDILSEWISFRFETVTRRTQFRMQKVNDRIHILEGREAVLLNIDKVIRIIRESDEPKPAL 437

Query: 418 VSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIAC 477
           +  F L++ Q + IL +RLR L +LE  +I+ EL  L  EK  +  LL+      N  + 
Sbjct: 438 IEAFRLSDRQAEDILEIRLRQLARLEAIKIQQELAELRNEKSTLQDLLD------NPSSM 491

Query: 478 EIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHS 537
           +   +KEI   +   G  R T  E   A++AT +Q +I+ EP+TV+IS +GW+R+   H 
Sbjct: 492 KKLVIKEIEGDAKTYGDARRTIIE--EAERATFEQKVID-EPVTVIISQKGWVRARTGHG 548

Query: 538 VDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLN 597
            D +   FK GDSL  A    T D +L   ++G+ YT+    L + RG G  +  L++L 
Sbjct: 549 HDATQFTFKAGDSLYGAFECRTVDNLLAFGSNGRVYTIAVNALPNARGDGVPVTTLLELA 608

Query: 598 HNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLV---V 654
               I+  F   +   LL+ S     FI + S++    + GK+F  +  E  + L    V
Sbjct: 609 SGSSILHYFAGPADTTLLLASDAAAGFIAKASDMFGRVKGGKSFFTL-DEGALPLAPTPV 667

Query: 655 KVTGDHVAVVGENRKLLIFSIDQIPEMSR-GKGVRL 689
                 VA V  N +LL+F +D++  +S  G+GV L
Sbjct: 668 PTDASAVACVSGNGRLLVFGLDEMKTLSSGGRGVNL 703


>gi|145597764|ref|YP_001161840.1| DNA topoisomerase IV subunit A [Yersinia pestis Pestoides F]
 gi|145209460|gb|ABP38867.1| DNA topoisomerase IV subunit A [Yersinia pestis Pestoides F]
          Length = 757

 Score =  524 bits (1349), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 284/746 (38%), Positives = 445/746 (59%), Gaps = 22/746 (2%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L  +  + + L    E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A 
Sbjct: 4   LTHDGAERLPLHTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNNSAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLGELAQGTVDWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+EI +A LALID P  S+++LLE++ GPDFPT   I+  R+ I + Y+ GRG  
Sbjct: 184 IPPHNVREIAQAVLALIDKPTTSLDELLEFVQGPDFPTEAEIITPRDDIRKIYQNGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+   GS   V+T +P+QV  ++++E+IA  + AK++P++ED+RDES  +  
Sbjct: 244 RMRAVWKKED---GS--AVITALPHQVSGAKVLEQIANQMRAKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P+   +D D +M  +F  +D+E  + +NMN++ +   P V  L  IL EWL  R
Sbjct: 299 TRLVIVPRTNRVDLDQVMSHLFATTDLERSYRINMNMIGLDNRPSVKGLLEILTEWLVFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ +  R +FR++ + +R+ IL+GLLIA+LNIDE+I IIR ED PKP+++ RFS++E Q 
Sbjct: 359 RQTVRNRLNFRLEKVLKRLHILEGLLIAFLNIDEVIHIIRTEDDPKPLLMQRFSISETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D L  E++++ +LL S ++    I  EI+     +  
Sbjct: 419 EAILELKLRHLAKLEEVKIRGEQDELAKERDQLQALLASERKLNTLIKKEIQADAAAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E   A KA  +  ++  EP+T+V+S  GW+RS K H +  S L +K G
Sbjct: 479 D-----RRSPLTERGEA-KAMSEHDIVPSEPVTIVLSEMGWVRSAKGHDIAPSGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           DS + A    +   ++ + + G++Y L    L S RG GE +   +       I    + 
Sbjct: 533 DSFRAAARGMSNQPVVFIDSTGRSYALDPLTLPSARGQGEPLTGKLTPPPGATIEHVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG--DHVAVVGE 666
             + KLL+ S  G  F+   ++++A  R GKT + +    K+   +++ G  D +  +  
Sbjct: 593 PDSQKLLMASDAGYGFVCTFNDLVAKNRAGKTMITLPENAKVLPPLEIYGPDDMLLSITA 652

Query: 667 NRKLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVICFKIC---EGLTWIDSAGRSYN 720
             ++L+F +  +PE+S+GKG   V + + +     D + +      +    +    R   
Sbjct: 653 VGRMLMFPVADLPELSKGKGNKIVSIPAAQAAAGEDRLAWLFVLPPQTSITLHFGKRKLT 712

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPR 746
               DL  +  +RG  GS +P+G  R
Sbjct: 713 LRPEDLQKFRAERGRKGSPLPRGLQR 738


>gi|238789170|ref|ZP_04632958.1| DNA topoisomerase 4 subunit A [Yersinia frederiksenii ATCC 33641]
 gi|238722702|gb|EEQ14354.1| DNA topoisomerase 4 subunit A [Yersinia frederiksenii ATCC 33641]
          Length = 757

 Score =  523 bits (1348), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 282/746 (37%), Positives = 446/746 (59%), Gaps = 22/746 (2%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L  +  + + L    E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A 
Sbjct: 4   LTHDGAERLPLHTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNNSAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLGELGQGTVDWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+EI +A +ALID P  S+++LLE++ GPDFPT   I+  R+ I + Y+ GRG  
Sbjct: 184 IPPHNVREIAQAVIALIDKPATSLDELLEFVQGPDFPTEAEIITPRDEIRKIYQNGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+   GS   V+T +P+QV  ++++E+IA  + AK++P++ED+RDES  +  
Sbjct: 244 RMRALWKKED---GS--AVITALPHQVSGAKVLEQIASQMRAKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P+   +D D +M  +F  +D+E  + +NMN++ +   P V  L  IL EWL  R
Sbjct: 299 TRLVIVPRTNRVDLDQVMNHLFATTDLERSYRINMNMIGLDHRPSVKGLLEILTEWLVFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ +  R ++R++ + +R+ IL+GLLIA+LNIDE+I IIR ED+PKP+++  F+++E Q 
Sbjct: 359 RQTVRNRLNYRLEKVLKRLHILEGLLIAFLNIDEVIHIIRTEDEPKPLLMQHFAISETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D L  E++++ +LL S ++    I  EI+     +  
Sbjct: 419 EAILELKLRHLAKLEEMKIRGEQDELAKERDQLQALLASERKLNTLIKKEIQADAAAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E   A KA  +  ++  EP+T+V+S  GW+RS K H +D + L +K G
Sbjct: 479 D-----RRSPLTERGEA-KAMSEHDIVPSEPVTIVLSEMGWVRSAKGHDIDPTGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           DS + A    +   ++ + + G++Y L    L S RG GE +   +       I    + 
Sbjct: 533 DSFRAAARGKSNQPVVFIDSTGRSYALDPLTLPSARGQGEPLTGKLTPPPGATIEQVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG--DHVAVVGE 666
             + KLL+ S  G  F+   ++++A  R GKT + +    K+   +++ G  D +  +  
Sbjct: 593 PDSQKLLMASDAGYGFVCTFNDLVAKNRAGKTMITLPENAKVLPPLEIYGPDDMLLSITA 652

Query: 667 NRKLLIFSIDQIPEMSRGKGVRLQSYK----DGGISDVICFKICEGLTWI--DSAGRSYN 720
             ++L+F +  +PE+S+GKG ++ S        G   ++   +    T I      R   
Sbjct: 653 AGRMLMFPVADLPELSKGKGNKIVSIPAADAAAGKDRLVWLFVLPPQTSITLHFGKRKLT 712

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPR 746
               DL  +  +RG  GS +P+G  R
Sbjct: 713 LRPEDLQKFRAERGRKGSPLPRGLQR 738


>gi|85058253|ref|YP_453955.1| DNA topoisomerase IV subunit A [Sodalis glossinidius str.
           'morsitans']
 gi|84778773|dbj|BAE73550.1| DNA topoisomerase IV subunit A [Sodalis glossinidius str.
           'morsitans']
          Length = 757

 Score =  523 bits (1348), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 277/745 (37%), Positives = 446/745 (59%), Gaps = 24/745 (3%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L  +  + ++L    E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A 
Sbjct: 4   LTHDGAERLALHKFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNANAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           +KKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYP++ GQGN+G  D   S AA R
Sbjct: 64  YKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPMVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSRYAEVLLGELGQGTVDYVPNFDGTLDEPKMLPARLPNVLLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV E+  AA+AL+ NP  ++E+LLE++ GPDFPT   I+  ++ + + Y  GRG  
Sbjct: 184 IPPHNVNEVAAAAIALLGNPAATLEQLLEHVKGPDFPTEAEIITPQDDLRKIYHTGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W VE+        V++ +P+QV  ++++E+IA  + AK++P++ED+RDES  +  
Sbjct: 244 RMRALWTVED-----GEAVISALPHQVSGAKVLEQIANQMRAKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P++  +D   +M  +F  +D+E  + +NMN++ +   P V  L  IL EWL +R
Sbjct: 299 TRLVIVPRSNRVDLTQVMNHLFATTDLERSYRVNMNMIGLDGRPAVKNLHEILSEWLVYR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ + RR +FR++ + RR+ IL GLL+AYLN+DE+I IIR +D+PK V++ RF L+E Q 
Sbjct: 359 RDTVRRRLNFRLEKVLRRLHILTGLLVAYLNLDEVIHIIRTKDEPKQVLMQRFELSETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           DAIL L+LR L KLEE +++ E D L  E++KI ++L S ++  N +  EI      +  
Sbjct: 419 DAILELKLRHLAKLEEMKLRGEQDELEKERDKIQAILASERKLSNLLKKEIEADDAAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
           +     RR+   E   A KA  +  ++  EP+TV++S  GW+RS K H +D S L ++ G
Sbjct: 479 A-----RRSPLIERGEA-KALSENELMPSEPVTVILSTMGWVRSAKGHDIDPSGLGYRSG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           D+   ++   +   ++ + + G++Y L    L S RG GE +   + L     +      
Sbjct: 533 DNYLSSVRGKSNQPVVFIDSTGRSYALEPACLPSARGQGEPLTGKLTLPPGAAVEQMLTG 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG--DHVAVVGE 666
               KLL+ S  G  F+   S+++A  R GK  L +    K+   + + G  D +  + E
Sbjct: 593 ADERKLLMASDAGYGFVCSFSDLVARNRAGKALLTLPENAKVMPPLWLNGAADKLLALTE 652

Query: 667 NRKLLIFSIDQIPEMSRGKGVRLQSYKDGG-------ISDVICFKICEGLTWIDSAGRSY 719
             +LL+F +D +P++S+GKG ++ S            ++ +        +T+     +  
Sbjct: 653 AGRLLMFPVDDLPQLSKGKGNKIISIPSADAAAGKDRLAGLYLLSTKASVTFYVGKRKLT 712

Query: 720 NRSENDLLGWLGKRGGVGSLVPKGF 744
            R E DL  +  +RG  G+L+P+G 
Sbjct: 713 LRPE-DLQKFSAERGRKGTLLPRGL 736


>gi|237807238|ref|YP_002891678.1| DNA topoisomerase IV subunit A [Tolumonas auensis DSM 9187]
 gi|237499499|gb|ACQ92092.1| DNA topoisomerase IV, A subunit [Tolumonas auensis DSM 9187]
          Length = 759

 Score =  523 bits (1347), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 276/746 (36%), Positives = 452/746 (60%), Gaps = 26/746 (3%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           E V+   LR   E+ YL Y++  I +RA+P + DG KPV RRI++AMSE+GL   +  KK
Sbjct: 9   EGVERQPLRTFTEQAYLNYSMYVIMDRALPHIADGLKPVQRRIVYAMSELGLSALSKHKK 68

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE
Sbjct: 69  SARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTE 128

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           AR+++ +EL+L  +++  V+++  ++    EP + P++ P++L NG +GIAVGMAT IP 
Sbjct: 129 ARLSRFSELLLSELEQGTVEWQPNFDGTMQEPQILPARLPHILLNGITGIAVGMATDIPP 188

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV+E+ +A + L++ P+ +I  LLE++ GPD+PT   I+  R  I + Y  G+G  + R
Sbjct: 189 HNVREVAQACITLLERPDATISDLLEHVQGPDYPTKAEIITPRSEIRKIYESGKGSIKAR 248

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           A + +E+       IV+T +P+Q   +++IE+IA  + AK++P++ D+RDES  +   R+
Sbjct: 249 AVYHMED-----GDIVITALPHQASGAKIIEQIANQMQAKKLPMVSDLRDESDHENPTRL 303

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ P++  +D + LM+ +F  +D+E  + +N+N+L M   PQV  L  IL EWLA RRE 
Sbjct: 304 VIIPRSNRIDVEQLMQHLFASTDLEKSYRVNLNMLGMDHRPQVKNLLTILTEWLAFRRET 363

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           + RR  FR+  +  R+ IL GLLIAYLNIDE+IAIIRNED+PK  ++ RF L+E Q DAI
Sbjct: 364 VRRRLQFRLDKVLNRLHILDGLLIAYLNIDEVIAIIRNEDEPKKELMRRFGLSEIQADAI 423

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L+L+LR L KLEE++I+ E D L  E++++++LL S ++  N +  EI+   E +     
Sbjct: 424 LDLKLRHLAKLEEFKIRGEQDELAKERDQLEALLGSARKLGNLLKKEIQADAEKYGDD-- 481

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
              RR+   E   A + T ++ +   E +TVV+S  GW+R+ K H VD+  L++K GD  
Sbjct: 482 ---RRSPLVERQEAKQLT-EKELTPSELVTVVVSEMGWVRAAKGHDVDVQGLNYKAGDGY 537

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
            ++    +  + + ++  G+ Y+L A  L S RG GE +   +     +      + +  
Sbjct: 538 LVSAQGRSNQQTVFMTNLGRTYSLEAHTLPSARGQGEPLTGKLSFTAGEQTRYVLLGNED 597

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENR 668
            + L+ S  G  F+ E +++I+  + GK  L +    ++   +L  K   D + +V  N 
Sbjct: 598 ERYLICSDAGYGFLCEYNDLISKNKNGKALLTLPEGAQVLPPQLTAKQDDDALCLVISNE 657

Query: 669 -KLLIFSIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSYN 720
            ++L+F ++ +P++ +GKG +L        + ++  ++ V   K  + +T + +  R   
Sbjct: 658 GRMLLFPLNTLPQLGKGKGNKLIGIPADKVASREEFVTHVAVVKADQAVT-LYAGKRKLT 716

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPR 746
               D++ + G+RG  G+ +P+G  R
Sbjct: 717 LKPADMVLYHGERGRRGAKLPRGLQR 742


>gi|317493407|ref|ZP_07951828.1| DNA topoisomerase IV [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918350|gb|EFV39688.1| DNA topoisomerase IV [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 759

 Score =  523 bits (1347), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 274/746 (36%), Positives = 445/746 (59%), Gaps = 22/746 (2%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L+ +  +  +L    E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A 
Sbjct: 4   LIHDGSERQALHTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNNSAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP   P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLGELGQGTVDYTPNFDGTLQEPKTLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+E+ +A + LID P ++++ +LE++ GPD+PT   I+  RE I + YR GRG  
Sbjct: 184 IPPHNVRELAKALVELIDKPSMTLDDILEHVQGPDYPTEAEIITPREEIRKIYRTGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+       +V++ +P+Q   ++++E+IA  + AK++P++ED+RDES  +  
Sbjct: 244 RMRAIWKKED-----GEVVISALPHQTSGAKVLEQIASQMRAKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P++  +D D +M  +F  +D+E  + +NMN++ +   P V  L  IL EWLA+R
Sbjct: 299 TRLVIVPRSNRVDMDQVMAHLFATTDLEKSYRINMNMIGLDNRPAVKNLLEILTEWLAYR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ + RR ++R++ + +R+ IL+GLL+A+LNIDE+I IIR ED+PKP ++ RF ++E Q 
Sbjct: 359 RDTVRRRLNYRLEKVLKRLHILEGLLVAFLNIDEVIHIIRTEDEPKPKLIERFGISETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D L  E++ + +LL S ++    I  EI+   + +  
Sbjct: 419 EAILELKLRHLAKLEEVKIRGEQDELAKERDHLQALLASERKLNTLIKKEIQADAQAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E   A KA  +   I  EP+T+V+S  GW+RS K H +D + L +K G
Sbjct: 479 D-----RRSPLQEREEA-KAMSEHDFIPSEPVTIVLSEGGWVRSAKGHDIDPTGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           DS + A    +   ++ + + G++Y L    L S RG GE +   +       I    + 
Sbjct: 533 DSFRAAARGKSNQPVVFIDSTGRSYALDPTTLPSARGQGEPLTGKLTPPPGATIEQVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG--DHVAVVGE 666
               KLL+ S  G  F+   ++++A  R GK  + +    K    +++ G  D +  + +
Sbjct: 593 ADDQKLLMASDAGYGFVCTFNDLVARNRAGKAMITLPENAKALPPIEINGADDMLLAITQ 652

Query: 667 NRKLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVICFKIC---EGLTWIDSAGRSYN 720
             ++L+F ++ +P++S+GKG   V + S +     D + +      +    +    R   
Sbjct: 653 AGRMLMFPVNDLPQLSKGKGNKIVSIPSAQAASGEDKLAWLFVLPPQTSITVHVGKRKLV 712

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPR 746
               +L  +  +RG  G+L+P+G  R
Sbjct: 713 MKPQELQKFRAERGRKGTLLPRGLQR 738


>gi|238782862|ref|ZP_04626891.1| DNA topoisomerase 4 subunit A [Yersinia bercovieri ATCC 43970]
 gi|238716285|gb|EEQ08268.1| DNA topoisomerase 4 subunit A [Yersinia bercovieri ATCC 43970]
          Length = 757

 Score =  523 bits (1347), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 283/746 (37%), Positives = 441/746 (59%), Gaps = 22/746 (2%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L  +  + + L    E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL   A 
Sbjct: 4   LTHDGAERLPLHTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLSNSAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLGELGQGTVDWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+EI +A +ALID P  S+E+LLE++ GPDFPT   I+  R  I + Y  GRG  
Sbjct: 184 IPPHNVREIAQAVIALIDKPATSLEELLEFVQGPDFPTEAEIITPRNEIRKIYENGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+   GS   V+T +P+QV  ++++E+IA  + AK++P++ED+RDES  +  
Sbjct: 244 RMRALWKKED---GS--AVITALPHQVSGAKVLEQIASQMRAKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P+   +D D +M  +F  +D+E  + +NMN++ +   P V  L  IL EWL  R
Sbjct: 299 TRLVIVPRTNRVDLDQVMNHLFATTDLERSYRINMNMIGLDHRPTVKGLLEILTEWLVFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ +  R ++R++ + +R+ IL+GLLIA+LNIDE+I IIR ED+PKP+++  F+++E Q 
Sbjct: 359 RQTVRNRLNYRLEKVLKRLHILEGLLIAFLNIDEVIHIIRTEDEPKPLLMQHFAISETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D L  E++++ +LL S ++    I  EI+     +  
Sbjct: 419 EAILELKLRHLAKLEEVKIRGEQDELAKERDQLQALLASERKLNTMIKKEIQADAAAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E + A KA     ++  EP+T+V+S  GW+RS K H +D S L +K G
Sbjct: 479 D-----RRSPLTERAEA-KAMSDHDIVPSEPVTIVLSEMGWVRSAKGHDIDPSGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           DS + A    +   ++ + + G++Y L    L S RG GE +   +       I    + 
Sbjct: 533 DSFRAAARGMSNQPVVFIDSTGRSYALDPLTLPSARGQGEPLTGKLTPPPGATIEQVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG--DHVAVVGE 666
               KLL+ S  G  F+   ++++A  R GKT + +    K    +++ G  D +  +  
Sbjct: 593 PDDQKLLMASDAGYGFVCTFNDLVAKNRAGKTMITLPENAKALPPLEIYGPDDMLLSITA 652

Query: 667 NRKLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVICFKIC---EGLTWIDSAGRSYN 720
             ++L+F +  +PE+S+GKG   V + S +     D + +      +    +    R   
Sbjct: 653 AGRMLMFPVADLPELSKGKGNKIVSIPSAQAAAGEDRLAWLFVLPPQTSVTLHFGKRKLT 712

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPR 746
               DL  +  +RG  GS +P+G  R
Sbjct: 713 LRPEDLQKFRAERGRKGSPLPRGLQR 738


>gi|254516085|ref|ZP_05128145.1| DNA topoisomerase IV, A subunit [gamma proteobacterium NOR5-3]
 gi|219675807|gb|EED32173.1| DNA topoisomerase IV, A subunit [gamma proteobacterium NOR5-3]
          Length = 749

 Score =  523 bits (1346), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 285/754 (37%), Positives = 449/754 (59%), Gaps = 26/754 (3%)

Query: 6   ISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMG 65
           +S+++++ ++ ++ +SL+   E+ YL Y++  I +RA+P + DG KPV RRI++AMSE+G
Sbjct: 1   MSDTSSIDDDGIEGISLKQYAEKAYLDYSMYVILDRALPHIGDGLKPVQRRIVYAMSELG 60

Query: 66  LDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-D 124
           L   A +KKSAR VG+VIGK HPHGD + Y+++V +AQ F  RYPL+ GQGN+G  D   
Sbjct: 61  LKSTAKYKKSARTVGDVIGKFHPHGDSAAYEAMVLMAQNFSYRYPLVDGQGNWGAPDDPK 120

Query: 125 SAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIA 184
           S AA RYTE+R+T  A+++L  + +  VD+   ++    EP + P++ PN+L NGT+GIA
Sbjct: 121 SFAAMRYTESRLTAYADVLLGELGQGTVDWVPNFDGTMDEPSLLPAQVPNILLNGTTGIA 180

Query: 185 VGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYR 244
           VGMAT IP HN++E+  AA+ L+D P+ S+ +L E I GPDFPT   I+   + I + Y 
Sbjct: 181 VGMATDIPPHNLREVVTAAITLLDAPKTSLAELCEIIKGPDFPTEAEIITPPQDIAQIYA 240

Query: 245 LGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDE 304
            GRG  R+RA W +E        IVV+ +P+Q   SR++E+IA+ + AK++P++ D+RDE
Sbjct: 241 TGRGSLRMRAVWELEH-----GDIVVSALPHQASGSRVLEQIAQQMQAKKLPMVADLRDE 295

Query: 305 SAED--VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILK 362
           S  +   R+V+ P++  +D + LM  +F  +D+E  + +N+N++     P V  LDGIL 
Sbjct: 296 SDHENPTRLVIVPRSNRIDREGLMSHLFATTDLERTYRVNLNMIGTDGRPGVRSLDGILN 355

Query: 363 EWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFS 422
           +WL  RR+ + RR S+R++ ++RR+ IL+G L+AYLNIDE+I IIR E+ PK  ++ RF 
Sbjct: 356 QWLKFRRDTVRRRLSYRLERVERRLHILQGYLVAYLNIDEVIHIIRTEEHPKQALMQRFE 415

Query: 423 LTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREV 482
           +++ Q +AIL L+LR+L KLEE +I+ E D L  E+E ++  L S  +    I  E+  +
Sbjct: 416 ISDVQAEAILELKLRNLAKLEEMKIRGEQDELEKEREWLEKTLGSDARLKTLIKKELTAI 475

Query: 483 KEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSA 542
            E +        RR+       A +A  +  ++  +PITVV+S +GWIR+ K H +D + 
Sbjct: 476 AEKYGDD-----RRSPLASREEA-RAFSELELMTADPITVVLSEKGWIRAAKGHDMDPAT 529

Query: 543 LHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDI 602
           L +K GDS K+A    +    +++ + G+AYTL   NL S RG GE +   I+       
Sbjct: 530 LSYKSGDSFKLAARGRSNQPAVIIDSTGRAYTLATHNLPSARGQGEPLTGRINPPSGAGF 589

Query: 603 VTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVT--GDH 660
               + D+  + L+ S  G  F+   +E+    R GK  L + +  K+   V +      
Sbjct: 590 DGLMMGDNEQRCLLASDAGYGFVTTLAELQTKNRAGKAALSLPAGAKVVSPVPINEGAQW 649

Query: 661 VAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISD-------VICFKICEGLT-WI 712
           VA V    +LL+F +  +P +SRGKG ++ +       D           K  +GLT W 
Sbjct: 650 VAAVSNEGRLLLFPLADLPSLSRGKGNKIIAIPGPRARDREEYVVATAVLKDDDGLTVWA 709

Query: 713 DSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPR 746
                +  R+E D   + G+RG  G+ +P+GF R
Sbjct: 710 GKRHLTLKRAELD--HYRGERGRRGNKLPRGFQR 741


>gi|238028238|ref|YP_002912469.1| DNA topoisomerase IV subunit A [Burkholderia glumae BGR1]
 gi|237877432|gb|ACR29765.1| DNA topoisomerase IV, A subunit [Burkholderia glumae BGR1]
          Length = 774

 Score =  523 bits (1346), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 290/703 (41%), Positives = 425/703 (60%), Gaps = 32/703 (4%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           E    ++L    E  YL YA+S +K RA+PD+ DG KPV RRI++AM+EMGL   A   K
Sbjct: 17  EGGDVLTLGHYAESAYLGYAVSVVKGRALPDVCDGQKPVQRRILYAMNEMGLGNNAKPVK 76

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEA 134
           SAR+VG+V+GK HPHGDQS YD+LVRLAQ F  RYPLI GQGNFG+ DGD AAA RYTEA
Sbjct: 77  SARVVGDVLGKYHPHGDQSAYDALVRLAQDFSMRYPLIDGQGNFGSRDGDGAAAMRYTEA 136

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           R+T +A+L+L  +D+  VDF   Y+    EP + P++ P +L NG SGIAVG+AT IPSH
Sbjct: 137 RLTPIAQLLLDEIDQGTVDFMPNYDGSFDEPKLLPARLPFVLLNGASGIAVGLATEIPSH 196

Query: 195 NVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
           N++EI  AA+ALI NP+++  +L++ + GPDFP GG I+ S   I  +Y  GRG  +VRA
Sbjct: 197 NLREIAAAAVALIRNPKLTHAELMQIVPGPDFPGGGQIISSDAEIAAAYETGRGSLKVRA 256

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAK------------------RIP 296
           RW +E++ RG W +VVTE+P      +++E+I EL   K                   + 
Sbjct: 257 RWKIEDLARGQWQLVVTELPPNTSGQKVLEEIEELTNPKIKAGKKTLSPEQVNTKKTMLD 316

Query: 297 LLEDIRDESAED--VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQV 354
           LL+ +RDES +D  VR+V  PK+RSLD    ++S+   + +E+  PLN+ ++     P  
Sbjct: 317 LLDAVRDESGKDAPVRLVFEPKSRSLDQAEFVQSLLAHTSLESNAPLNLVMIGNDGRPAQ 376

Query: 355 MPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPK 414
             L  IL EW+  R+  L RR   R+  +D R+ IL+G +I +LNIDE+I IIR  D+PK
Sbjct: 377 KGLGTILGEWVRFRQLTLTRRCRHRLGKVDDRIHILEGRMIVFLNIDEVIRIIRESDEPK 436

Query: 415 PVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQ 474
             ++S F LTE Q D IL +RLR L +LE+ +I+ EL+ L AEK K++ LL       N+
Sbjct: 437 AALMSAFGLTERQADDILEIRLRQLARLEKIKIEKELEELRAEKAKLEELLA------NE 490

Query: 475 IACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLK 534
            A +   +KEI   +   G  R T  +  +  +AT  +A +  EP+TVV+S +GW+R+LK
Sbjct: 491 SAMKRLMIKEIEGDAKQYGDDRRTLIQQEK--RATF-EAKVVDEPVTVVVSQKGWVRALK 547

Query: 535 SHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLI 594
            H +D ++  FK GD L  A    T D ++   + G+ +++P   L  GRG G  +  LI
Sbjct: 548 GHGLDPASFTFKAGDGLYAAFQCRTPDVLIAWGSKGRVHSVPVQVLPGGRGDGVPVTSLI 607

Query: 595 DLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKV--SSEEKMKL 652
           +L     ++  F  ++  +LL+ SS G  FI +  ++++  + GK F+ +   +E    +
Sbjct: 608 ELESGTHLMHYFAANAEQQLLLASSNGFGFIAKLGDMVSRVKAGKAFMTIDEGAEPLAPM 667

Query: 653 VVKVTGDHVAVVGENRKLLIFSIDQIPEMSR-GKGVRLQSYKD 694
            V      VA +    +LL+F +D++  +S  G+GV L + +D
Sbjct: 668 PVMPLATQVACLSGQGRLLVFGLDEMKTLSAGGRGVILMALED 710


>gi|197364044|ref|YP_002143681.1| DNA topoisomerase IV subunit A [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197095521|emb|CAR61086.1| topoisomerase IV subunit A [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 752

 Score =  522 bits (1345), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 274/739 (37%), Positives = 449/739 (60%), Gaps = 25/739 (3%)

Query: 20  VSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIV 79
           ++L   +E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A FKKSAR V
Sbjct: 8   LALHEFMENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAKFKKSARTV 67

Query: 80  GEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMTQ 138
           G+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE+R+++
Sbjct: 68  GDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLSK 127

Query: 139 VAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQE 198
            AEL+L  + +   D+   ++    EP + P++ PN+L NGT+GIAVGMAT IP HN++E
Sbjct: 128 YAELLLSELGQGTADWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLRE 187

Query: 199 ICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCV 258
           + +AA+ LI+ P+ ++++LL+ + GPD+PT   I+  R  I + Y  GRG  R+RA W  
Sbjct: 188 VAKAAITLIEQPKTTLDQLLDIVQGPDYPTEAEIITPRAEIRKIYENGRGSVRMRAVWTK 247

Query: 259 EEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIVLFPK 316
           E+       +V+T +P+QV  ++++E+IA  I  K++P+++D+RDES  +   R+V+ P+
Sbjct: 248 ED-----GAVVITALPHQVSGAKVLEQIAAQIRNKKLPMVDDLRDESDHENPTRLVIVPR 302

Query: 317 NRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRS 376
           +  +D + +M  +F  +D+E  + +N+N++ +   P V  L  IL EWLA RR+ + RR 
Sbjct: 303 SNRVDMEQVMNHLFATTDLEKSYRINLNMIGLDGRPAVKNLLEILTEWLAFRRDTVRRRL 362

Query: 377 SFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL 436
           ++R++ + +R+ IL+GLL+A+LNIDE+I IIRNED+PKP ++SRF ++E Q +AIL L+L
Sbjct: 363 NYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEPKPALMSRFGISETQAEAILELKL 422

Query: 437 RSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRR 496
           R L KLEE +I+ E D L  E++++  +L S ++    +  E++   + +        RR
Sbjct: 423 RHLAKLEEMKIRGEQDELEKERDQLQGILASERKMNTLLKKELQADSDAYGDD-----RR 477

Query: 497 TTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALH 556
           +   E   A KA  +  M+  EP+T+V+S  GW+RS K H +D   L++K GDS K A+ 
Sbjct: 478 SPLREREEA-KAMSEHDMLPSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAVK 536

Query: 557 AHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLV 616
             +   ++ + T G++Y +    L S RG GE +   + L     +    +     KLL+
Sbjct: 537 GKSNQPVVFIDTTGRSYAIDPITLPSARGQGEPLTGKLTLPPGATVEHMLMEGDDQKLLM 596

Query: 617 VSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGDHVAVVGENRKLLIFS 674
            S  G  F+   ++++A  R GKT + +     +   LV+K   D +  + +  ++L+F 
Sbjct: 597 ASDAGYGFVCTFNDLVARNRAGKTLITLPENAHVMPPLVIKDEHDMLLAITQAGRMLMFP 656

Query: 675 IDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLL 727
           +D +P++S+GKG ++        +  D G++ +        LT I    R       +L 
Sbjct: 657 VDSLPQLSKGKGNKIINIPSAEAAKGDDGLAHLYVLPPQSTLT-IHVGKRKIKLRPEELQ 715

Query: 728 GWLGKRGGVGSLVPKGFPR 746
             +G+RG  G+L+ +G  R
Sbjct: 716 KVVGERGRRGTLM-RGLQR 733


>gi|71057503|emb|CAJ18964.1| topoisomerse IV subunit [Salmonella enterica subsp. enterica
           serovar Paratyphi A]
          Length = 752

 Score =  522 bits (1344), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 276/740 (37%), Positives = 449/740 (60%), Gaps = 29/740 (3%)

Query: 23  RFALEE----RYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARI 78
           R AL E     YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A FKKSAR 
Sbjct: 7   RLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAKFKKSART 66

Query: 79  VGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMT 137
           VG+V+GK HPHGD++ Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE+R++
Sbjct: 67  VGDVLGKYHPHGDRACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLS 126

Query: 138 QVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQ 197
           + AEL+L  + +   D+   ++    EP + P++ PN+L NGT+GIAVGMAT IP HN++
Sbjct: 127 KYAELLLSELGQGTADWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLR 186

Query: 198 EICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWC 257
           E+ +AA+ LI+ P+ ++++LL+ + GPD+PT   I+  R  I + Y  GRG  R+RA W 
Sbjct: 187 EVAKAAITLIEQPKTTLDQLLDIVQGPDYPTEAEIITPRAEIRKIYENGRGSVRMRAVWT 246

Query: 258 VEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIVLFP 315
            E+       +V+T +P+QV  ++++E+IA  I  K++P+++D+RDES  +   R+V+ P
Sbjct: 247 KED-----GAVVITALPHQVSGAKVLEQIAAQIRNKKLPMVDDLRDESDHENPTRLVIVP 301

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           ++  +D + +M  +F  +D+E  + +N+N++ +   P V  L  IL EWLA RR+ + RR
Sbjct: 302 RSNRVDMEQVMNHLFATTDLEKSYRINLNMIGLDGRPAVKNLLEILTEWLAFRRDTVRRR 361

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
            ++R++ + +R+ IL+GLL+A+LNIDE+I IIRNED+PKP ++SRF ++E Q +AIL L+
Sbjct: 362 LNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEPKPALMSRFGISETQAEAILELK 421

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LR L KLEE +I+ E D L  E++++  +L S ++    +  E++   + +        R
Sbjct: 422 LRHLAKLEEMKIRGEQDELEKERDQLQGILASERKMNTLLKKELQADSDAYGDD-----R 476

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           R+   E   A KA  +  M+  EP+T+V+S  GW+RS K H +D   L++K GDS K A+
Sbjct: 477 RSPLREREEA-KAMSEHDMLPSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAV 535

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
              +   ++ + T G++Y +    L S RG GE +   + L     +    +     KLL
Sbjct: 536 KGKSNQPVVFIDTTGRSYAIDPITLPSARGQGEPLTGKLTLPPGATVEHMLMEGDDQKLL 595

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGDHVAVVGENRKLLIF 673
           + S  G  F+   ++++A  R GKT + +     +   LV+K   D +  + +  ++L+F
Sbjct: 596 MASDAGYGFVCTFNDLVARNRAGKTLITLPENAHVMPPLVIKDEHDMLLAITQAGRMLMF 655

Query: 674 SIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDL 726
            +D +P++S+GKG ++        +  D G++ +        LT I    R       +L
Sbjct: 656 PVDSLPQLSKGKGNKIINIPSAEAAKGDDGLAHLYVLPPQSTLT-IHVGKRKIKLRPEEL 714

Query: 727 LGWLGKRGGVGSLVPKGFPR 746
              +G+RG  G+L+ +G  R
Sbjct: 715 QKVVGERGRRGTLM-RGLQR 733


>gi|293394327|ref|ZP_06638627.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Serratia odorifera DSM
           4582]
 gi|291423305|gb|EFE96534.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Serratia odorifera DSM
           4582]
          Length = 757

 Score =  521 bits (1343), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 290/748 (38%), Positives = 454/748 (60%), Gaps = 26/748 (3%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L  + V+ + L    E  YL Y++  I +RA+P + DG KPV RRII+AMSE+GL+  A 
Sbjct: 4   LTHDGVERLPLHTFTENAYLNYSMYVIMDRALPYIGDGLKPVQRRIIYAMSELGLNNSAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLAELGQGTVDWVPNFDGTLQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+E+  AA+ALID P  S+++LLE++ GPDFPT   I+  R+ I + Y+ GRG  
Sbjct: 184 IPPHNVREVAAAAVALIDKPGASLDELLEFVQGPDFPTEAEIITPRDEIRKIYQNGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+   GS   V+T +P+QV  ++++E+IA  + AK++P++ED+RDES  +  
Sbjct: 244 RMRAVWKKED---GS--AVITALPHQVSGAKVLEQIASQMRAKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P++  +D + +M  +F  +D+E  + +NMN++ +   P V  L  I+ EWLA R
Sbjct: 299 TRLVIVPRSNRVDLEQVMNHLFATTDLERSYRVNMNMIGLDNRPSVKGLVEIITEWLAFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ + RR ++R++ + +R+ IL+GLLIA+LNIDE+I IIR+ED+PKPV++ RF ++E Q 
Sbjct: 359 RDTVRRRLNYRLEKVLKRLHILEGLLIAFLNIDEVIHIIRSEDEPKPVLMQRFGISETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D L  E++++ +LL S ++    I       KEI + 
Sbjct: 419 EAILELKLRHLAKLEEMKIRGEQDELAKERDQLQALLASERKLNTLIK------KEIQAD 472

Query: 489 STDLG-RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKE 547
           S   G  RR+   E + A KA  +   +  EP+T+V+S  GW+RS K H +D S L +K 
Sbjct: 473 SLAYGDERRSPLTERAEA-KAMSEHDFVPSEPVTIVLSEMGWVRSAKGHDIDPSGLSYKA 531

Query: 548 GDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFV 607
           GD+ + A    T   ++ + + G++Y L    L S RG GE +   +       I    +
Sbjct: 532 GDTFRAAARGKTNQPVVFIDSTGRSYALDPLTLPSARGQGEPLTGKLTPPPGATIEQVIM 591

Query: 608 YDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGEN 667
                KLL+ S  G  F+   ++++A  R GK  + +    K    +++ GD   ++   
Sbjct: 592 AADDQKLLMASDAGYGFVCTFNDLVARNRAGKVMITLPENAKALPPMEIHGDDDMLLSIT 651

Query: 668 R--KLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVICFKIC----EGLTWIDSAGRS 718
           +  ++L+F +  +P++S+GKG   V + S +     DV+ +         LT +    R 
Sbjct: 652 KAGRMLMFPVADLPQLSKGKGNKIVSIPSAQAASGEDVLSWLFVLPPQTSLT-LHVGKRK 710

Query: 719 YNRSENDLLGWLGKRGGVGSLVPKGFPR 746
                 DL  +  +RG  G+L+P+G  R
Sbjct: 711 LTLRPEDLQKFRAERGRKGTLLPRGLQR 738


>gi|120555698|ref|YP_960049.1| DNA topoisomerase IV subunit A [Marinobacter aquaeolei VT8]
 gi|120325547|gb|ABM19862.1| DNA topoisomerase IV subunit A [Marinobacter aquaeolei VT8]
          Length = 768

 Score =  521 bits (1343), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 278/747 (37%), Positives = 446/747 (59%), Gaps = 24/747 (3%)

Query: 13  VEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAF 72
            +E  + VSLR   E+ YL Y++  I +RA+P++ DG KPV RRI++AMSE+GL   + +
Sbjct: 7   TDEGFERVSLRDYTEKAYLDYSMYVILDRALPNVGDGLKPVQRRIVYAMSELGLKSTSKY 66

Query: 73  KKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRY 131
           KKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G+ D   S AA RY
Sbjct: 67  KKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGSPDDPKSFAAMRY 126

Query: 132 TEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSI 191
           TE+R+   AE++L  + +  VD+   ++    EP V P++ P++L NGT+GIAVGMAT I
Sbjct: 127 TESRLAPFAEVLLSELGQGTVDWVPNFDGTMEEPSVLPARLPHVLLNGTTGIAVGMATDI 186

Query: 192 PSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFR 251
           P HNV+E+  A + L+D P+ S+++L E+I GPDFPT   I+  R+ + + Y  GRG  R
Sbjct: 187 PPHNVREVTAACIRLLDQPDASVDELCEHIKGPDFPTRAEIITPRKDLRQMYETGRGSLR 246

Query: 252 VRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--V 309
           +RARW      R +  +V+T++P+QV  +R++E+IA+ +  K++P++ D+RDES  +   
Sbjct: 247 MRARWI-----RENGEVVITDLPHQVSGNRVLEQIAQQMQTKKLPMVADLRDESDHENPT 301

Query: 310 RIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRR 369
           R+V+ P++  +D D LM  +F  +D+E  + +N+NV+     P V  L  IL EWLA R+
Sbjct: 302 RLVIVPRSNRVDLDGLMAHLFASTDLEKTYRVNINVIGNDGRPGVKGLYTILTEWLAFRK 361

Query: 370 EVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVD 429
             + RR   R+  +  R+ +L+GLLIAYLNIDE+I IIR EDKPK  +++RF L+  Q +
Sbjct: 362 TTVTRRLQHRLDKVLARLHLLEGLLIAYLNIDEVIEIIRTEDKPKAELMARFGLSAEQAE 421

Query: 430 AILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKS 489
           AIL L+LR L KLEE +I+ E D L AE++++ ++L S  +    I  E+ +  E F   
Sbjct: 422 AILELKLRHLAKLEEMKIRGEQDELSAERDELQAILGSEDRLRELIKTELEQDAETFGDD 481

Query: 490 TDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGD 549
                RR+   E   A +A  +  ++  +P+TVV+S++GW+R+ K H +D + L +K GD
Sbjct: 482 -----RRSPIVEREEA-RAFSETDLVSNDPVTVVLSDKGWVRAAKGHDIDPAGLSYKSGD 535

Query: 550 SLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYD 609
              +A       + + L + G+AY+L A +L S RG GE +   I+           + +
Sbjct: 536 RFALAAKGRNNQQAIFLDSTGRAYSLMAHSLPSARGQGEPLTGRINPPSGATFSGLLMGN 595

Query: 610 STCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGD----HVAVVG 665
              K L+V+  G  F+   +++I+  R GK  + V    ++   V +       ++A + 
Sbjct: 596 PERKTLLVTDGGYGFVTSLNDMISKNRAGKAVVSVPKGARIMPPVMIPETASTLYLAAIS 655

Query: 666 ENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISD----VICFKIC--EGLTWIDSAGRSY 719
              ++L+F + ++PE+++GKG ++ S     + +    V+   +   E    + +  R  
Sbjct: 656 NEGRMLVFPLSELPELAKGKGNKIISIPSARVQNREEYVVAVAVFGEEDQLEVKAGKRKL 715

Query: 720 NRSENDLLGWLGKRGGVGSLVPKGFPR 746
                DL  +LG+RG  G  +P+G  R
Sbjct: 716 GLRFGDLEHYLGERGRRGHKLPRGLQR 742


>gi|262166469|ref|ZP_06034206.1| topoisomerase IV subunit A [Vibrio mimicus VM223]
 gi|262026185|gb|EEY44853.1| topoisomerase IV subunit A [Vibrio mimicus VM223]
          Length = 762

 Score =  521 bits (1342), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 271/681 (39%), Positives = 425/681 (62%), Gaps = 17/681 (2%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + V+ + LR   E+ YL Y++  I +RA+P + DG KPV RRII+AMSE+GL   A +KK
Sbjct: 8   DGVEQLPLRKFTEDAYLNYSMYVIMDRALPYIGDGLKPVQRRIIYAMSELGLSASAKYKK 67

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE
Sbjct: 68  SARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTE 127

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           A++++ AE++L  + +  V+++  ++    EP + P++ P++L NG +GIAVGMAT IP 
Sbjct: 128 AKLSKFAEILLSELGQGTVEWQPNFDGTMQEPKMLPARLPHILLNGVTGIAVGMATDIPP 187

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV+E+ +A + LID+P   +  L++Y+ GPDFPT   I+     + + YR GRG  R+R
Sbjct: 188 HNVREVADATIHLIDHPSAPLTDLMQYVKGPDFPTEAEIITPTVELEKIYRSGRGSVRMR 247

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           A WC E    GS  IV+T +P+QV  ++L+E+IA  + AK++P++ED+RDES  +   RI
Sbjct: 248 AVWCKE----GS-DIVITALPHQVSGAKLLEQIAAQMRAKKLPMVEDLRDESDHENPTRI 302

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ P++  +D DLLM  +F  +D+E  F +N+N++ +   PQV  L  IL EW++ RRE 
Sbjct: 303 VIVPRSNRVDCDLLMNHLFASTDLEKSFRVNLNMIGLDNRPQVKGLVQILSEWISFRRET 362

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           +  R  +R+  +  R+ IL+GLLIAYLNIDE+I IIR ED PK V+++RF LT+ Q DAI
Sbjct: 363 VRSRLQYRLDKVLARLHILQGLLIAYLNIDEVIEIIRTEDDPKAVLMARFDLTDIQADAI 422

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L+ +LR L KLEE +I+ E D L  E++K++ LL S ++  N +  EI+   + F     
Sbjct: 423 LDTKLRHLAKLEEMKIRGEQDELEKERKKLEELLGSERRLNNLLKKEIKADADKFGDD-- 480

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
              RR+   E   A KA  ++ ++  E ITVV+S +GWIR  K H VD  +L++K GD+ 
Sbjct: 481 ---RRSPLVEREEA-KALTERDLMPSEAITVVLSEKGWIRHAKGHDVDCQSLNYKAGDNY 536

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
                  +  + + L +DG++Y+L +  L S RG GE I   +++     I    + +  
Sbjct: 537 LTHACGKSNQQAVFLGSDGRSYSLESHTLPSARGQGEPITGRLNVAEGTSIRQVVMGEED 596

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENR 668
              LV S  G  F+ +  ++++  R GK  + +    ++   +++  +  D +  +    
Sbjct: 597 QLWLVGSDAGYGFVCKGDDLLSKNRSGKALINLPENSEVMTPQVIADLDNDEILAITNQG 656

Query: 669 KLLIFSIDQIPEMSRGKGVRL 689
           ++L+F I  +P++S+GKG ++
Sbjct: 657 RMLLFPIKDLPQLSKGKGNKI 677


>gi|56415115|ref|YP_152190.1| DNA topoisomerase IV subunit A [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|56129372|gb|AAV78878.1| topoisomerase IV subunit A [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
          Length = 752

 Score =  521 bits (1342), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 276/740 (37%), Positives = 448/740 (60%), Gaps = 29/740 (3%)

Query: 23  RFALEE----RYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARI 78
           R AL E     YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A FKKSAR 
Sbjct: 7   RLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAKFKKSART 66

Query: 79  VGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMT 137
           VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE+R++
Sbjct: 67  VGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLS 126

Query: 138 QVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQ 197
           + AEL+L  + +   D+   ++    EP + P++ PN+L NGT+GIAVGMAT IP HN++
Sbjct: 127 KYAELLLSELGQGTADWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLR 186

Query: 198 EICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWC 257
           E+ +AA+ LI+ P+ ++++LL+ + GPD+PT   I+  R  I + Y  GRG  R+RA W 
Sbjct: 187 EVAKAAITLIEQPKTTLDQLLDIVQGPDYPTEAEIITPRAEIRKIYENGRGSVRMRAVWT 246

Query: 258 VEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIVLFP 315
            E+       +V+T +P+QV  ++++E+IA  I  K++P+++D+RDES  +   R+V+ P
Sbjct: 247 KED-----GAVVITALPHQVSGAKVLEQIAAQIRNKKLPMVDDLRDESDHENPTRLVIVP 301

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           ++  +D + +M  +F  +D+E  + +N+N++ +   P V  L  IL EWLA RR+ + RR
Sbjct: 302 RSNRVDMEQVMNHLFATTDLEKSYRINLNMIGLDGRPAVKNLLEILTEWLAFRRDTVRRR 361

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
            ++R++ + +R+ IL+GLL+A+LNIDE+I IIRNED+PKP ++SRF ++E Q +AIL L+
Sbjct: 362 LNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEPKPALMSRFGISETQAEAILELK 421

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LR L KLEE +I+ E D L  E++++  +L S ++    +  E++   + +        R
Sbjct: 422 LRHLAKLEEMKIRGEQDELEKERDQLQGILASERKMNTLLKKELQADSDAYGDD-----R 476

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           R+   E   A KA  +  M+  EP+T+V+S  GW+RS K H +D   L++K GDS K A+
Sbjct: 477 RSPLREREEA-KAMSEHDMLPSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAV 535

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
              +   ++ + T G++Y +    L S RG GE +   + L     +    +     KLL
Sbjct: 536 KGKSNQPVVFIDTTGRSYAIDPITLPSARGQGEPLTGKLTLPPGATVEHMLMEGDDQKLL 595

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGDHVAVVGENRKLLIF 673
           + S  G  F+   ++++A  R GKT + +     +   LV+K   D +  + +  ++L+F
Sbjct: 596 MASDAGYGFVCTFNDLVARNRAGKTLITLPENAHVMPPLVIKDEHDMLLAITQAGRMLMF 655

Query: 674 SIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDL 726
            +D +P++S+GKG ++        +  D G++ +        LT I    R       +L
Sbjct: 656 PVDSLPQLSKGKGNKIINIPSAEAAKGDDGLAHLYVLPPQSTLT-IHVGKRKIKLRPEEL 714

Query: 727 LGWLGKRGGVGSLVPKGFPR 746
              +G+RG  G+L+ +G  R
Sbjct: 715 QKVVGERGRRGTLM-RGLQR 733


>gi|238755472|ref|ZP_04616812.1| DNA topoisomerase 4 subunit A [Yersinia ruckeri ATCC 29473]
 gi|238706313|gb|EEP98690.1| DNA topoisomerase 4 subunit A [Yersinia ruckeri ATCC 29473]
          Length = 757

 Score =  521 bits (1342), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 282/749 (37%), Positives = 444/749 (59%), Gaps = 32/749 (4%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L  +  + + L    E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL   A 
Sbjct: 4   LTHDGAERLPLHTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLSNNAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLGELGQGTVDWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+EI +A +ALID P+ S+E+LLE++ GPDFPT   I+  R+ I + Y+ GRG  
Sbjct: 184 IPPHNVREIAQAVVALIDKPQTSLEELLEFVQGPDFPTDAEIITPRDEIRKIYQNGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+   GS   V+T +P+QV  ++++E+IA  + AK++P++ED+RDES  +  
Sbjct: 244 RMRAVWKKED---GS--AVITALPHQVSGAKILEQIANQMRAKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P+   +D + +M  +F  +D+E  + +NMN++ +   P V  L  IL EWL  R
Sbjct: 299 TRLVIVPRTNRVDMEQVMNHLFATTDLERSYRINMNMIGLDHRPSVKGLMAILTEWLEFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ + +R ++R+  + +R+ IL+GLLIA+LNIDE+I IIR ED+PKP+++  F ++E Q 
Sbjct: 359 RDTVRKRLNYRLDKVLKRLHILEGLLIAFLNIDEVIHIIRTEDEPKPLLMQHFGISETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E + L  E++++ +LL S ++    I  EI+     +  
Sbjct: 419 EAILELKLRHLAKLEEVKIRGEQEELAKERDQLQALLASERKLNTLIKKEIQADALAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E   A KA  +  ++  EP+T+V+S  GW+RS K H +D S L +K G
Sbjct: 479 E-----RRSPLTERGEA-KAMSEHDIVPSEPVTIVLSEMGWVRSAKGHDIDPSGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           DS + A    +   ++ + + G++Y L    L S RG GE +   +       I    + 
Sbjct: 533 DSFRAAARGKSNQPVVFIDSTGRSYALDPLTLPSARGQGEPLTGKLTPPPGATIEQVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG--DHVAVVGE 666
               KLL+ S  G  F+   S+++A  R GK  + +    K    +++ G  D +  +  
Sbjct: 593 PDDQKLLMASDAGYGFVCTFSDLVAKNRAGKAMISLPENAKALTPLEIHGPDDMLLSITA 652

Query: 667 NRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWI------DSAGRSYN 720
             ++L+F +  +PE+S+GKG ++ S     I         +GL W+       S    + 
Sbjct: 653 AGRMLMFPVADLPELSKGKGNKIVS-----IPAAQAAAGEDGLAWLFVLPPQTSVTLYFG 707

Query: 721 RSE-----NDLLGWLGKRGGVGSLVPKGF 744
           + +      DL  +  +RG  GS +P+G 
Sbjct: 708 KRKLILRPEDLQKFRAERGRKGSPLPRGL 736


>gi|262170624|ref|ZP_06038302.1| topoisomerase IV subunit A [Vibrio mimicus MB-451]
 gi|261891700|gb|EEY37686.1| topoisomerase IV subunit A [Vibrio mimicus MB-451]
          Length = 761

 Score =  521 bits (1342), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 271/681 (39%), Positives = 425/681 (62%), Gaps = 17/681 (2%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + V+ + LR   E+ YL Y++  I +RA+P + DG KPV RRII+AMSE+GL   A +KK
Sbjct: 8   DGVEQLPLRKFTEDAYLNYSMYVIMDRALPYIGDGLKPVQRRIIYAMSELGLSASAKYKK 67

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE
Sbjct: 68  SARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTE 127

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           A++++ AE++L  + +  V+++  ++    EP + P++ P++L NG +GIAVGMAT IP 
Sbjct: 128 AKLSKFAEILLSELGQGTVEWQPNFDGTMQEPKMLPARLPHILLNGVTGIAVGMATDIPP 187

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV+E+ +A + LID+P   +  L++Y+ GPDFPT   I+     + + YR GRG  R+R
Sbjct: 188 HNVREVADATIHLIDHPSAPLTDLMQYVKGPDFPTEAEIITPTVELEKIYRSGRGSVRMR 247

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           A WC E    GS  IV+T +P+QV  ++L+E+IA  + AK++P++ED+RDES  +   RI
Sbjct: 248 AVWCKE----GS-DIVITALPHQVSGAKLLEQIAAQMRAKKLPMVEDLRDESDHENPTRI 302

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ P++  +D DLLM  +F  +D+E  F +N+N++ +   PQV  L  IL EW++ RRE 
Sbjct: 303 VIVPRSNRVDCDLLMNHLFASTDLEKSFRVNLNMIGLDNRPQVKGLVQILSEWISFRRET 362

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           +  R  +R+  +  R+ IL+GLLIAYLNIDE+I IIR ED PK V+++RF LT+ Q DAI
Sbjct: 363 VRSRLQYRLDKVLARLHILQGLLIAYLNIDEVIEIIRTEDDPKAVLMARFDLTDIQADAI 422

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L+ +LR L KLEE +I+ E D L  E++K++ LL S ++  N +  EI+   + F     
Sbjct: 423 LDTKLRHLAKLEEMKIRGEQDELEKERKKLEELLGSERRLNNLLKKEIKADADKFGDD-- 480

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
              RR+   E   A KA  ++ ++  E ITVV+S +GWIR  K H VD  +L++K GD+ 
Sbjct: 481 ---RRSPLVEREEA-KALTERDLMPSEAITVVLSEKGWIRHAKGHDVDCQSLNYKAGDNY 536

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
                  +  + + L +DG++Y+L +  L S RG GE I   +++     I    + +  
Sbjct: 537 LTHACGKSNQQAVFLGSDGRSYSLESHTLPSARGQGEPITGRLNVAEGTSIRQVVMGEED 596

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENR 668
              LV S  G  F+ +  ++++  R GK  + +    ++   +++  +  D +  +    
Sbjct: 597 QLWLVGSDAGYGFVCKGDDLLSKNRSGKALINLPENSEVMTPQVIADLDNDEILAITNQG 656

Query: 669 KLLIFSIDQIPEMSRGKGVRL 689
           ++L+F I  +P++S+GKG ++
Sbjct: 657 RMLLFPIKDLPQLSKGKGNKI 677


>gi|119713346|gb|ABL97410.1| DNA topoisomerase IV subunit A [uncultured marine bacterium
           EB80_02D08]
          Length = 752

 Score =  521 bits (1341), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 273/743 (36%), Positives = 458/743 (61%), Gaps = 24/743 (3%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           +E + ++SL+   EE YL YA+  I +RA+P++ DG KPV RRI++AMSE+GLD G+ +K
Sbjct: 4   QEQINSISLKQYAEESYLNYAMYVILDRALPNIGDGLKPVQRRILYAMSELGLDAGSKYK 63

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYT 132
           KSAR VG+VIGK HPHGD + Y+++V +AQ F  +YPL+ GQGN+G+ D   S AA RYT
Sbjct: 64  KSARTVGDVIGKFHPHGDGAAYEAMVLMAQNFSFKYPLVDGQGNWGSQDDPKSFAAMRYT 123

Query: 133 EARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIP 192
           E+++T+ A L++  +    VD++  ++    EPV+FPSK P++L NGTSGIAVGMAT IP
Sbjct: 124 ESKLTKFANLLISELKSGTVDWQPNFDGSLLEPVIFPSKLPSILLNGTSGIAVGMATDIP 183

Query: 193 SHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRV 252
           SHN+ E+ +A + L++NP+  +  LL+ + GPDF     I+ S E + E Y  GRGGF+ 
Sbjct: 184 SHNINEVIDATVHLLENPKSELADLLKIVKGPDFSNHSPIIISTEELEEIYSTGRGGFKA 243

Query: 253 RARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDES--AEDVR 310
           +A W  ++       I++  +PYQ   S+++E+IA+ ++ K+IP++ D+ DE    E VR
Sbjct: 244 QAFWQQDKN-----QIIINALPYQASGSKILEQIADQMVKKKIPMVVDLSDEGDHKEPVR 298

Query: 311 IVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRRE 370
           +V+  K+  ++ + +M  +F  +D++  + +NMN++S+   P+V  L  +LKEWL  R+ 
Sbjct: 299 LVITLKSNRVNAEDVMNHLFASTDLQKNYRVNMNLISLKGGPKVFSLIDLLKEWLVFRKN 358

Query: 371 VLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDA 430
            + R+   R+  ++ R+ IL+GLLI YL++D++I IIR  D+PK  ++  F L++ Q +A
Sbjct: 359 TVIRKLEHRLDQVNDRLHILEGLLIVYLDLDKVIKIIRESDEPKKDIIKAFKLSDIQANA 418

Query: 431 ILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKST 490
           IL +RLR L KLE+ +++ E D LLAE+  I+ +L+S  +    I  E+ E+KE+F +  
Sbjct: 419 ILEIRLRQLAKLEQIKLEQERDTLLAEQTDIEKILSSKTRLKTLIKNELLEIKEVFGE-- 476

Query: 491 DLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDS 550
               R++   E+S A   + ++ ++  EP+TVV+S  GWIRS K H +D S+L ++  D+
Sbjct: 477 ---ERKSPIKELSGAKVFSEEETLV-TEPVTVVLSAAGWIRSAKGHDIDPSSLSYRGEDT 532

Query: 551 LKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDS 610
           L+      +    + L ++GKAY+LP  +L S RG G+ I   +  +     ++  + + 
Sbjct: 533 LQDFRRGKSNQVSVFLDSNGKAYSLPTHSLPSARGMGDPISGRVSADSGVKFISTLIGND 592

Query: 611 TCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH--VAVVGENR 668
             K +++++ G  +I E   +I+N + GK F+K+  + ++   +KV  DH  +A +    
Sbjct: 593 DDKFMIMNTAGYGYISEFKNMISNKKSGKAFMKIPHDAELLKAIKVRNDHMYIAALSNIG 652

Query: 669 KLLIFSIDQIPEMSRGKGVRLQSY-------KDGGISDVICFKICEGLTWIDSAGRSYNR 721
           +LLIF+ID++P + +GKG ++ +        K+  ++          L  I+S  R    
Sbjct: 653 RLLIFNIDELPVLGKGKGNKIINIPTAKFIAKEELMTHAQLLSEASSLR-IESGKRFLTL 711

Query: 722 SENDLLGWLGKRGGVGSLVPKGF 744
              DL  ++  R   G+++P+G+
Sbjct: 712 KLKDLENYISTRAKRGNMLPQGY 734


>gi|126666934|ref|ZP_01737910.1| DNA topoisomerase IV subunit A [Marinobacter sp. ELB17]
 gi|126628650|gb|EAZ99271.1| DNA topoisomerase IV subunit A [Marinobacter sp. ELB17]
          Length = 768

 Score =  521 bits (1341), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 282/753 (37%), Positives = 451/753 (59%), Gaps = 32/753 (4%)

Query: 13  VEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAF 72
            +E  + V+LR   E+ YL Y++  I +RA+P++ DG KPV RRII+AMSE+GL   + +
Sbjct: 7   TDEGFERVALRDYTEKAYLDYSMYVILDRALPNVGDGLKPVQRRIIYAMSELGLKSTSKY 66

Query: 73  KKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRY 131
           KKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G+ D   S AA RY
Sbjct: 67  KKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGSPDDPKSFAAMRY 126

Query: 132 TEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSI 191
           TE+R+ + A+++L  + +   D+   ++    EP + P++ P++L NGT+GIAVGMAT I
Sbjct: 127 TESRLARFADVLLSELGQGTADWVPNFDGTMDEPSILPARLPHVLLNGTTGIAVGMATDI 186

Query: 192 PSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFR 251
           P HNV+E+  A + L+  P+ ++E+L EYI GPD+PT   I+  R+ +++ Y  GRG  R
Sbjct: 187 PPHNVREVTAACVHLLSAPDATVEQLCEYIQGPDYPTRAEIITPRKDLLQMYETGRGSLR 246

Query: 252 VRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--V 309
           +RARW V E G     +V+T++P+QV  +R++E+IA+ + AK++P++ D+RDES  +   
Sbjct: 247 MRARW-VNEGGD----LVITDLPHQVSGNRVLEQIAQQMQAKKLPMVADLRDESDHENPT 301

Query: 310 RIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRR 369
           R+V+ P++  +D + LM  +F  +D+E  + +N+NV+     P V  L  +L EWL  RR
Sbjct: 302 RLVIVPRSNRVDAEGLMAHLFASTDLEKPYRVNINVIGNDGRPGVKGLVQLLTEWLTFRR 361

Query: 370 EVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVD 429
             + RR  +R+  +  R+ +L+GLLIAYLN+DE+I IIR EDKPK  ++ RFSL+ +Q +
Sbjct: 362 ATVIRRLQYRLDKVLARLHLLEGLLIAYLNLDEVIEIIRYEDKPKAELMVRFSLSADQAE 421

Query: 430 AILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKS 489
           AIL L+LR L KLEE +I+ E D L  E++ + S+L S K+    I  E+++  E +   
Sbjct: 422 AILELKLRHLAKLEEMKIRGEQDELAIERDHLQSILGSEKKLRQLIKTELQQDAETYGDD 481

Query: 490 TDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGD 549
                RR+   E   + +A     ++  +P+TVV+S +GW+R+ K H +D   L +K GD
Sbjct: 482 -----RRSPIVERGES-RAFSNIDLVSNDPVTVVLSEKGWVRAAKGHDIDPLGLSYKAGD 535

Query: 550 SLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYD 609
              +  H     +++ L + G+AY L A +L S RG GE +   I+           + D
Sbjct: 536 KFSLQAHGRNNQQVIFLDSTGRAYALMAHSLPSARGQGEPLSGHINPPPGAQFCGLLMGD 595

Query: 610 STCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGD------HV 661
           S  K+++V+  G  F     ++++  R GKT + V     +   ++V V         ++
Sbjct: 596 SQRKVVLVTDGGYGFATSLGDMLSKNRNGKTLVSVPKGAHLMAPVMVPVMAPESRETLYL 655

Query: 662 AVVGENRKLLIFSIDQIPEMSRGKG--------VRLQSYKDGGISDVICFKICEGLTWID 713
           A V    ++L+F + ++PE+ +GKG         R+QS +D  +  V  F   + L  I 
Sbjct: 656 AAVSNEGRMLVFPLTELPELVKGKGNKLISIPSARVQS-RDEFVVAVAVFAHSDQLE-IH 713

Query: 714 SAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPR 746
           +  R  +   +DL  +LG+RG  G  +P+G  R
Sbjct: 714 AGKRKMSLQFSDLEHYLGERGRRGHKLPRGLQR 746


>gi|149377744|ref|ZP_01895478.1| DNA topoisomerase IV subunit A [Marinobacter algicola DG893]
 gi|149357970|gb|EDM46458.1| DNA topoisomerase IV subunit A [Marinobacter algicola DG893]
          Length = 774

 Score =  521 bits (1341), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 285/748 (38%), Positives = 442/748 (59%), Gaps = 26/748 (3%)

Query: 13  VEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAF 72
            +E  + VSLR   E+ YL Y++  I +RA+P++ DG KPV RRII+AMSE+GL   + +
Sbjct: 7   TDEGFERVSLRDYTEKAYLDYSMYVILDRALPNVGDGLKPVQRRIIYAMSELGLKSTSKY 66

Query: 73  KKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRY 131
           KKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RY
Sbjct: 67  KKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRY 126

Query: 132 TEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSI 191
           TE+R+ + A+++L  + +  VD+   ++    EP V P++ P++L NGT+GIAVGMAT I
Sbjct: 127 TESRLAKFADVLLSELGQGTVDWVPNFDGTMDEPSVLPARLPHVLLNGTTGIAVGMATDI 186

Query: 192 PSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFR 251
           P HNV+E+  A + L+D PE + + L E++ GPDFPT   I+  R+ I + Y  GRG  R
Sbjct: 187 PPHNVREVAAACVRLLDQPEATTDDLCEHVQGPDFPTYAEIITPRKDIRQMYETGRGSLR 246

Query: 252 VRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--V 309
           +RARW  E     S  IVVT++P+QV  +R++E+IA+ +  K++P++ D+RDES  +   
Sbjct: 247 MRARWINE-----SGEIVVTDLPHQVSGNRVLEQIAQQMQTKKLPMVADLRDESDHENPT 301

Query: 310 RIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRR 369
           R+V+ P++  +D + LM  +F  +D+E  + +N+NV+     P V  L  +L EWL+ RR
Sbjct: 302 RLVIVPRSNRVDQEGLMAHLFASTDLEKTYRVNINVIGNDGRPGVKGLREMLTEWLSFRR 361

Query: 370 EVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVD 429
             + RR   R+  +  R+ IL+GLL+AYLNIDE+IAIIR EDKPK  ++SRF L+  Q +
Sbjct: 362 TTVTRRLQHRLDKVLARLHILEGLLVAYLNIDEVIAIIRYEDKPKAELMSRFGLSGEQAE 421

Query: 430 AILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKS 489
           AIL L+LR L KLEE +I+ E D L AE++++ S+L S  +    I  E+    E +   
Sbjct: 422 AILELKLRHLAKLEEMKIRGEQDELSAERDELQSILGSEDRLRELIKDELLADAETYGDD 481

Query: 490 TDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGD 549
                RR+   E  R  KA  +  ++  +P+TVV+S +GW+R+ K H ++   L +K GD
Sbjct: 482 -----RRSPIVE-RREAKAFSETELVSNDPVTVVLSEKGWVRAAKGHDIEPEGLSYKAGD 535

Query: 550 SLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYD 609
           +  +A       + + L + G+AY+L A    S RG GE +   I+           + D
Sbjct: 536 AFAMAAKGRNNQQAVFLDSTGRAYSLVAHTFPSARGQGEPLSGRINPPSGATFSGLLMGD 595

Query: 610 STCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEK-MKLVVKVTGD---HVAVVG 665
              ++L+V+  G  F+    ++I+  R GK  + V    K M  VV    D   ++  + 
Sbjct: 596 PARRVLLVTDGGYGFVTSLDDMISKNRNGKAVVSVPKGAKIMSPVVVPNSDKPLYLGAIS 655

Query: 666 ENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISD-------VICFKICEGLTWIDSAGRS 718
              ++L+F + ++PE+++GKG ++ S     + +       V  F   + L  I +  R 
Sbjct: 656 NEGRMLVFPLSELPELAKGKGNKIISIPSARVQNREEYVVAVAVFAEDDQLE-IRAGKRK 714

Query: 719 YNRSENDLLGWLGKRGGVGSLVPKGFPR 746
                +DL  +LG+RG  G  +P+G  R
Sbjct: 715 MGLQFSDLEHYLGERGRRGHKLPRGLQR 742


>gi|258620849|ref|ZP_05715883.1| DNA topoisomerase 4 subunit A [Vibrio mimicus VM573]
 gi|258586237|gb|EEW10952.1| DNA topoisomerase 4 subunit A [Vibrio mimicus VM573]
          Length = 761

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 272/681 (39%), Positives = 424/681 (62%), Gaps = 17/681 (2%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + V+ + LR   E+ YL Y++  I +RA+P + DG KPV RRII+AMSE+GL   A +KK
Sbjct: 8   DGVEQLPLRKFTEDAYLNYSMYVIMDRALPYIGDGLKPVQRRIIYAMSELGLSASAKYKK 67

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE
Sbjct: 68  SARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTE 127

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           A++++ AE++L  + +  V+++  ++    EP + P++ P++L NG +GIAVGMAT IP 
Sbjct: 128 AKLSKFAEILLSELGQGTVEWQPNFDGTMQEPKMLPARLPHILLNGVTGIAVGMATDIPP 187

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV+E+ EA + LID+P   +  L++Y+ GPDFPT   I+     + + YR GRG  R+R
Sbjct: 188 HNVREVAEATIHLIDHPSAPLTDLMQYVKGPDFPTEAEIITPTVELEKIYRSGRGSVRMR 247

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           A WC E    GS  IV+T +P+QV  ++L+E+IA  + AK++P++ED+RDES  +   RI
Sbjct: 248 AVWCKE----GS-DIVITALPHQVSGAKLLEQIAAQMRAKKLPMVEDLRDESDHENPTRI 302

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ P++  +D DLLM  +F  +D+E  F +N+N++ +   PQV  L  IL EW++ RRE 
Sbjct: 303 VIVPRSNRVDCDLLMNHLFASTDLEKSFRVNLNMIGLDNRPQVKGLVQILSEWISFRRET 362

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           +  R  +R+  +  R+ IL+GLLIAYLNIDE+I IIR ED PK V+++RF LT  Q DAI
Sbjct: 363 VRSRLQYRLDKVLARLHILQGLLIAYLNIDEVIEIIRTEDDPKAVLMARFDLTGIQADAI 422

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L+ +LR L KLEE +I+ E D L  E++K++ LL S ++  N +  EI+   + F     
Sbjct: 423 LDTKLRHLAKLEEMKIRGEQDELEKERKKLEELLGSERRLNNLLKKEIKADADKFGDD-- 480

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
              RR+   E   A KA  ++ ++  E ITVV+S +GWIR  K H VD  +L++K GD+ 
Sbjct: 481 ---RRSPLVEREEA-KALTERDLMPSEAITVVLSEKGWIRHAKGHDVDCQSLNYKAGDNY 536

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
                  +  + + L +DG++Y+L +  L S RG GE I   +++     I    + +  
Sbjct: 537 LTHACGKSNQQAVFLGSDGRSYSLESHTLPSARGQGEPITGRLNVAEGTTIRQVVMGEED 596

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENR 668
              LV S  G  F+ +  ++++  R GK  + +    ++   +++  +  D +  +    
Sbjct: 597 QLWLVGSDAGYGFVCKGDDLLSKNRSGKALINLPENSEVMTPQVIADLDNDEILAITNQG 656

Query: 669 KLLIFSIDQIPEMSRGKGVRL 689
           ++L+F I  +P++S+GKG ++
Sbjct: 657 RMLLFPIKDLPQLSKGKGNKI 677


>gi|89092023|ref|ZP_01164978.1| DNA topoisomerase IV subunit A [Oceanospirillum sp. MED92]
 gi|89083758|gb|EAR62975.1| DNA topoisomerase IV subunit A [Oceanospirillum sp. MED92]
          Length = 759

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 282/749 (37%), Positives = 458/749 (61%), Gaps = 23/749 (3%)

Query: 10  NTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFG 69
            T  E+  + ++L+   E+ YL Y++  I +RA+P + DG KPV RRII+AMSE+GL   
Sbjct: 4   QTTFEDGTERLALKDFTEKAYLDYSMYVILDRALPHVGDGMKPVQRRIIYAMSELGLKAS 63

Query: 70  AAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAA 128
           A +KKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G+ D   S AA
Sbjct: 64  AKYKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGSPDDPKSFAA 123

Query: 129 YRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMA 188
            RYTE+R+ + AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMA
Sbjct: 124 MRYTESRLARYAEVLLSEISQGTVDWVPNFDGTMREPAILPARLPNVLLNGTTGIAVGMA 183

Query: 189 TSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRG 248
           T I  HN++E+ +A + L+DNP   ++++ E + GPD PT   I+ SR  + + Y  GRG
Sbjct: 184 TDILPHNLREVAKACVHLLDNPRADLDEITEIVPGPDMPTDAEIITSRRELKKVYETGRG 243

Query: 249 GFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED 308
             R+RA +  E+       I++T +P+QV  ++++E+IA  +  K++P++ D+RDES  +
Sbjct: 244 SVRMRAVYTKEQ-----GEIIITALPHQVSGAKILEQIAAQMQQKKLPMVSDLRDESDHE 298

Query: 309 --VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLA 366
              R+V+ P++  +D + LM  +F  +D+E  + +NMN++ +   PQV  L  IL EWL+
Sbjct: 299 NPTRLVIIPRSNRVDVEQLMAHLFASTDLERTYRVNMNMIGVDGKPQVKDLRQILVEWLS 358

Query: 367 HRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTEN 426
            R E++ +R + R+  +  R+ IL+GL++AYLNIDE+IAIIR+E+ PK  ++ RF LTE 
Sbjct: 359 WRTEIVRKRLNHRLAKVLDRLHILEGLMVAYLNIDEVIAIIRHEEDPKAELIKRFGLTEI 418

Query: 427 QVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIF 486
           Q DAIL+L+LR L KLEE++I+SE + L  E++K++ +L S  +    I  EI++  E +
Sbjct: 419 QADAILDLKLRHLAKLEEFKIQSEQNELEEERKKLEGILGSDAKMRKLIKKEIQDAAEEY 478

Query: 487 SKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFK 546
                   RR+   E   A +A  ++ ++  +P+TVVIS +GWIR+ K H +D   L++K
Sbjct: 479 GDD-----RRSPIVEREEA-QAFSEKDLLSSDPVTVVISKQGWIRAAKGHEIDAVGLNYK 532

Query: 547 EGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAF 606
            GD+ K+A    T    +LL T G+++T+   NL S RG GE +   I L     I  A 
Sbjct: 533 SGDAFKLACKGRTNQPTILLDTTGRSFTIETHNLPSARGQGEPVTGRITLPKGSTIDAAV 592

Query: 607 VYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVT---GDHVAV 663
                 K+L+ S  G  F+ + S++ + T+ GK  L +     +   +KV     D +A 
Sbjct: 593 AGKDADKILMASDAGYGFVAKISDLTSKTKNGKAALTLPKNANIISPIKVATPETDLLAA 652

Query: 664 VGENRKLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVIC--FKICEGLTWIDSAGRS 718
           V    +LL+F + ++PE++RGKG   + + S +     +++     + +  T +  AG+ 
Sbjct: 653 VTNEGRLLVFPVSELPELARGKGNKIINIPSARAAAREELVVALATLSKDDTLMVHAGKQ 712

Query: 719 YNR-SENDLLGWLGKRGGVGSLVPKGFPR 746
           + R   +D+  + G+RG  G+ +P+G+ R
Sbjct: 713 HLRLKPSDIEHYRGERGRRGNKLPRGYQR 741


>gi|148653991|ref|YP_001281084.1| DNA topoisomerase IV subunit A [Psychrobacter sp. PRwf-1]
 gi|148573075|gb|ABQ95134.1| DNA topoisomerase IV subunit A [Psychrobacter sp. PRwf-1]
          Length = 762

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 279/737 (37%), Positives = 441/737 (59%), Gaps = 29/737 (3%)

Query: 27  EERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIGKL 86
           E+ YL YA+  I +RA+P + DG KPV RRII+AMSE+GL      KKSAR VG+V+GK 
Sbjct: 26  EQAYLNYAMYVIMDRALPHIADGLKPVQRRIIYAMSELGLKSTTKPKKSARTVGDVLGKY 85

Query: 87  HPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMTQVAELILQ 145
           HPHGD + Y+++V +AQPF  RYPLISGQGN+G+ D   S AA RYTEA+M+  A  +L 
Sbjct: 86  HPHGDTACYEAMVLMAQPFSYRYPLISGQGNWGSPDDPKSFAAMRYTEAKMSAYANTLLA 145

Query: 146 GVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAALA 205
            + +  VD++D ++    EPV  P++ PN+L NGT+GIAVGMAT IP HN+ E+  AA+ 
Sbjct: 146 ELGQGTVDWQDNFDGSMQEPVTLPARLPNILLNGTTGIAVGMATDIPPHNLNEVVRAAIR 205

Query: 206 LIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRGS 265
           L+ NP++S+++L + I  PD PT   I+ S++ +   Y  GRG +++RA + V++  +  
Sbjct: 206 LLKNPDLSVKQLTQSIPAPDLPTAAEIITSKKDLQAMYETGRGSYKMRAVYHVDQQEKN- 264

Query: 266 WCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIVLFPKNRSLDPD 323
             +++  +PYQV  +++ E+IA+L++ K++P + DI DES  +   RIVL  ++  +D  
Sbjct: 265 -LVIIDALPYQVSGNKVQEQIAKLMMDKKLPWVVDIHDESDHENACRIVLELRSTRVDVA 323

Query: 324 LLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAI 383
            +M  +F  +D+E+ + +NMN++ +   PQV  L  +L+EWL  RR+V+ RR  FR+  I
Sbjct: 324 RVMSHLFASTDLESSYRVNMNMIGLNGKPQVKNLKEVLEEWLISRRQVVTRRVQFRLDKI 383

Query: 384 DRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLE 443
           D+R+ IL GLLIAYLNIDE+I IIR ED PK  ++ ++ L++ Q +AIL++RLR L +LE
Sbjct: 384 DKRLHILAGLLIAYLNIDEVIRIIREEDDPKQELMGKYDLSDIQANAILDIRLRQLARLE 443

Query: 444 EYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVS 503
           E +++SE D L AE+  +  LL++  +   Q+  E     E+ +   + G  R +   V 
Sbjct: 444 EIELRSEKDALEAERATLQELLDN-PESLTQLMIE-----ELEADMKEHGNDRMSSV-VE 496

Query: 504 RADKATLQQA-MIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDR 562
           R +   L+++ ++  EPIT V+S  GWIR+ K H VD   + ++ GDS +  +H+ + ++
Sbjct: 497 REEATALKESDLVPSEPITAVLSKAGWIRAAKGHDVDAKGMSYRSGDSYQAHVHSKSNEK 556

Query: 563 ILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGN 622
           I ++ + G++Y++ A  L S RG G+ +  ++                  ++++ SS+G 
Sbjct: 557 IYIMDSTGRSYSIEAHTLASARGQGDPLTSVLKPPAGASFEQLLAGADDQRIILASSQGY 616

Query: 623 AFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKV--------------TGDHVAVVGENR 668
            FI     +  N + GK  +   ++ K+  V  +              T + +AVV    
Sbjct: 617 GFINTLGNLETNQKAGKNVINFDADAKLLTVATIDKTDSETPDDAQALTQNQIAVVTSAG 676

Query: 669 KLLIFSIDQIPEMSRGKGVRLQSYKDG-GISDVICFKICEGLTWIDSAGRSYNRSENDLL 727
            LLIF +D++PE  RGKG +L + K G  +  VI     + LT I +  R       DL 
Sbjct: 677 YLLIFGVDELPEQQRGKGNKLINLKAGEEVLAVIALNSHDSLT-ITAGKRHVTLKPMDLA 735

Query: 728 GWLGKRGGVGSLVPKGF 744
            +  KRG  G  +P+GF
Sbjct: 736 NYTSKRGNRGGQLPRGF 752


>gi|146305636|ref|YP_001186101.1| DNA topoisomerase IV subunit A [Pseudomonas mendocina ymp]
 gi|145573837|gb|ABP83369.1| DNA topoisomerase IV subunit A [Pseudomonas mendocina ymp]
          Length = 749

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 284/761 (37%), Positives = 455/761 (59%), Gaps = 29/761 (3%)

Query: 6   ISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMG 65
           +S S  L  E V+  SL    E+ YL Y++  I +RA+P + DG KPV RRI++AMSE+G
Sbjct: 1   MSESLDLSLEGVERRSLADFTEQAYLNYSMYVIMDRALPHIGDGLKPVQRRIVYAMSELG 60

Query: 66  LDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-D 124
           LD  A  KKSAR VG+V+GK HPHGD + Y+++V +AQPF  RY L+ GQGN+G  D   
Sbjct: 61  LDADAKHKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYTLVDGQGNWGAPDDPK 120

Query: 125 SAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIA 184
           S AA RYTEAR+++ +E++L  + +  VD+   ++   +EP   P++ PNLL NGT+GIA
Sbjct: 121 SFAAMRYTEARLSRYSEVLLSELGQGTVDWVPNFDGTMNEPATLPARLPNLLLNGTTGIA 180

Query: 185 VGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYR 244
           VGMAT +P HN++E+  A + L+D P  ++E+L E+I GPDFPT   ++  +  +++ Y 
Sbjct: 181 VGMATDVPPHNLREVAAACVRLLDEPGATVEQLCEHIQGPDFPTEAEVITPKADLLKIYE 240

Query: 245 LGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDE 304
            GRG  R+RA + VE+       I+VT +P+QV  ++++E+IA  + AK++P++ D+RDE
Sbjct: 241 SGRGSVRMRAVYRVED-----GDIIVTALPHQVSGAKVLEQIAAQMQAKKLPMVADLRDE 295

Query: 305 SAED--VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILK 362
           S  +   RIV+ P++  +D D LM  +F  +D+E+ + +N NV+ +   PQV  L  +L 
Sbjct: 296 SDHENPTRIVIIPRSNRVDADELMTHLFATTDLESSYRVNTNVIGLDGKPQVKDLRTLLS 355

Query: 363 EWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFS 422
           EWL +R   + RR  FR+  +++R+ +L+GLLIA+LN+DE+I IIR ED+PKPV++  F 
Sbjct: 356 EWLVYRVGTVRRRLQFRLDKVEKRLHLLEGLLIAFLNLDEVIRIIRTEDQPKPVLMEAFG 415

Query: 423 LTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREV 482
           LTE Q D IL+ RLR L +LEE +I+ E D L  E+EK+ +LL S  +    +  EI E 
Sbjct: 416 LTEVQADYILDTRLRQLARLEEMKIRGEQDELAKEREKLLALLGSEAKLKKLVRKEIIED 475

Query: 483 KEIFSKSTDLGRRRTTFCEVSRADKATLQQA-MIEKEPITVVISNRGWIRSLKSHSVDLS 541
            E +        RR+    V+RA+   L +  ++  EP+TVV+S +GW+R  K H +D +
Sbjct: 476 AEKYGDD-----RRSPI--VARAEARALSETELMPTEPVTVVLSEKGWVRCAKGHDIDAT 528

Query: 542 ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQD 601
            L +K GD  K A    +    + + + G++Y+L A +L S RG GE +   +       
Sbjct: 529 GLSYKAGDGFKAAAPGRSNQYAVFIDSTGRSYSLAAHSLPSARGQGEPLTGRLTPPPGAT 588

Query: 602 IVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTG 658
                + + +   ++ S  G  F+V+  ++ A  + GK  L + +  K+   K V  +  
Sbjct: 589 FECVMLPEDSALYVIASDAGYGFVVKGEDLQAKNKAGKALLSLPNGAKVVAPKPVTNLED 648

Query: 659 DHVAVVGENRKLLIFSIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTW 711
           D +A V    +LL+F +  +P++ +GKG ++        + ++  ++D+    +  G + 
Sbjct: 649 DWLAAVTTEGRLLLFKVTDLPQLGKGKGNKIIGIPGERVASREEYLTDLAV--LPSGASL 706

Query: 712 IDSAG-RSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKFL 751
           +  AG R+     +DL  + G+RG  G+ +P+GF R  + L
Sbjct: 707 VLQAGKRTLTLKADDLEHYKGERGRRGNKLPRGFQRVDQLL 747


>gi|238750917|ref|ZP_04612414.1| DNA topoisomerase 4 subunit A [Yersinia rohdei ATCC 43380]
 gi|238710831|gb|EEQ03052.1| DNA topoisomerase 4 subunit A [Yersinia rohdei ATCC 43380]
          Length = 757

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 281/746 (37%), Positives = 444/746 (59%), Gaps = 22/746 (2%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L  +  + + L    E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A 
Sbjct: 4   LTHDGAERLPLHTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNNSAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ A+++L  + +  VD+   ++    EP   P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYADVLLGELGQGTVDWTPNFDGTMQEPKTLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+EI +A +ALID P  S+++LLE++ GPDFPT   I+  R+ I + Y+ GRG  
Sbjct: 184 IPPHNVREIAQAVIALIDKPATSLDELLEFVQGPDFPTEAEIITPRDDIRKIYQNGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+   GS   V+T +P+QV  ++++E+IA  + AK++P++ED+RDES  +  
Sbjct: 244 RMRALWKKED---GS--AVITALPHQVSGAKVLEQIASQMRAKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P+   +D D +M  +F  +D+E  + +NMN++ +   P V  L  IL EWL  R
Sbjct: 299 TRLVIVPRTNRVDLDQVMNHLFATTDLERSYRINMNMIGLDHRPSVKGLLEILTEWLVFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ +  R ++R++ + +R+ IL+GLLIA+LNIDE+I IIR ED+PKP+++  F+++E Q 
Sbjct: 359 RQTVRNRLNYRLEKVLKRLHILEGLLIAFLNIDEVIHIIRTEDEPKPLLMQHFAISETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D L  E++++ +LL S ++    +  EI+     +  
Sbjct: 419 EAILELKLRHLAKLEEVKIRGEQDELAKERDQLQALLASERKLNTLLKKEIQADAAAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E + A KA     ++  EP+T+V+S  GW+RS K H +D + L++K G
Sbjct: 479 D-----RRSPLKERAEA-KAMSDHDIVPSEPVTIVLSEMGWVRSAKGHDIDPTGLNYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           DS + A    +   ++ + + G++Y L    L S RG GE +   +       I    + 
Sbjct: 533 DSFRAAARGMSNQPVVFIDSTGRSYALDPLTLPSARGQGEPLTGKLTPPPGATIEQVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG--DHVAVVGE 666
               KLL+ S  G  F+   +++IA  R GKT + +    K    +++ G  D +  +  
Sbjct: 593 PEHQKLLMASDAGYGFVCTFNDLIAKNRAGKTMITLPENAKALPPLEIYGPDDMLLSITA 652

Query: 667 NRKLLIFSIDQIPEMSRGKGVRLQSYK----DGGISDVICFKICEGLTWI--DSAGRSYN 720
             ++L+F +  +PE+S+GKG ++ S        G   ++   +    T I      R   
Sbjct: 653 AGRMLMFPVADLPELSKGKGNKIVSIPAPDAAAGKDRLVWLFVLPPQTSITLHFGKRKLT 712

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPR 746
               DL  +  +RG  GS +P+G  R
Sbjct: 713 LRPEDLQKFRAERGRKGSPLPRGLQR 738


>gi|152980564|ref|YP_001352396.1| DNA topoisomerase IV subunit A [Janthinobacterium sp. Marseille]
 gi|151280641|gb|ABR89051.1| topoisomerase IV subunit A [Janthinobacterium sp. Marseille]
          Length = 771

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 281/695 (40%), Positives = 418/695 (60%), Gaps = 32/695 (4%)

Query: 18  KAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSAR 77
           +A++L    E  YL YA+S +K RA+PD+ DG KPV RRI+ AM+E+GL+  A  +KSA 
Sbjct: 18  EALTLTTFAERAYLDYAISVVKGRALPDVCDGQKPVQRRILFAMNELGLNSAAKPRKSAA 77

Query: 78  IVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMT 137
           +VG+V+GKLHPHGDQSVYD+LVR+AQ F  RYPLI GQGNFG+ DGD AAA RYTEAR+T
Sbjct: 78  VVGDVLGKLHPHGDQSVYDALVRMAQDFSLRYPLIDGQGNFGSRDGDGAAAMRYTEARLT 137

Query: 138 QVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQ 197
            +++L+L  +D   VDF+  Y+    EP + PS+ P +L NG SGIAVGMAT IPSHN+ 
Sbjct: 138 PISKLLLDEIDMGTVDFQPNYDGSTEEPKLLPSRLPFVLLNGASGIAVGMATEIPSHNLH 197

Query: 198 EICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWC 257
           E+ +AA+ALI NP+++ E+L+  + GPDFP GG I+ S  +I + Y  GRG  +VRA W 
Sbjct: 198 EVAKAAVALIRNPKLTHEELMAIVPGPDFPGGGQIITSPTAISDIYSSGRGSVKVRATWK 257

Query: 258 VEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELI-----IAKR-------------IPLLE 299
           +E++ RG W  VVTE+P+     +++E+I EL      + K+             + +L+
Sbjct: 258 IEDMARGQWQAVVTELPHGTSSQKVLEEIEELTNPKIKLGKKSLSPEQLALKQTVLSMLD 317

Query: 300 DIRDESAED--VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPL 357
            +RDES  D  VR+V  PK+++ D       +   + +ET   +N+ ++     P+   L
Sbjct: 318 TVRDESGRDAPVRLVFEPKSKNQDQTEFTNLLLAHTSLETSVSINLVMIGGDGRPRQKSL 377

Query: 358 DGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVM 417
             IL+EW+  R   + RRS F++Q +D R+ IL+G     LNID++I IIR  D+PKP +
Sbjct: 378 GDILREWIEFRFTTITRRSQFKLQKVDDRIHILEGREAILLNIDKVIKIIRESDEPKPAL 437

Query: 418 VSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIAC 477
           +  F L+E Q D IL +RLR L +LE  +I+ EL  L  EK  +  LL+      N  + 
Sbjct: 438 MDAFRLSERQADDILEIRLRQLARLETIKIQQELAELRNEKTTLQDLLD------NPSSM 491

Query: 478 EIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHS 537
           +   +KEI +     G  R T  EV  A+KA+++  +I+ EP+TVVIS +GW+R+   H 
Sbjct: 492 KRLVIKEIEADEKQFGDARRTLIEV--AEKASVETKVID-EPVTVVISQKGWVRARTGHG 548

Query: 538 VDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLN 597
            D +   FK GD+L       T D +L+  ++G+ Y++P   L   RG G  I  L++L 
Sbjct: 549 HDAAQFTFKAGDTLYNTFECRTVDSLLVFGSNGRIYSVPVSALPGARGDGVPITTLVELA 608

Query: 598 HNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVT 657
               I+  F   +   LL+ S+ G  F  +  ++++ TR GK+F+ +   ++      VT
Sbjct: 609 SGSRILHYFAGPADVTLLLASTAGYGFTAKSGDMVSRTRGGKSFITLDDGDEPLAPCPVT 668

Query: 658 --GDHVAVVGENRKLLIFSIDQIPEMSR-GKGVRL 689
                +A + E  +LL+F ID+I  ++  G+GV L
Sbjct: 669 AGASAIACLSEKGRLLVFGIDEIKSLTAGGRGVIL 703


>gi|310766340|gb|ADP11290.1| DNA topoisomerase IV subunit A [Erwinia sp. Ejp617]
          Length = 758

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 277/746 (37%), Positives = 448/746 (60%), Gaps = 22/746 (2%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L ++  + ++L    E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL   A 
Sbjct: 4   LTQDGAERLALHKFTENAYLNYSMYVIMDRALPYIGDGLKPVQRRIVYAMSELGLSNNAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLGELGQGTVDYVPNFDGTLQEPSMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HN++E+ +AA+ LID+P+ ++++LL+ + GPD+PT   I+  R  I + Y+ GRG  
Sbjct: 184 IPPHNLREVAKAAITLIDSPKTTLDELLDIVQGPDYPTEAEIITPRNEIRKIYQNGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  EE       +V+T +P+QV  +R++E+IA  +  K++P++ED+RDES  +  
Sbjct: 244 RMRAVWKKEE-----GDVVITALPHQVSGARVLEQIAVQMRNKKLPMVEDLRDESNHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P++  +D D +M  +F  +D+E  + +N+N++ +   P V  L  IL EWL  R
Sbjct: 299 TRLVIVPRSNRVDMDQVMNHLFATTDLERSYRINLNMIGLNNRPAVKNLLEILSEWLIFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ + RR + R++ + +R+ IL GLL+A+LNIDE+I IIR ED+PKPV++SRF ++E Q 
Sbjct: 359 RDTVRRRLNHRLEKVLKRLHILAGLLVAFLNIDEVIEIIRAEDEPKPVLMSRFDISEIQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D L  E+  ++++L S ++    +  E++   + +  
Sbjct: 419 EAILELKLRHLAKLEEMKIRGEQDELEKERAHLEAILASERKMNTLLKKELQADSDAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E   A KA  +  +I  EP+T+V+S  GW+RS K H +D + L +K G
Sbjct: 479 D-----RRSPLREREEA-KAIGEHELIPSEPVTIVLSQSGWVRSAKGHDIDPAGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           D+   A    +   ++ + + G++Y L    L S RG GE +   +       +    + 
Sbjct: 533 DAYLGAARGKSNQPVVFIDSTGRSYALDPLTLPSARGQGEPLTGKLTPPPGAVVEQVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGDHVAVVGE 666
           D T KLL+ S  G  F+   SE+++  R GK  L + S  K+   L ++   D +  +  
Sbjct: 593 DETQKLLMASDAGYGFVCTFSELVSRNRAGKALLTLPSNAKVMTPLAIQSNDDLLLAITA 652

Query: 667 NRKLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVICFKIC---EGLTWIDSAGRSYN 720
             ++L+F + ++P++S+GKG   V + S +     D + + +    E    +    R   
Sbjct: 653 AGRMLMFPVSELPQLSKGKGNKIVSIPSAEAASGEDKLAWLLLLTPENAITLYVGKRKLT 712

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPR 746
               DL  +  +RG  G+L+P+G  R
Sbjct: 713 LKAADLQKFRAERGRRGTLLPRGLQR 738


>gi|259907126|ref|YP_002647482.1| DNA topoisomerase IV subunit A [Erwinia pyrifoliae Ep1/96]
 gi|224962748|emb|CAX54203.1| DNA topoisomerase 4 subunit A [Erwinia pyrifoliae Ep1/96]
 gi|283476932|emb|CAY72810.1| topoisomerase IV subunit A [Erwinia pyrifoliae DSM 12163]
          Length = 758

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 277/746 (37%), Positives = 448/746 (60%), Gaps = 22/746 (2%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L ++  + ++L    E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL   A 
Sbjct: 4   LTQDGAERLALHKFTENAYLNYSMYVIMDRALPYIGDGLKPVQRRIVYAMSELGLSNNAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLGELGQGTVDYVPNFDGTLQEPSMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HN++E+ +AA+ LID+P+ ++++LL+ + GPD+PT   I+  R  I + Y+ GRG  
Sbjct: 184 IPPHNLREVAKAAITLIDSPKTTLDELLDIVQGPDYPTEAEIITPRNEIRKIYQNGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  EE       +V+T +P+QV  +R++E+IA  +  K++P++ED+RDES  +  
Sbjct: 244 RMRAVWKKEE-----GDVVITALPHQVSGARVLEQIAVQMRNKKLPMVEDLRDESNHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P++  +D D +M  +F  +D+E  + +N+N++ +   P V  L  IL EWL  R
Sbjct: 299 TRLVIVPRSNRVDMDQVMNHLFATTDLERSYRINLNMIGLNNRPAVKNLLEILSEWLIFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ + RR + R++ + +R+ IL GLL+A+LNIDE+I IIR ED+PKPV++SRF ++E Q 
Sbjct: 359 RDTVRRRLNHRLEKVLKRLHILAGLLVAFLNIDEVIEIIRAEDEPKPVLMSRFDISEIQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D L  E+  ++++L S ++    +  E++   + +  
Sbjct: 419 EAILELKLRHLAKLEEMKIRGEQDELEKERAHLEAILASERKMNTLLKKELQADSDAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E   A KA  +  +I  EP+T+V+S  GW+RS K H +D + L +K G
Sbjct: 479 D-----RRSPLREREEA-KAIGEHELIPSEPVTIVLSQSGWVRSAKGHDIDPAGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           D+   A    +   ++ + + G++Y L    L S RG GE +   +       +    + 
Sbjct: 533 DAYLGAARGKSNQPVVFIDSTGRSYALDPLTLPSARGQGEPLTGKLTPPPGAVVEQVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGDHVAVVGE 666
           D T KLL+ S  G  F+   SE+++  R GK  L + S  K+   L ++   D +  +  
Sbjct: 593 DETQKLLMASDAGYGFVCTFSELVSRNRAGKALLTLPSNAKVMTPLAIQSNDDLLLAITA 652

Query: 667 NRKLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVICFKIC---EGLTWIDSAGRSYN 720
             ++L+F + ++P++S+GKG   V + S +     D + + +    E    +    R   
Sbjct: 653 AGRMLMFPVSELPQLSKGKGNKIVSIPSAEAASGEDKLAWLLLLTPENAITLYVGKRKLT 712

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPR 746
               DL  +  +RG  G+L+P+G  R
Sbjct: 713 LKAADLQKFRAERGRRGTLLPRGLQR 738


>gi|170719131|ref|YP_001784279.1| DNA topoisomerase IV subunit A [Haemophilus somnus 2336]
 gi|168827260|gb|ACA32631.1| DNA topoisomerase IV, A subunit [Haemophilus somnus 2336]
          Length = 747

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 280/747 (37%), Positives = 448/747 (59%), Gaps = 24/747 (3%)

Query: 10  NTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFG 69
           NT+  E ++ + LR   E+ YL Y++  I +RA+P + DG KPV RRII+AMSE+GL+  
Sbjct: 2   NTINYEGIEQMPLRQFTEKAYLNYSMYVIMDRALPFIGDGLKPVQRRIIYAMSELGLNAS 61

Query: 70  AAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAA 128
           A +KKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA
Sbjct: 62  AKYKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAA 121

Query: 129 YRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMA 188
            RYTE+R+++++E++L  + +  V+++  ++    EP   P++ P++L NGT+GIAVGMA
Sbjct: 122 MRYTESRLSKISEILLSELGQGTVNYQANFDGTLEEPQYLPARLPHILLNGTTGIAVGMA 181

Query: 189 TSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRG 248
           T IP HN+ E+ +A + L+DNP   +++L+  + GPDFPT   I+  +E I + Y  GRG
Sbjct: 182 TDIPPHNLNEVADATIMLLDNPNADLDQLMTALQGPDFPTEAEIISPKEEIRKIYEQGRG 241

Query: 249 GFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED 308
             ++RA W  E     +  I++T +P+Q   S+++ +IAE +  K++P++EDIRDE+  +
Sbjct: 242 SIKMRAVWKKE-----NGEIIITALPHQSSPSKIVAQIAEQMQNKKLPMVEDIRDEADHE 296

Query: 309 --VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLA 366
             +R+V+ P++  +D D LM  +F  +D+E  + +NMN++ +   P V  L  IL EWL 
Sbjct: 297 NPIRLVIVPRSNRVDTDALMAHLFATTDLEKSYRVNMNMIGLDNKPAVKNLVQILTEWLT 356

Query: 367 HRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTEN 426
            RR+ + RR  +R+  +  R+ IL GLLIA+LNIDEII IIRNEDKPK ++++RF+LT+ 
Sbjct: 357 FRRQTVTRRLQYRLDKVLARLHILDGLLIAFLNIDEIIEIIRNEDKPKEILIARFNLTDE 416

Query: 427 QVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIF 486
           Q +AILNLRLR L KLEE ++++E +NL  E+  ++ +LNS  +  N I  EI++  + F
Sbjct: 417 QAEAILNLRLRHLAKLEEQELQAEKNNLAKERNSLEQILNSEIRLNNLIKKEIQQDAKTF 476

Query: 487 SKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFK 546
           +       R +   E + A KA  +  M   EPIT+++S  GW+R  K H ++  AL +K
Sbjct: 477 ASP-----RLSPLVERAEA-KAISETDMTPSEPITIILSEMGWVRCAKGHDINARALSYK 530

Query: 547 EGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAF 606
            GD+        +   ++ + + G++YTL   +L S R  GE +   + L     I    
Sbjct: 531 TGDNYLTHACGKSNQPVVFIDSTGRSYTLDPLSLPSARSQGEPLTGKLTLPSGATIEHLL 590

Query: 607 VYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVK-VTGDHVAV 663
           + +    LL+ S  G  FI +  ++++  + GK  + +     +   LV++  T   VA+
Sbjct: 591 IENENQSLLMASDAGYGFICKFEDLVSRNKAGKAVISLPENANVLPPLVLQNSTALLVAL 650

Query: 664 VGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISD-----VICFKICEGLTWIDSAG-R 717
              NR +L+F +  +PE+S+GKG ++         +     V  F I E  + +  AG R
Sbjct: 651 TSMNR-MLVFPVADLPELSKGKGNKIIHIPAANAKERSELLVKLFLISEKTSLVFHAGKR 709

Query: 718 SYNRSENDLLGWLGKRGGVGSLVPKGF 744
                  D+  +  +RG  GS +P+G 
Sbjct: 710 KVTLKPEDIRKFRAERGRKGSPLPRGL 736


>gi|237748748|ref|ZP_04579228.1| topoisomerase IV subunit A [Oxalobacter formigenes OXCC13]
 gi|229380110|gb|EEO30201.1| topoisomerase IV subunit A [Oxalobacter formigenes OXCC13]
          Length = 772

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 296/766 (38%), Positives = 442/766 (57%), Gaps = 52/766 (6%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           +E+ +++ L    E  YL YA+S +K RA+PD+ DG KPV RRI++AM+E+ LD  A  +
Sbjct: 15  DEHKESLMLASFAERAYLDYAISVVKGRALPDVCDGQKPVQRRILYAMNELRLDSEAKPR 74

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTE 133
           KSA +VG+V+GKLHPHGDQSVYD+LVR+AQ F  RYPLI G GNFG+ DGD AAA RYTE
Sbjct: 75  KSAAVVGDVLGKLHPHGDQSVYDALVRMAQDFSMRYPLIDGHGNFGSRDGDGAAAMRYTE 134

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           AR+T +AEL+L+ +D+  V+F+D Y+    EP + P++ P  L NG SGIAVGMAT IPS
Sbjct: 135 ARLTPIAELLLEEIDQGTVEFQDNYDGSTQEPKLLPARLPVTLLNGASGIAVGMATEIPS 194

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN+ E+  AA+A+I NP IS  +L+E I GPDFP GG I+ +  +I E Y  GRG  +VR
Sbjct: 195 HNLNEVATAAVAMIRNPSISHAELMEIIPGPDFPGGGQIITAPNTISEIYENGRGSVKVR 254

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAEL-----------IIAKRIPL----- 297
           ARW +EE+ RG W  VV+E+P      +++E+I E+           + A+++ L     
Sbjct: 255 ARWKIEELARGQWQAVVSELPPGTSAQKVLEEIEEITNPKVRAGKKALSAEQVALRQQFL 314

Query: 298 --LEDIRDESAED--VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQ 353
             L+ IRDE++ D  VRIVL PK++  +PD  M+ +   + +E   P+N+ ++ +   P+
Sbjct: 315 GILDTIRDEASRDAPVRIVLEPKSKRQNPDEFMQMLLAHTSLECNAPVNLVMIGIDGRPR 374

Query: 354 VMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKP 413
              L  I+ EW+  R   + RR+++R++ +D R+ IL+G     LNID +I IIR  D+P
Sbjct: 375 QKGLTDIISEWIDFRFATVTRRTNWRLKRVDDRIHILEGRETVLLNIDAVIHIIRESDEP 434

Query: 414 KPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWN 473
           K  ++  F L+E Q D IL +RLR L +LE+ +I+ EL  L  EK+ +  LL++      
Sbjct: 435 KAALIDAFQLSERQADDILEIRLRQLARLEKIRIEQELAELRKEKKGLHDLLDNPSSMKR 494

Query: 474 QIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSL 533
            I      ++EI +     G  R T  E   A++AT +Q +++ EP+TV+IS  GW+R  
Sbjct: 495 LI------IREIEADRKKYGDARRTLIE--EAERATAEQKIVD-EPVTVIISQNGWVRQR 545

Query: 534 KSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLL 593
             H ++LSA+ FK GD+L  +    +TD +L  S+ G+ YT+P   L  GRG G  I   
Sbjct: 546 TGHGLNLSAITFKSGDNLFSSFECRSTDFLLAFSSTGRIYTIPVHQLPGGRGDGMPITTF 605

Query: 594 IDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--K 651
            ++  ++ IV   V      +L+    G  F  + S++++  R GK+F+ +   E +   
Sbjct: 606 AEIGIDETIVQYLVSSPDKSVLLSMDSGYGFAAKTSDMMSRVRNGKSFISLEDGETLLPP 665

Query: 652 LVVKVTGDHVAVVGENRKLLIFSIDQIPEMSR-GKGVRLQSYKDG-------GISDVICF 703
           LV+      + V+ E  + L+F   ++  +S  G GV L     G        + D  C 
Sbjct: 666 LVIPEASKSIGVLSEKGRFLLFDATELRVLSSGGHGVILMGLDKGEKIRATLPVDDNGCL 725

Query: 704 KICEGLTWIDSAGRSYNRSE-----NDLLGWLGKRGGVGSLVPKGF 744
            IC          ++ NR E     N +  + GKR   G  V   F
Sbjct: 726 VIC--------MAKNDNRYEVRISGNQIETYTGKRARKGKPVETRF 763


>gi|238796975|ref|ZP_04640479.1| DNA topoisomerase 4 subunit A [Yersinia mollaretii ATCC 43969]
 gi|238719235|gb|EEQ11047.1| DNA topoisomerase 4 subunit A [Yersinia mollaretii ATCC 43969]
          Length = 757

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 283/751 (37%), Positives = 439/751 (58%), Gaps = 32/751 (4%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L  +  + + L    E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL   A 
Sbjct: 4   LTHDGAERLPLHTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLSNSAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLGELGQGTVDWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV+EI +A +ALID P  S+E+LLE++ GPDFPT   I+  R  I + Y  GRG  
Sbjct: 184 IPPHNVREIAQAVIALIDKPTTSLEELLEFVQGPDFPTEAEIITPRNEIRKIYENGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+   GS   V+T +P+QV  ++++E+IA  + AK++P++ED+RDES  +  
Sbjct: 244 RMRALWKKED---GS--AVITALPHQVSGAKVLEQIASQMRAKKLPMVEDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P+   +D D +M  +F  +D+E  + +NMN++ +   P V  L  IL EWL  R
Sbjct: 299 TRLVIVPRTNRVDLDQVMNHLFATTDLERSYRINMNMIGLDHRPTVKGLLEILTEWLVFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ +  R ++R++ + +R+ IL+GLLIA+LNIDE+I IIR ED+PKP+++  F+++E Q 
Sbjct: 359 RQTVRNRLNYRLEKVLKRLHILEGLLIAFLNIDEVIHIIRTEDEPKPLLMQHFAISETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D L  E++++ +LL S ++    I  EI+     +  
Sbjct: 419 EAILELKLRHLAKLEEVKIRGEQDELAKERDQLQALLASERKLNTMIKKEIQADAAAYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E + A KA     ++  EP+T+V+S  GW+RS K H +D   L +K G
Sbjct: 479 D-----RRSPLTERAEA-KAMSDHDIVPSEPVTIVLSEMGWVRSAKGHDIDPGGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           DS + A    +   ++ + + G++Y L    L S RG GE +   +       I    + 
Sbjct: 533 DSFRAAARGMSNQPVVFIDSTGRSYALDPLTLPSARGQGEPLTGKLTPPPGATIEQVLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG--DHVAVVGE 666
               KLL+ S  G  F+   ++++A  R GKT + +    K    +++ G  D +  +  
Sbjct: 593 PDDQKLLMASDAGYGFVCTFNDLVAKNRAGKTMITLPENAKALPPLEIHGPDDMLLSITA 652

Query: 667 NRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTW-----------IDSA 715
             ++L+F +  +PE+S+GKG ++ S     I         + L W           +   
Sbjct: 653 AGRMLMFPVADLPELSKGKGNKIVS-----IPGAQAAAGEDRLAWLFVLPPQTSVTLHFG 707

Query: 716 GRSYNRSENDLLGWLGKRGGVGSLVPKGFPR 746
            R       DL  +  +RG  GS +P+G  R
Sbjct: 708 KRKLTLRPEDLQKFRAERGRKGSPLPRGLQR 738


>gi|307544311|ref|YP_003896790.1| DNA topoisomerase IV subunit A [Halomonas elongata DSM 2581]
 gi|307216335|emb|CBV41605.1| DNA topoisomerase IV subunit A [Halomonas elongata DSM 2581]
          Length = 752

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 284/746 (38%), Positives = 436/746 (58%), Gaps = 25/746 (3%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           + E +V+ +SLR   E+ YL Y++  I +RA+P + DG KPV RRI++AM E+ L   A 
Sbjct: 7   VAEGDVERLSLREYTEKAYLDYSMYVILDRALPHIGDGMKPVQRRIVYAMRELALSANAK 66

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           +KKSAR VG+V+GK HPHGD + Y+++V +AQ F  RYPL+ GQGN+G+ D   S AA R
Sbjct: 67  YKKSARTVGDVLGKFHPHGDSACYEAMVLMAQSFSYRYPLVDGQGNWGSPDDPKSFAAMR 126

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTEAR+++ AE++L  + +  VD+   ++   +EPVV P++ P++L NG +GIAVGMAT 
Sbjct: 127 YTEARLSKFAEVLLSELGQGTVDWAPNFDGTMNEPVVLPARLPHVLLNGGTGIAVGMATD 186

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HNV E+ EA   L+  PE +  +L+ ++ GPDFP+   I+     + + Y  GRG  
Sbjct: 187 IPPHNVGEVVEATCHLLRQPEATTAELMAHLPGPDFPSAAEIITPASDLRKIYENGRGSV 246

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESA--ED 308
           +VRAR+  EE       +V+T +PYQV  ++++E+IA  + AK++P++ D+RDES   E 
Sbjct: 247 KVRARFVREE-----GNVVITALPYQVSGAKVLEQIAAQMQAKKLPMVADLRDESTHEEP 301

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P++  +D + LM  +F  +D+E    +NMNV+ +   P+V+ L G+L EWL  R
Sbjct: 302 TRLVIEPRSNRVDVESLMAHLFATTDLEKNIRVNMNVIGLDGRPRVLSLAGLLSEWLDFR 361

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R  + RR   R+  ++ R+ IL+GLL AYLNIDE+I IIR ED+PKP ++  F L+E Q 
Sbjct: 362 RSTVRRRLEHRLGKVEDRLHILEGLLAAYLNIDEVIRIIREEDEPKPALMEAFGLSERQA 421

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL LRLR L KLEE +I+ E D L  E++++  LL +     + I  E+R   E +  
Sbjct: 422 EAILELRLRHLAKLEEMKIRGEQDELEEERKRLKELLGNEAALTDLIERELRAAGEEYGD 481

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR    E   A +A  +  ++  +P+TVV+S +GWIRS K H +D + L +K G
Sbjct: 482 P-----RRAPIVEREEA-RALSEVELVGADPVTVVLSEKGWIRSAKGHDIDPAGLSYKAG 535

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           D   +A    T   ++LL   G+AYTL A NL S R  GE +   +++     +    + 
Sbjct: 536 DRFALAARGKTNQPLVLLDDTGRAYTLTAHNLPSARSQGEPVTGRVNVAAGAHMAGVMLG 595

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVG 665
             T + L+ S  G  FI     +   ++ GK  L V     +    +V +  G  VA V 
Sbjct: 596 PPTTRYLLASDGGYGFIAPLEALTGKSKSGKGVLSVPKGCNVLAPLMVPEGEGISVAAVS 655

Query: 666 ENRKLLIFSIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRS 718
              +LL+F +DQ+PEM++GKG ++        + ++  + D+      + L  + +  R 
Sbjct: 656 NEGRLLVFPLDQLPEMAKGKGNKMIDIPGARAARREEFLRDLTLLGPGQALV-VQAGKRK 714

Query: 719 YNRSENDLLGWLGKRGGVGSLVPKGF 744
                 DL  + G RG  GS +P+G 
Sbjct: 715 LTLKAGDLDYYRGDRGRRGSKLPRGL 740


>gi|313500891|gb|ADR62257.1| ParC [Pseudomonas putida BIRD-1]
          Length = 752

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 288/756 (38%), Positives = 452/756 (59%), Gaps = 29/756 (3%)

Query: 6   ISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMG 65
           +S+S  L  + V+  SL    E+ YL Y++  I +RA+P + DG KPV RRI++AMSE+G
Sbjct: 1   MSDSLELSLDGVERRSLADFTEQAYLNYSMYVIMDRALPHIGDGLKPVQRRIVYAMSELG 60

Query: 66  LDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-D 124
           LD  A  KKSAR VG+V+GK HPHGD + Y+++V +AQPF  RY L+ GQGN+G  D   
Sbjct: 61  LDADAKHKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYTLVDGQGNWGAPDDPK 120

Query: 125 SAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIA 184
           S AA RYTEAR+++ AE++L  V +  VD+   ++    EP V P++ PN+L NGT+GIA
Sbjct: 121 SFAAMRYTEARLSRYAEVLLSEVGQGTVDWVPNFDGTLQEPAVLPARLPNILLNGTTGIA 180

Query: 185 VGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYR 244
           VGMAT +P HN++E+  A + L+D P+ ++E+L E+I GPD+PT   IV  R  I++ Y 
Sbjct: 181 VGMATDVPPHNLREVASACVRLLDEPKATVEQLCEHIQGPDYPTEAEIVTPRAEILKMYE 240

Query: 245 LGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDE 304
            GRG  R+RA + VE+       IVVT +P+QV  ++++E+IA  + AK++P++ D+RDE
Sbjct: 241 SGRGSIRMRAVYRVED-----GDIVVTALPHQVSGAKVLEQIAAQMQAKKLPMVADLRDE 295

Query: 305 SAED--VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILK 362
           S  +   RIV+ P++  +D D LM+ +F  +D+E+ + +N+N++ +   PQ+  L  IL 
Sbjct: 296 SDHENPCRIVIIPRSNRVDVDELMQHLFATTDLESTYRVNVNIIGLDGRPQLKNLRTILV 355

Query: 363 EWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFS 422
           EWL  R   + RR   R+  +++R+ +L GLL A+LN+DE+I IIR E+ PK  ++ RF 
Sbjct: 356 EWLEFRTNTVRRRLQHRLDKVEKRLHLLDGLLTAFLNLDEVIHIIRTEEYPKQALIERFE 415

Query: 423 LTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREV 482
           LTE Q D IL  RLR L +LEE +I+ E D LL E+ K+ +LL S  +    +  E+ + 
Sbjct: 416 LTEIQADYILETRLRQLARLEEMKIRGEQDELLKEQAKLQALLGSEAKLRKLVRSELIKD 475

Query: 483 KEIFSKSTDLGRRRTTFCEVSRAD-KATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLS 541
            E +        RR+    V+RA+ KA  +  ++  EP+TVV+S +GW+R  K H +D +
Sbjct: 476 AETYGDD-----RRSPI--VARAEAKALSENELMPTEPVTVVLSEKGWVRCAKGHDIDAT 528

Query: 542 ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQD 601
            L +K GD  K A    +    +L+ + G++Y+L A +L S RG GE +   +       
Sbjct: 529 GLSYKAGDGFKAAAAGRSNQFAVLIDSTGRSYSLAAHSLPSARGQGEPLTGRLTPPPGAT 588

Query: 602 IVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTG 658
                + D     +V S  G  F+V+  ++ A  + GK  L + +  K+   + V     
Sbjct: 589 FECVLLPDDDALYVVASDAGYGFVVKGEDLQAKNKAGKGLLSLPNGAKVMTPRPVADREQ 648

Query: 659 DHVAVVGENRKLLIFSIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTW 711
           D +A V    +LL+F +  +P++ +GKG ++        + ++  ++D+    I EG T 
Sbjct: 649 DWLAAVTTEGRLLVFKVSDLPQLGKGKGNKIIGVPGDRVASREEFVTDLAV--IPEGATL 706

Query: 712 IDSAG-RSYNRSENDLLGWLGKRGGVGSLVPKGFPR 746
           +  AG R+ +   +DL  + G+RG  GS +P+GF R
Sbjct: 707 VLQAGKRTLSLKADDLEHYKGERGRRGSKLPRGFQR 742


>gi|148549990|ref|YP_001270092.1| DNA topoisomerase IV subunit A [Pseudomonas putida F1]
 gi|148514048|gb|ABQ80908.1| DNA topoisomerase IV subunit A [Pseudomonas putida F1]
          Length = 752

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 289/756 (38%), Positives = 452/756 (59%), Gaps = 29/756 (3%)

Query: 6   ISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMG 65
           +S+S  L  + V+  SL    E+ YL Y++  I +RA+P + DG KPV RRI++AMSE+G
Sbjct: 1   MSDSLELSLDGVERRSLAEFTEQAYLNYSMYVIMDRALPHIGDGLKPVQRRIVYAMSELG 60

Query: 66  LDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-D 124
           LD  A  KKSAR VG+V+GK HPHGD + Y+++V +AQPF  RY L+ GQGN+G  D   
Sbjct: 61  LDADAKHKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYTLVDGQGNWGAPDDPK 120

Query: 125 SAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIA 184
           S AA RYTEAR+++ AE++L  V +  VD+   ++    EP V P++ PN+L NGT+GIA
Sbjct: 121 SFAAMRYTEARLSRYAEVLLSEVGQGTVDWVPNFDGTLQEPAVLPARLPNILLNGTTGIA 180

Query: 185 VGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYR 244
           VGMAT +P HN++E+  A + L+D P+ +IE+L E+I GPD+PT   IV  R  I++ Y 
Sbjct: 181 VGMATDVPPHNLREVASACVRLLDEPKATIEQLCEHIQGPDYPTEAEIVTPRAEILKMYE 240

Query: 245 LGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDE 304
            GRG  R+RA + VE+       IVVT +P+QV  ++++E+IA  + AK++P++ D+RDE
Sbjct: 241 SGRGSIRMRAVYRVED-----GDIVVTALPHQVSGAKVLEQIAAQMQAKKLPMVADLRDE 295

Query: 305 SAED--VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILK 362
           S  +   RIV+ P++  +D D LM+ +F  +D+E+ + +N+N++ +   PQ+  L  IL 
Sbjct: 296 SDHENPCRIVIIPRSNRVDVDELMQHLFATTDLESTYRVNVNIIGLDGRPQLKNLRTILV 355

Query: 363 EWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFS 422
           EWL  R   + RR   R+  +++R+ +L GLL A+LN+DE+I IIR E+ PK  ++ RF 
Sbjct: 356 EWLEFRTNTVRRRLQHRLDKVEKRLHLLDGLLTAFLNLDEVIHIIRTEEYPKQALIERFE 415

Query: 423 LTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREV 482
           LTE Q D IL  RLR L +LEE +I+ E D LL E+ K+ +LL S  +    +  E+ + 
Sbjct: 416 LTEIQADYILETRLRQLARLEEMKIRGEQDELLKEQAKLQALLGSEAKLRKLVRSELIKD 475

Query: 483 KEIFSKSTDLGRRRTTFCEVSRAD-KATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLS 541
            E +        RR+    V+RA+ KA  +  ++  EP+TVV+S +GW+R  K H +D +
Sbjct: 476 AETYGDD-----RRSPI--VARAEAKALSENELMPTEPVTVVLSEKGWVRCAKGHDIDAT 528

Query: 542 ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQD 601
            L +K GD  K A    +    +L+ + G++Y+L A +L S RG GE +   +       
Sbjct: 529 GLSYKAGDGFKAAAAGRSNQFAVLIDSTGRSYSLAAHSLPSARGQGEPLTGRLTPPPGAT 588

Query: 602 IVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTG 658
                + D     +V S  G  F+V+  ++ A  + GK  L + +  K+   + V     
Sbjct: 589 FECVLLPDDDALYVVASDAGYGFVVKGEDLQAKNKAGKGLLSLPNGAKVMTPRPVADREQ 648

Query: 659 DHVAVVGENRKLLIFSIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTW 711
           D +A V    +LL+F +  +P++ +GKG ++        + ++  ++D+    I EG T 
Sbjct: 649 DWLAAVTTEGRLLVFKVSDLPQLGKGKGNKIIGVPGDRVASREEFVTDLAV--IPEGGTL 706

Query: 712 IDSAG-RSYNRSENDLLGWLGKRGGVGSLVPKGFPR 746
           +  AG R+ +   +DL  + G+RG  GS +P+GF R
Sbjct: 707 VLQAGKRTLSLKADDLEHYKGERGRRGSKLPRGFQR 742


>gi|258626884|ref|ZP_05721688.1| DNA topoisomerase 4 subunit A [Vibrio mimicus VM603]
 gi|258580807|gb|EEW05752.1| DNA topoisomerase 4 subunit A [Vibrio mimicus VM603]
          Length = 761

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 271/681 (39%), Positives = 424/681 (62%), Gaps = 17/681 (2%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + V+ + LR   E+ YL Y++  I +RA+P + DG KPV RRII+AMSE+GL   A +KK
Sbjct: 8   DGVEQLPLRKFTEDAYLNYSMYVIMDRALPYIGDGLKPVQRRIIYAMSELGLSASAKYKK 67

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE
Sbjct: 68  SARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTE 127

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           A++++ AE++L  + +  V+++  ++    EP + P++ P++L NG +GIAVGMAT IP 
Sbjct: 128 AKLSKFAEILLSELGQGTVEWQPNFDGTMQEPKMLPARLPHILLNGVTGIAVGMATDIPP 187

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HNV+E+ +A + LID+P   +  L++Y+ GPDFPT   I+     + + YR GRG  R+R
Sbjct: 188 HNVREVADATIHLIDHPSAPLTDLMQYVKGPDFPTEAEIITPTVELEKIYRSGRGSVRMR 247

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           A WC E    GS  IV+T +P+QV  ++L+E+IA  + AK++P++ED+RDES  +   RI
Sbjct: 248 AVWCKE----GS-DIVITALPHQVSGAKLLEQIAAQMRAKKLPMVEDLRDESDHENPTRI 302

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ P++  +D DLLM  +F  +D+E  F +N+N++ +   PQV  L  IL EW++ RRE 
Sbjct: 303 VIVPRSNRVDCDLLMNHLFASTDLEKSFRVNLNMIGLDNRPQVKGLVQILSEWISFRRET 362

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           +  R  +R+  +  R+ IL+GLLIAYLNIDE+I IIR ED PK V+++RF LT  Q DAI
Sbjct: 363 VRSRLQYRLDKVLARLHILQGLLIAYLNIDEVIEIIRTEDDPKAVLMARFDLTGIQADAI 422

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L+ +LR L KLEE +I+ E D L  E++K++ LL S ++  N +  EI+   + F     
Sbjct: 423 LDTKLRHLAKLEEMKIRGEQDELEKERKKLEELLGSERRLNNLLKKEIKADADKFGDD-- 480

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
              RR+   E   A KA  ++ ++  E ITVV+S +GWIR  K H VD  +L++K GD+ 
Sbjct: 481 ---RRSPLVEREEA-KALTERDLMPSEAITVVLSEKGWIRHAKGHDVDCQSLNYKAGDNY 536

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
                  +  + + L +DG++Y+L +  L S RG GE I   +++     I    + +  
Sbjct: 537 LTHACGKSNQQAVFLGSDGRSYSLESHTLPSARGQGEPITGRLNVAEGTSIRQVVMGEED 596

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENR 668
              LV S  G  F+ +  ++++  R GK  + +    ++   +++  +  D +  +    
Sbjct: 597 QLWLVGSDAGYGFVCKGDDLLSKNRSGKALINLPENSEVMTPQVIADLDNDEILAITNQG 656

Query: 669 KLLIFSIDQIPEMSRGKGVRL 689
           ++L+F I  +P++S+GKG ++
Sbjct: 657 RMLLFPIKDLPQLSKGKGNKI 677


>gi|110835354|ref|YP_694213.1| DNA topoisomerase IV subunit A [Alcanivorax borkumensis SK2]
 gi|110648465|emb|CAL17941.1| DNA topoisomerase IV, A subunit [Alcanivorax borkumensis SK2]
          Length = 745

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 275/743 (37%), Positives = 441/743 (59%), Gaps = 25/743 (3%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           +  ++  L+   E+ YL Y++  I +RA+P++ DG KPV RRI++AMSE+GL   A +KK
Sbjct: 3   DEFESFPLKEYTEKAYLDYSMYVILDRALPNIGDGLKPVQRRIVYAMSELGLKNTAKYKK 62

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G+ D   S AA RYTE
Sbjct: 63  SARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGSADDPKSFAAMRYTE 122

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           +++   AE++L  + +  V++   ++    EP + P++ PN+L NGT+GIAVGM+T IP 
Sbjct: 123 SKLAPYAEVLLSELGQGTVEWLPNFDGTMDEPKLLPARLPNVLLNGTTGIAVGMSTDIPP 182

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN++E+  A + L+ +P  S++ L++YI GPDFPT   ++     I+  Y  G+G  + R
Sbjct: 183 HNLREVANACIHLLKDPGASLDDLMQYIQGPDFPTEAEVITPINDIIRMYAQGKGSLKQR 242

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           A +  EE       IVVT +PYQV  ++++E+IA+ +  K++P++ D+RDES  +   R+
Sbjct: 243 AVYEREE-----GDIVVTALPYQVSGAKVLEQIADQMNKKKLPMVSDLRDESDHENPTRL 297

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ P++  +D + LM  +F  +D+E  + +N+N++ +   PQV  LD IL EWL  R   
Sbjct: 298 VITPRSNRVDVEQLMSHLFASTDLEKNYRVNLNMIGIDGRPQVKSLDMILNEWLQFRMVT 357

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           + RR   R+  +  R+ IL+GLL A+LNIDE+I IIR ED PKPV++ RF +++ Q +AI
Sbjct: 358 VRRRLQHRLDKVLERLHILEGLLAAFLNIDEVIHIIRTEDAPKPVLMERFGVSDRQAEAI 417

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L L+LR L KLEE +I+ E D L  E+E +++ L S  +    +A E+++  E +     
Sbjct: 418 LELKLRHLAKLEEMKIRGEQDELNEEREYLETTLGSMAKMKKLVAKELKDDAEKYGDD-- 475

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
              RR+   E   A KA  +  ++  +PITVV+S +GW+R+ K H VD+  L +K GD  
Sbjct: 476 ---RRSPLVEREDA-KALDESDLLSADPITVVLSEKGWVRAAKGHEVDVEGLSYKAGDKY 531

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
           K      +   +  + + G+ Y+LPA  L S RG GE +   +        + A +    
Sbjct: 532 KACAKGKSNQSVCFIDSTGRTYSLPAHTLPSARGQGEPLSGRVSPPSGASFMAAVMGKDK 591

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENR 668
              L+ +  G  F+V  ++++AN + GKT L V    ++   + +   T D +A+V    
Sbjct: 592 DAYLMSTDAGYGFVVRYADLLANKKAGKTVLNVPKGARVLPPQPIASTTDDLIALVSNEG 651

Query: 669 KLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICF-------KICEGLTWIDSAGRSYNR 721
           +LL+F + ++PEM RGKG ++ S     ++D + F          + LT + +  R    
Sbjct: 652 RLLVFPVSELPEMVRGKGNKMMSIPGARVADRVEFVQDVQVVGPNDALT-LYAGKRHLTL 710

Query: 722 SENDLLGWLGKRGGVGSLVPKGF 744
             NDL  + G+RG  G+ +P+GF
Sbjct: 711 KANDLEHYYGERGRRGAKLPRGF 733


>gi|329911521|ref|ZP_08275556.1| Topoisomerase IV subunit A [Oxalobacteraceae bacterium IMCC9480]
 gi|327545861|gb|EGF30973.1| Topoisomerase IV subunit A [Oxalobacteraceae bacterium IMCC9480]
          Length = 772

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 277/704 (39%), Positives = 418/704 (59%), Gaps = 33/704 (4%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           +  + ++L    E  YL YA+S +K RA+PD+ DG KPV RRI+ AM+++GL+  A  +K
Sbjct: 17  DGAETLTLATFAERAYLDYAISVVKGRALPDVSDGQKPVQRRILFAMNQLGLNAAAKPRK 76

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEA 134
           SA +VG+V+GKLHPHGDQSVYD+LVR+AQ F  RYPLI GQGNFG+ DGD AAA RYTEA
Sbjct: 77  SAAVVGDVLGKLHPHGDQSVYDALVRMAQGFSLRYPLIDGQGNFGSRDGDGAAAMRYTEA 136

Query: 135 RMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSH 194
           R+T ++ L+L  +D   VDF+  Y+    EP + P + P +L NG SGIAVGMAT IPSH
Sbjct: 137 RLTPISSLLLDEIDLGTVDFQPNYDGSTEEPSLLPGRLPFVLLNGASGIAVGMATEIPSH 196

Query: 195 NVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRA 254
           N++E+ +AA+ALI NP ++  +L+  I GPDFP+GG I+ S  ++ E Y  GRG  +VRA
Sbjct: 197 NLREVAQAAVALIRNPALTHAELMAIIPGPDFPSGGQIITSAAALSEMYANGRGSLKVRA 256

Query: 255 RWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAK------------------RIP 296
            W +EE+ RG W  VVTE+P+     +++E+I EL   K                   + 
Sbjct: 257 LWKIEEMARGQWQAVVTELPHGTSAQKVLEEIEELTNPKIKLGKKALSPDQLAQKQLMLS 316

Query: 297 LLEDIRDESAED--VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQV 354
           LL+ +RDES  +  VR+V  PK+++ D       +   + +ET   +N+ ++     P+ 
Sbjct: 317 LLDAVRDESGREAPVRLVFEPKSKNQDQTEFTNMLLAQTSLETSASINLVMIGGDGRPRQ 376

Query: 355 MPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPK 414
             L  IL+EW+A R + + RRS FR++ ++ R+ IL+G     LNIDE+I IIR  D+PK
Sbjct: 377 KGLGDILREWIAFRFDTVTRRSHFRLKKVEDRIHILEGRETILLNIDEVIRIIRESDEPK 436

Query: 415 PVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQ 474
           P ++  F L++ Q + IL +RLR L +LE  +I+ EL  L  EK  ++ LLN      N 
Sbjct: 437 PALMGAFKLSDRQAEDILEIRLRQLARLEAIKIQQELAGLRTEKSTLEELLN------NP 490

Query: 475 IACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLK 534
            A +   +KEI +     G  R T  E   A++AT++Q +I+ EP+TVVIS +GW+R+  
Sbjct: 491 GAMKKLIIKEIDADEKRFGDARRTLIEA--AERATVEQKVID-EPVTVVISQKGWLRART 547

Query: 535 SHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLI 594
            H  D +   FK GD L       T D +L   ++G+ Y++   +L   RG G  I  L+
Sbjct: 548 GHGHDPAQFAFKAGDDLYRTFECRTLDSLLAFGSNGRIYSIAVSSLPGARGDGAPISALV 607

Query: 595 DLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEE---KMK 651
           +L     ++  F   +   +L+ S+ G  FI   +++I   + GK F+ + + +     +
Sbjct: 608 ELASGSTVLHYFAGSADSTMLLASTAGYGFIARAADMIGRNKAGKAFITLDAGDLPLPPQ 667

Query: 652 LVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDG 695
           +++        + GE R LL+F +D++  MS G+G+ L + +DG
Sbjct: 668 MLIPSASSVACLSGEGR-LLVFGLDELKTMSGGRGMILMALEDG 710


>gi|269103507|ref|ZP_06156204.1| topoisomerase IV subunit A [Photobacterium damselae subsp. damselae
           CIP 102761]
 gi|268163405|gb|EEZ41901.1| topoisomerase IV subunit A [Photobacterium damselae subsp. damselae
           CIP 102761]
          Length = 754

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 280/744 (37%), Positives = 445/744 (59%), Gaps = 23/744 (3%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + V+ + LR   E+ YL Y++  I +RA+P + DG KPV RRI++AMSE+GL   A +KK
Sbjct: 7   DGVEQLPLRKFTEDAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLSATAKYKK 66

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE
Sbjct: 67  SARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTE 126

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           +R+++ +E++L  + +  VD++  ++    EP + P++ P++L NG +GIAVGMAT IP 
Sbjct: 127 SRLSRFSEVLLSELGQGTVDWQPNFDGTMKEPKMLPARLPHILLNGVTGIAVGMATDIPP 186

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN +E+  AA+ +IDNP+  ++ L+E++ GPD+PT   I+  +  + + YR GRG  ++R
Sbjct: 187 HNAREVAAAAVHMIDNPKADLDALMEFVKGPDYPTEAEIITPKAELKKVYRTGRGSIKMR 246

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           A W  E     +  IV+T +P+QV  ++L+E+IA  + AK++P++ED+RDES  +   RI
Sbjct: 247 AVWHKE-----NGDIVITSLPHQVSGAKLLEQIATQMRAKKLPMVEDLRDESDHENPTRI 301

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ P++  +D + LM  +F  +D+E  F +N+N+L +   PQV  L  I+ EWL +RR  
Sbjct: 302 VVVPRSNRIDCEQLMNHLFASTDLEKSFRVNLNMLGLDGRPQVKGLVSIISEWLEYRRIT 361

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           + RR   R+  +  R+ IL+GLL AYLNIDE+I IIR+ED PK  ++SRF LT  Q DAI
Sbjct: 362 VRRRLQHRLDKVTARLHILEGLLAAYLNIDEVIEIIRSEDDPKAELMSRFDLTAIQADAI 421

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L ++LR L KLEE +I+ E D L  EKE ++ LL S ++    I  E+    E +     
Sbjct: 422 LEIKLRQLAKLEEIKIRGEQDELSKEKEHLEKLLGSERRLNTLIKKELLADAETYGDD-- 479

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
              RR+   E + A KA  ++ +I  EPITVV+S +GWIR  K H VD S L +K GDS 
Sbjct: 480 ---RRSPMVERAEA-KALTERDLIPSEPITVVLSEKGWIRHAKGHEVDPSTLSYKSGDSY 535

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
                  +    + L +DG++Y L + +L S R  GE I   ++L    ++    + +  
Sbjct: 536 LAHARGKSNQPAIFLGSDGRSYALESHSLPSARSQGEPITGRLNLTPGSNMRQVMMAEDE 595

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENR 668
              L+ S  G  FI + S++++  + GK  L +    ++   + +  +  D +  +    
Sbjct: 596 QLWLMASDAGYGFICKSSDMVSKNKSGKALLTLPENAQVMAPQEIRDIEHDQILAITNEG 655

Query: 669 KLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVICF--KICEGLTWIDSAG-RSYNRS 722
           ++L+F I  +P++ +GKG   + + + +     + + +   + +G      AG R  +  
Sbjct: 656 RMLLFPIKDLPQLGKGKGNKIINIPAARSKSREEFLSYLQVLHDGAQVTLHAGKRKLSLK 715

Query: 723 ENDLLGWLGKRGGVGSLVPKGFPR 746
            +DL  + G+RG  GS++P+G  R
Sbjct: 716 PSDLDNFRGERGRRGSILPRGLQR 739


>gi|26991590|ref|NP_747015.1| DNA topoisomerase IV subunit A [Pseudomonas putida KT2440]
 gi|24986679|gb|AAN70479.1|AE016689_7 DNA topoisomerase IV, A subunit [Pseudomonas putida KT2440]
          Length = 752

 Score =  519 bits (1337), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 288/756 (38%), Positives = 452/756 (59%), Gaps = 29/756 (3%)

Query: 6   ISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMG 65
           +S+S  L  + V+  SL    E+ YL Y++  I +RA+P + DG KPV RRI++AMSE+G
Sbjct: 1   MSDSLELSLDGVERRSLADFTEQAYLNYSMYVIMDRALPHIGDGLKPVQRRIVYAMSELG 60

Query: 66  LDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-D 124
           LD  A  KKSAR VG+V+GK HPHGD + Y+++V +AQPF  RY L+ GQGN+G  D   
Sbjct: 61  LDADAKHKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYTLVDGQGNWGAPDDPK 120

Query: 125 SAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIA 184
           S AA RYTEAR+++ AE++L  V +  VD+   ++    EP V P++ PN+L NGT+GIA
Sbjct: 121 SFAAMRYTEARLSRYAEVLLSEVGQGTVDWVPNFDGTLQEPAVLPARLPNILLNGTTGIA 180

Query: 185 VGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYR 244
           VGMAT +P HN++E+  A + L+D P+ +IE+L E+I GPD+PT   IV  R  I++ Y 
Sbjct: 181 VGMATDVPPHNLREVASACVRLLDEPKATIEQLCEHIQGPDYPTEAEIVTPRAEILKMYE 240

Query: 245 LGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDE 304
            GRG  R+RA + VE+       IVVT +P+QV  ++++E+IA  + AK++P++ D+RDE
Sbjct: 241 SGRGSIRMRAVYRVED-----GDIVVTALPHQVSGAKVLEQIAAQMQAKKLPMVADLRDE 295

Query: 305 SAED--VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILK 362
           S  +   RIV+ P++  +D D LM+ +F  +D+E+ + +N+N++ +   PQ+  L  +L 
Sbjct: 296 SDHENPCRIVIIPRSNRVDVDELMQHLFATTDLESTYRVNVNIIGLDGRPQLKNLRTLLV 355

Query: 363 EWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFS 422
           EWL  R   + RR   R+  +++R+ +L GLL A+LN+DE+I IIR E+ PK  ++ RF 
Sbjct: 356 EWLEFRTNTVRRRLQHRLDKVEKRLHLLDGLLTAFLNLDEVIHIIRTEEYPKQALIERFE 415

Query: 423 LTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREV 482
           LTE Q D IL  RLR L +LEE +I+ E D LL E+ K+ +LL S  +    +  E+ + 
Sbjct: 416 LTEIQADYILETRLRQLARLEEMKIRGEQDELLKEQAKLQALLGSEAKLRKLVRSELIKD 475

Query: 483 KEIFSKSTDLGRRRTTFCEVSRAD-KATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLS 541
            E +        RR+    V+RA+ KA  +  ++  EP+TVV+S +GW+R  K H +D +
Sbjct: 476 AETYGDD-----RRSPI--VARAEAKALSENELMPTEPVTVVLSEKGWVRCAKGHDIDAT 528

Query: 542 ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQD 601
            L +K GD  K A    +    +L+ + G++Y+L A +L S RG GE +   +       
Sbjct: 529 GLSYKAGDGFKAAAAGRSNQFAVLIDSTGRSYSLAAHSLPSARGQGEPLTGRLTPPPGAT 588

Query: 602 IVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTG 658
                + D     +V S  G  F+V+  ++ A  + GK  L + +  K+   + V     
Sbjct: 589 FECVLLPDDDALYVVASDAGYGFVVKGEDLQAKNKAGKGLLSLPNGAKVMTPRPVADREQ 648

Query: 659 DHVAVVGENRKLLIFSIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTW 711
           D +A V    +LL+F +  +P++ +GKG ++        + ++  ++D+    I EG T 
Sbjct: 649 DWLAAVTTEGRLLVFKVSDLPQLGKGKGNKIIGVPGDRVASREEFVTDLAV--IPEGATL 706

Query: 712 IDSAG-RSYNRSENDLLGWLGKRGGVGSLVPKGFPR 746
           +  AG R+ +   +DL  + G+RG  GS +P+GF R
Sbjct: 707 VLQAGKRTLSLKADDLEHYKGERGRRGSKLPRGFQR 742


>gi|73760124|dbj|BAE19969.1| topoisomerase IV subunit A [Photobacterium damselae subsp.
           piscicida]
          Length = 754

 Score =  519 bits (1337), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 280/744 (37%), Positives = 445/744 (59%), Gaps = 23/744 (3%)

Query: 15  ENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKK 74
           + V+ + LR   E+ YL Y++  I +RA+P + DG KPV RRI++AMSE+GL   A +KK
Sbjct: 7   DGVEQLPLRKFTEDAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLSATAKYKK 66

Query: 75  SARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTE 133
           SAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE
Sbjct: 67  SARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTE 126

Query: 134 ARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPS 193
           +R+++ +E++L  + +  VD++  ++    EP + P++ P++L NG +GIAVGMAT IP 
Sbjct: 127 SRLSRFSEVLLSELGQGTVDWQPNFDGTMKEPKMLPARLPHILLNGVTGIAVGMATDIPP 186

Query: 194 HNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVR 253
           HN +E+  AA+ +IDNP+  ++ L+E++ GPD+PT   I+  +  + + YR GRG  ++R
Sbjct: 187 HNAREVAAAAVHMIDNPKADLDALMEFVKGPDYPTEAEIITPKAELKKVYRTGRGSIKMR 246

Query: 254 ARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRI 311
           A W  E     +  IV+T +P+QV  ++L+E+IA  + AK++P++ED+RDES  +   RI
Sbjct: 247 AVWHKE-----NGDIVITSLPHQVSGAKLLEQIATQMRAKKLPMVEDLRDESDHENPTRI 301

Query: 312 VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREV 371
           V+ P++  +D + LM  +F  +D+E  F +N+N+L +   PQV  L  I+ EWL +RR  
Sbjct: 302 VVVPRSNRIDCEQLMNHLFASTDLEKSFRVNLNMLGLDGRPQVKGLVSIISEWLEYRRIT 361

Query: 372 LFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAI 431
           + RR   R+  +  R+ IL+GLL AYLNIDE+I IIR+ED PK  ++SRF LT  Q DAI
Sbjct: 362 VRRRLQHRLDKVTARLHILEGLLAAYLNIDEVIEIIRSEDDPKAELMSRFDLTAIQADAI 421

Query: 432 LNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTD 491
           L ++LR L KLEE +I+ E D L  EKE ++ LL S ++    I  E+    E +     
Sbjct: 422 LEIKLRQLAKLEEIKIRGEQDELSKEKEHLEKLLGSERRLNTLIKKELLADAETYGDD-- 479

Query: 492 LGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSL 551
              RR+   E + A KA  ++ +I  EPITVV+S +GWIR  K H VD S L +K GDS 
Sbjct: 480 ---RRSPMVERAEA-KALTERDLIPSEPITVVLSEKGWIRHAKGHEVDPSTLSYKSGDSY 535

Query: 552 KIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDST 611
                  +    + L +DG++Y L + +L S R  GE I   ++L    ++    + +  
Sbjct: 536 LAHARGKSNQPAIFLGSDGRSYALESHSLPSARSQGEPITGRLNLTPGSNMRQVMMAEDE 595

Query: 612 CKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENR 668
              L+ S  G  FI + S++++  + GK  L +    ++   + +  +  D +  +    
Sbjct: 596 QLWLMASDAGYGFICKSSDMVSKNKSGKALLTLPENAQVMAPQEIRDIEHDQILAITNEG 655

Query: 669 KLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVICF--KICEGLTWIDSAG-RSYNRS 722
           ++L+F I  +P++ +GKG   + + + +     + + +   + +G      AG R  +  
Sbjct: 656 RMLLFPIKDLPQLGKGKGNKIINIPAARSKSREEFLSYLQVLHDGAQVTLHAGKRKLSLK 715

Query: 723 ENDLLGWLGKRGGVGSLVPKGFPR 746
            +DL  + G+RG  GS++P+G  R
Sbjct: 716 PSDLDNFRGERGRRGSILPRGLQR 739


>gi|16761950|ref|NP_457567.1| DNA topoisomerase IV subunit A [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29143437|ref|NP_806779.1| DNA topoisomerase IV subunit A [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213052530|ref|ZP_03345408.1| DNA topoisomerase IV subunit A [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213424351|ref|ZP_03357175.1| DNA topoisomerase IV subunit A [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213581150|ref|ZP_03362976.1| DNA topoisomerase IV subunit A [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213647440|ref|ZP_03377493.1| DNA topoisomerase IV subunit A [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|289827115|ref|ZP_06545904.1| DNA topoisomerase IV subunit A [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|25292861|pir||AF0888 topoisomerase IV chain A [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16504252|emb|CAD03006.1| topoisomerase IV subunit A [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29139071|gb|AAO70639.1| topoisomerase IV subunit A [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 752

 Score =  519 bits (1337), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 275/740 (37%), Positives = 448/740 (60%), Gaps = 29/740 (3%)

Query: 23  RFALEE----RYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARI 78
           R AL E     YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A FKKSAR 
Sbjct: 7   RLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNATAKFKKSART 66

Query: 79  VGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMT 137
           VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE+R++
Sbjct: 67  VGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLS 126

Query: 138 QVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQ 197
           + AEL+L  + +   D+   ++    EP + P++ PN+L NGT+GIAVGMAT IP HN++
Sbjct: 127 KYAELLLSELGQGTADWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLR 186

Query: 198 EICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWC 257
           E+ +AA+ LI+ P+ ++++LL+ + GPD+PT   I+  R  I + Y  GRG  R+RA W 
Sbjct: 187 EVAKAAITLIEQPKTTLDQLLDIVQGPDYPTEAEIIIPRAEIRKIYENGRGSVRMRAVWT 246

Query: 258 VEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIVLFP 315
            E+       +V+T +P+QV  ++++E+IA  +  K++P+++D+RDES  +   R+V+ P
Sbjct: 247 KED-----GAVVITALPHQVSGAKVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIVP 301

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           ++  +D + +M  +F  +D+E  + +N+N++ +   P V  L  IL EWLA RR+ + RR
Sbjct: 302 RSNRVDMEQVMNHLFATTDLEKSYRINLNMIGLDGRPAVKNLLEILTEWLAFRRDTVRRR 361

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
            ++R++ + +R+ IL+GLL+A+LNIDE+I IIRNED+PKP ++SRF ++E Q +AIL L+
Sbjct: 362 LNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEPKPALMSRFGISETQAEAILELK 421

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LR L KLEE +I+ E D L  E++++  +L S ++    +  E++   + +        R
Sbjct: 422 LRHLAKLEEMKIRGEQDELEKERDQLQGILASERKMNTLLKKELQADSDAYGDD-----R 476

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           R+   E   A KA  +  M+  EP+T+V+S  GW+RS K H +D   L++K GDS K A+
Sbjct: 477 RSPLREREEA-KAMSEHDMLPSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAV 535

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
              +   ++ + T G++Y +    L S RG GE +   + L     +    +     KLL
Sbjct: 536 KGKSNQPVVFIDTTGRSYAIDPITLPSARGQGEPLTGKLTLPPGATVEHMLMEGDDQKLL 595

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGDHVAVVGENRKLLIF 673
           + S  G  F+   ++++A  R GKT + +     +   LV+K   D +  + +  ++L+F
Sbjct: 596 MASDAGYGFVCTFNDLVARNRAGKTLITLPENAHVMPPLVIKDEHDMLLAITQAGRMLMF 655

Query: 674 SIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDL 726
            +D +P++S+GKG ++        +  D G++ +        LT I    R       +L
Sbjct: 656 PVDSLPQLSKGKGNKIINIPSAEAAKGDDGLAHLYVLPPQSTLT-IHVGKRKIKLRPEEL 714

Query: 727 LGWLGKRGGVGSLVPKGFPR 746
              +G+RG  G+L+ +G  R
Sbjct: 715 QKVVGERGRRGTLM-RGLQR 733


>gi|300718406|ref|YP_003743209.1| DNA topoisomerase 4 subunit A [Erwinia billingiae Eb661]
 gi|299064242|emb|CAX61362.1| DNA topoisomerase 4 subunit A [Erwinia billingiae Eb661]
          Length = 757

 Score =  519 bits (1336), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 275/751 (36%), Positives = 445/751 (59%), Gaps = 32/751 (4%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L ++  +  +L    EE YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A 
Sbjct: 4   LTQDGAERRALHKFTEEAYLNYSMYVIMDRALPYIGDGLKPVQRRIVYAMSELGLNNSAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AE++L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAEVLLGELGQGTVDYVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HN++E+ +AA+ALID P+ ++++LL+ + GPD+PT   I+  R  I + Y+ GRG  
Sbjct: 184 IPPHNLREVAKAAIALIDAPKTTLDELLDIVQGPDYPTEAEIITPRNEIRKIYQSGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+       +V+T +P+QV  +R++E+IA  +  K++P++ED+RDES  +  
Sbjct: 244 RMRAVWKRED-----GDVVITALPHQVSGARVLEQIAAQMRNKKLPMVEDLRDESNHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P++  +D D +M  +F  +D+E  + +N+N++ +   P V  L  IL EWL +R
Sbjct: 299 TRLVIVPRSNRVDMDQVMNHLFATTDLEKSYRINLNMIGLNNRPAVKNLLEILSEWLIYR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ + RR   R+  + RR+ IL+GLL+A+LNIDE+I IIR ED+PKPV++SRF ++E Q 
Sbjct: 359 RDTVRRRLQHRLDKVLRRLHILEGLLVAFLNIDEVIHIIRTEDEPKPVLMSRFEISETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D L  E++++  +L S ++    +  E++   +++  
Sbjct: 419 EAILELKLRHLAKLEEMKIRGEQDELAKERDQLQGILASERKMNTLLKKELQADSDLYGD 478

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E   A KA  +  ++  EP+T+V+S  GW+RS K H +D   L +K G
Sbjct: 479 D-----RRSPLREREEA-KAISESELVPSEPVTIVLSQSGWVRSAKGHDIDPGGLSYKAG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           DS + A    +   ++ + + G++Y L    L S RG GE +   +       +    + 
Sbjct: 533 DSYRAAARGKSNQPVVFVDSTGRSYALDPITLPSARGQGEPLTGKLTPPPGAVMEQVLME 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGDHVAVVGE 666
               KLL+ S+ G  F+   S++++  R GK  L +    K+   L +    D +  +  
Sbjct: 593 ADDQKLLMASNAGYGFVCTFSDLVSRNRAGKALLTLPQNAKVMTPLAIHHDDDLLLAITS 652

Query: 667 NRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTW-----------IDSA 715
             ++L+F +  +P++S+GKG ++ S     I         + L W           +   
Sbjct: 653 AGRMLLFPVGDLPQLSKGKGNKIIS-----IPSAQAASGEDNLAWLLLLTPQTSVTLHVG 707

Query: 716 GRSYNRSENDLLGWLGKRGGVGSLVPKGFPR 746
            R      +DL  +  +RG  G+L+P+G  R
Sbjct: 708 KRKLTLKPDDLQKFRAERGRRGTLLPRGLQR 738


>gi|37527804|ref|NP_931149.1| DNA topoisomerase IV subunit A [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36787240|emb|CAE16321.1| topoisomerase IV subunit A [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 755

 Score =  518 bits (1335), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 273/745 (36%), Positives = 452/745 (60%), Gaps = 22/745 (2%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           +  + V+ + L    E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A 
Sbjct: 4   ITHDGVERLPLHSFTETAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNNTAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDGACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AEL+L  +    VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAELLLAELGHGTVDWVPNFDGTLQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HN +E+  A + L+D P+ S++ L+E++ GPD+PT   I+ S E I + Y+ GRG  
Sbjct: 184 IPPHNAREVVNALVMLLDKPQSSLDDLMEHVKGPDYPTEAEIITSHEDIRKIYKNGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+       +V+T +P+QV  ++++E+IA  + AK++P+++D+RDES  +  
Sbjct: 244 RMRAVWSKED-----GNVVITALPHQVSGAKVLEQIANQMRAKKLPMVDDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P+   +D + +M  +F  +D+E  + +N+N++ +   P V  L  IL EWL  R
Sbjct: 299 TRLVIVPRTNRVDLEQVMNHLFATTDLEKSYRVNLNMIGLDNRPTVKGLVEILSEWLVFR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           RE + +R + R++ + +R+ +L+GLLIA+LNIDE+I IIR+ED+PKPV++SRF L+E Q 
Sbjct: 359 RETVRKRLNHRLEKVLKRLHVLEGLLIAFLNIDEVIHIIRSEDEPKPVLMSRFGLSETQT 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E   L  E++K+ ++L+S +++ N +       KEI + 
Sbjct: 419 EAILELKLRHLAKLEEVKIRGEQSELAKERDKLQAILSS-ERKLNTLLK-----KEIMAD 472

Query: 489 STDLG-RRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKE 547
           +   G  RR+   E   A KA  +  +   EP+T+V+S  GW+RS K H +D + L++K 
Sbjct: 473 AATYGDERRSPMRERDEA-KAMSEHDITPSEPVTIVLSEMGWVRSAKGHDIDPAGLNYKA 531

Query: 548 GDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFV 607
           GDS + A    +   ++ + T G++Y+L   +L S RG GE +   + +     +    +
Sbjct: 532 GDSFRGAARGKSNQPVVFIDTTGRSYSLDPRDLPSARGQGEPLTGKLTVPAGATVEHVLM 591

Query: 608 YDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG---DHVAVV 664
                + L+VS  G  FI   S+++A  R GK  + +    ++   +++     D +  +
Sbjct: 592 APDEQQFLMVSDAGYGFICTFSDLVAKNRAGKALITLPENARVMTPLEINNPQDDMLLAI 651

Query: 665 GENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKIC---EGLTWIDSAGRSYNR 721
               ++L+F +  +P++S+GKG ++ S +    +D++ + +    +    +    R    
Sbjct: 652 TRAGRMLMFPVADLPQLSKGKGNKIISVQSAAENDLLSWLLILPPQSSITLYFGKRKLTL 711

Query: 722 SENDLLGWLGKRGGVGSLVPKGFPR 746
              DL  + G+RG  G+ +P+G  R
Sbjct: 712 RPEDLQKFRGERGRKGTSLPRGLQR 736


>gi|331674565|ref|ZP_08375325.1| DNA topoisomerase IV, A subunit [Escherichia coli TA280]
 gi|331068659|gb|EGI40054.1| DNA topoisomerase IV, A subunit [Escherichia coli TA280]
          Length = 752

 Score =  518 bits (1335), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 274/740 (37%), Positives = 446/740 (60%), Gaps = 29/740 (3%)

Query: 23  RFALEE----RYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARI 78
           R AL E     YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A FKKSAR 
Sbjct: 7   RLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAKFKKSART 66

Query: 79  VGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMT 137
           VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE+R++
Sbjct: 67  VGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLS 126

Query: 138 QVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQ 197
           + +EL+L  + +   D+   ++    EP + P++ PN+L NGT+GIAVGMAT IP HN++
Sbjct: 127 KYSELLLSELGQGTADWVPNFDGTLQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLR 186

Query: 198 EICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWC 257
           E+ +AA+ALID P+ ++++LL+ + GPD+PT   I+ SR  I + Y  GRG  R+RA W 
Sbjct: 187 EVAQAAIALIDQPKTTLDQLLDIVQGPDYPTEAEIITSRAEIRKIYENGRGSVRMRAVWK 246

Query: 258 VEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIVLFP 315
            E+       +V++ +P+QV  +R++E+IA  +  K++P+++D+RDES  +   R+V+ P
Sbjct: 247 KED-----GAVVISALPHQVSGARVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIVP 301

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           ++  +D D +M  +F  +D+E  + +N+N++ +   P V  L  IL EWL  RR+ + RR
Sbjct: 302 RSNRVDMDQVMNHLFATTDLEKSYRINLNMIGLDGRPAVKNLLEILSEWLVFRRDTVRRR 361

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
            ++R++ + +R+ IL+GLL+A+LNIDE+I IIRNED+PKP ++SRF LTE Q +AIL L+
Sbjct: 362 LNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEPKPALMSRFGLTETQAEAILELK 421

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LR L KLEE +I+ E   L  E++++  +L S ++  N +  E++   + +        R
Sbjct: 422 LRHLAKLEEMKIRGEQSELEKERDQLQGILASERKMNNLLKKELQADAQAYGDD-----R 476

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           R+   E   A KA  +  M+  EP+T+V+S  GW+RS K H +D   L++K GDS K A+
Sbjct: 477 RSPLQEREEA-KAMSEHDMLPSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAV 535

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
              +   ++ + + G++Y +    L S RG GE +   + L     +    +     KLL
Sbjct: 536 KGKSNQPVVFVDSTGRSYAIDPITLPSARGQGEPLTGKLTLPPGATVDHMLMESDDQKLL 595

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGDHVAVVGENRKLLIF 673
           + S  G  F+   ++++A  R GK  + +     +   +V+K   D +  + +  ++L+F
Sbjct: 596 MASDAGYGFVCTFNDLVARNRAGKALITLPENAHVMPPVVIKDASDMLLAITQAGRMLMF 655

Query: 674 SIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDL 726
            +  +P++S+GKG ++        +  + G++ +        LT I    R       +L
Sbjct: 656 PVSDLPQLSKGKGNKIINIPSAEAARGEDGLAQLYVLPPQSTLT-IHVGKRKIKLRPEEL 714

Query: 727 LGWLGKRGGVGSLVPKGFPR 746
               G+RG  G+L+ +G  R
Sbjct: 715 QKVTGERGRRGTLM-RGLQR 733


>gi|327482436|gb|AEA85746.1| DNA topoisomerase IV subunit A [Pseudomonas stutzeri DSM 4166]
          Length = 750

 Score =  518 bits (1334), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 282/753 (37%), Positives = 446/753 (59%), Gaps = 23/753 (3%)

Query: 6   ISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMG 65
           +S S  L  + V+  SL    E+ YL Y++  I +RA+P + DG KPV RRI++AMSE+G
Sbjct: 1   MSESLDLSLDGVERRSLADFTEQAYLNYSMYVIMDRALPHIGDGLKPVQRRIVYAMSELG 60

Query: 66  LDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-D 124
           L+  A  KKSAR VG+V+GK HPHGD + Y+++V +AQPF  RY L+ GQGN+G  D   
Sbjct: 61  LNADAKHKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYTLVDGQGNWGAPDDPK 120

Query: 125 SAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIA 184
           S AA RYTEAR+++ +E++L  + +  VD+   ++    EP   P++ PNLL NGT+GIA
Sbjct: 121 SFAAMRYTEARLSRYSEVLLSELGQGTVDWVPNFDGTLDEPATLPARLPNLLLNGTTGIA 180

Query: 185 VGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYR 244
           VGMAT +P HN++E+  A + L+D P  S+E+L E++ GPDFPT   IV  R  +++ Y 
Sbjct: 181 VGMATDVPPHNLREVAAACVRLLDEPSASVEQLCEHVQGPDFPTEAEIVTPRADLLKIYE 240

Query: 245 LGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDE 304
            GRG  R+RA + VE+       IVVT +P+QV  S+++E+IA  + AK++P++ D+RDE
Sbjct: 241 TGRGSVRMRAVYRVED-----GDIVVTALPHQVSGSKVLEQIAGQMQAKKLPMVADLRDE 295

Query: 305 SAED--VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILK 362
           S  +   RIV+ P++  +D + LM+ +F  +D+E+ + +N NV+ +   PQV  L  +L 
Sbjct: 296 SDHENPCRIVIIPRSNRVDVEALMQHLFATTDLESSYRVNTNVIGLDGRPQVKNLRTLLS 355

Query: 363 EWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFS 422
           EWL +R   + RR  FR+  ++RR+ +L+GLL+A+LN+DE+I IIR ED+PKPV+++RF 
Sbjct: 356 EWLTYRIGTVRRRLQFRLDKVERRLHLLEGLLVAFLNLDEVIHIIRTEDQPKPVLMARFE 415

Query: 423 LTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREV 482
           L+E Q D IL+ RLR L +LEE +I+ E D L  E+E++ +LL S  +    +  E+ E 
Sbjct: 416 LSELQADYILDTRLRQLARLEEMKIRGEQDELAKERERLLALLGSEAKLKKLVRKELLED 475

Query: 483 KEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSA 542
            E +        RR+   E + A +A  +  ++  EP+TVVIS +GW R  K H +D   
Sbjct: 476 AETYGDD-----RRSPIVERAEA-RALTENELLPSEPVTVVISEKGWARCAKGHDIDAGG 529

Query: 543 LHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDI 602
           L +K GD+ K A    +    + + + G++Y+L A  L S RG GE +   +        
Sbjct: 530 LSYKAGDNFKAAAAGRSNQYAVFIDSTGRSYSLAAHTLPSARGQGEPLTGRLTPPPGASF 589

Query: 603 VTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGD 659
               + D     ++ S  G  F+V+  ++ A  + GK  L + +  ++   + +     D
Sbjct: 590 ECVLLPDDEALYVIASDAGYGFVVKGEDLQAKNKAGKALLSLPAGARVVAPRPLASREDD 649

Query: 660 HVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISD-----VICFKICEGLTWIDS 714
            +A V    +LL+F +  +P++ +GKG ++       ++      V    +  G T +  
Sbjct: 650 WLAAVTTEGRLLVFPVRDLPQLGKGKGNKIIGIPGERVASREEYLVDLAVLPAGATLVLQ 709

Query: 715 AG-RSYNRSENDLLGWLGKRGGVGSLVPKGFPR 746
           AG R+ +    DL  + G+RG  G+ +P+GF R
Sbjct: 710 AGKRTLSLKAEDLEHYKGERGRRGNKLPRGFQR 742


>gi|74313561|ref|YP_311980.1| DNA topoisomerase IV subunit A [Shigella sonnei Ss046]
 gi|73857038|gb|AAZ89745.1| DNA topoisomerase IV subunit A [Shigella sonnei Ss046]
          Length = 752

 Score =  518 bits (1334), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 273/740 (36%), Positives = 447/740 (60%), Gaps = 29/740 (3%)

Query: 23  RFALEE----RYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARI 78
           R AL E     YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A FKKSAR 
Sbjct: 7   RLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAKFKKSART 66

Query: 79  VGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMT 137
           VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE+R++
Sbjct: 67  VGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLS 126

Query: 138 QVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQ 197
           + +EL+L  + +   D+   ++    EP + P++ PN+L NGT+GIAVGMAT IP HN++
Sbjct: 127 KYSELLLSELGQGTADWVPNFDGTLQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLR 186

Query: 198 EICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWC 257
           E+ +AA+ALID P+ ++++LL+ + GPD+PT   I+ SR  I + Y  GRG  R+RA W 
Sbjct: 187 EVAQAAIALIDQPKTTLDQLLDIVQGPDYPTEAEIITSRAEIRKIYENGRGSVRMRAVWK 246

Query: 258 VEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIVLFP 315
            E+       +V++ +P+QV  +R++E+IA  +  K++P+++D+RDES  +   R+V+ P
Sbjct: 247 KED-----GAVVISALPHQVSGARVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIVP 301

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           ++  +D D +M  +F  +D+E  + +N+N++ +   P V  L  IL EWL  RR+ + RR
Sbjct: 302 RSNRVDMDQVMNHLFATTDLEKSYRINLNMIGLDGRPAVKNLLEILSEWLVFRRDTVRRR 361

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
            ++R++ + +R+ IL+GLL+A+LNIDE+I IIRNED+PKP ++SRF LTE Q +AIL L+
Sbjct: 362 LNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEPKPALMSRFGLTETQAEAILELK 421

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LR L KLEE +I+ E   L  E++++  +L S ++  N +  E++   + +        R
Sbjct: 422 LRHLAKLEEMKIRGEQSELEKERDQLQGILASERKMNNLLKKELQADAQAYGDD-----R 476

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           R+   E   A KA  +  M+  EP+T+V+S  GW+RS K H +D   L++K GDS K+A+
Sbjct: 477 RSPLQEREEA-KAMSEHDMLPSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKVAV 535

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
              +   ++ + + G++Y +    L S RG GE +   + L     +    +     KLL
Sbjct: 536 KGKSNQSVVFVDSTGRSYAIDPITLPSARGQGEPLTGKLTLPPGATVDHMLMESDDQKLL 595

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGDHVAVVGENRKLLIF 673
           + S  G  F+   ++++A  R GK  + +     +   +V++   D +  + +  ++L+F
Sbjct: 596 MASDAGYGFVCTFNDLVARNRAGKALITLPENAHVMPPVVIEDASDMLLAITQAGRMLMF 655

Query: 674 SIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDL 726
            +  +P++S+GKG ++        +  + G++ +        LT I    R       +L
Sbjct: 656 PVSDLPQLSKGKGNKIINIPSAEAARGEDGLAQLYVLPPQSTLT-IHVGKRKIKLRPEEL 714

Query: 727 LGWLGKRGGVGSLVPKGFPR 746
               G+RG  G+L+ +G  R
Sbjct: 715 QKVTGERGRRGTLM-RGLQR 733


>gi|260857155|ref|YP_003231046.1| DNA topoisomerase IV subunit A [Escherichia coli O26:H11 str.
           11368]
 gi|257755804|dbj|BAI27306.1| DNA topoisomerase IV subunit A [Escherichia coli O26:H11 str.
           11368]
 gi|323154718|gb|EFZ40917.1| DNA topoisomerase IV, A subunit [Escherichia coli EPECa14]
          Length = 752

 Score =  518 bits (1334), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 274/740 (37%), Positives = 446/740 (60%), Gaps = 29/740 (3%)

Query: 23  RFALEE----RYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARI 78
           R AL E     YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A FKKSAR 
Sbjct: 7   RLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAKFKKSART 66

Query: 79  VGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMT 137
           VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE+R++
Sbjct: 67  VGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLS 126

Query: 138 QVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQ 197
           + +EL+L  + +   D+   ++    EP + P++ PN+L NGT+GIAVGMAT IP HN++
Sbjct: 127 KYSELLLSELGQGTADWVPNFDGTLQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLR 186

Query: 198 EICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWC 257
           E+ +AA+ALID P+ ++E+LL+ + GPD+PT   I+ SR  I + Y  GRG  R+RA W 
Sbjct: 187 EVAQAAIALIDQPKTTLEQLLDIVQGPDYPTEAEIITSRAEIRKIYENGRGSVRMRAVWK 246

Query: 258 VEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIVLFP 315
            E+       +V++ +P+QV  +R++E+IA  +  K++P+++D+RDES  +   R+V+ P
Sbjct: 247 KED-----GAVVISALPHQVSGARVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIVP 301

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           ++  +D D +M  +F  +D+E  + +N+N++ +   P V  L  IL EWL  RR+ + RR
Sbjct: 302 RSNRVDMDQVMNHLFATTDLEKSYRINLNMIGLDGRPAVKNLLEILSEWLVFRRDTVRRR 361

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
            ++R++ + +R+ IL+GLL+A+LNIDE+I IIRNED+PKP ++SRF LTE Q +AIL L+
Sbjct: 362 LNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEPKPALMSRFGLTETQAEAILELK 421

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LR L KLEE +I+ E   L  E++++  +L S ++  N +  E++   + +        R
Sbjct: 422 LRHLAKLEEMKIRGEQSELEKERDQLQGILASERKMNNLLKKELQADAQAYGDD-----R 476

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           R+   E   A KA  +  M+  EP+T+V+S  GW+RS K H +D   L++K GDS K A+
Sbjct: 477 RSPLQEREEA-KAMSEHDMLPSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAV 535

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
              +   ++ + + G++Y +    L S RG GE +   + L     +    +     KLL
Sbjct: 536 KGKSNQPVVFVDSTGRSYAIDPITLPSARGQGEPLTGKLTLPPGATVDHMLMESDDQKLL 595

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGDHVAVVGENRKLLIF 673
           + S  G  F+   ++++A  R GK  + +     +   +V++   D +  + +  ++L+F
Sbjct: 596 MASDAGYGFVCTFNDLVARNRAGKALITLPENAHVMPPVVIEDASDMLLAITQAGRMLMF 655

Query: 674 SIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDL 726
            +  +P++S+GKG ++        +  + G++ +        LT I    R       +L
Sbjct: 656 PVSDLPQLSKGKGNKIINIPSAEAARGEDGLAQLYVLPPQSTLT-IHVGKRKIKLRPEEL 714

Query: 727 LGWLGKRGGVGSLVPKGFPR 746
               G+RG  G+L+ +G  R
Sbjct: 715 QKVTGERGRRGTLM-RGLQR 733


>gi|307729037|ref|YP_003906261.1| DNA topoisomerase IV subunit A [Burkholderia sp. CCGE1003]
 gi|307583572|gb|ADN56970.1| DNA topoisomerase IV, A subunit [Burkholderia sp. CCGE1003]
          Length = 774

 Score =  518 bits (1333), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 276/693 (39%), Positives = 420/693 (60%), Gaps = 36/693 (5%)

Query: 27  EERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIGKL 86
           E  YL YA+S +K RA+PD+ DG KPV RRI++AM+E+GL   A   KSAR+VG+VIGK 
Sbjct: 28  EGAYLQYAVSVVKGRALPDVCDGQKPVQRRILYAMNELGLSDNAKPVKSARVVGDVIGKY 87

Query: 87  HPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELILQG 146
           HPHGDQS YD+LVRLAQ F  RYPLI GQGNFG+ DGD AAA RYTEAR+T +++L+L  
Sbjct: 88  HPHGDQSAYDALVRLAQDFAMRYPLIDGQGNFGSRDGDGAAAMRYTEARLTPISKLLLDE 147

Query: 147 VDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAALAL 206
           +D+  VDF   Y+  + EP   P++ P LL NG SGIAVG+AT IPSHN++E+  A +A+
Sbjct: 148 IDQGTVDFMPNYDGVEEEPRQLPARLPFLLLNGASGIAVGLATEIPSHNLREVAAATVAM 207

Query: 207 IDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRGSW 266
           I NP+I+  +L++++ GPDFP GG I+ S   I  +Y  GRG  +VRARW +E++ RG W
Sbjct: 208 IRNPKIAHAELMQHLPGPDFPGGGQIISSEAEIAAAYETGRGSLKVRARWKIEDLARGQW 267

Query: 267 CIVVTEIPYQVQKSRLIEKIAE-----LIIAKR-------------IPLLEDIRDESAED 308
            +V+TE+P      +++E+I E     + + K+             + LL+ +RDES +D
Sbjct: 268 QLVITELPPNTAAQKVLEEIEEQTNPKIKLGKKALTPEQLQAKQTMLGLLDAVRDESGKD 327

Query: 309 --VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLA 366
             VR+V  PK+  +D    + ++   + +E+   LN+ ++     P+   L  IL EW+A
Sbjct: 328 APVRLVFEPKSSRIDQTEFVNTLLAHTSLESNASLNLVMVGGDGRPRQKGLSEILHEWIA 387

Query: 367 HRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTEN 426
            R   + RR+  R+  +D R+ IL+G +I YLNIDE+I IIR  D+PK  +++ F L++ 
Sbjct: 388 FRFATVTRRTRHRLTKVDDRIHILEGRMIVYLNIDEVIRIIRESDEPKVALMAAFGLSDR 447

Query: 427 QVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIF 486
           Q D IL +RLR L +LE+ +I+ EL  L  EK K++ LL S      + A +   +KEI 
Sbjct: 448 QADDILEIRLRQLARLEKIKIEKELAELRDEKAKLEELLGS------ESAMKRLLIKEIE 501

Query: 487 SKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFK 546
           + +   G  R T  +  +  +AT +  +I+ EP+TVV+S +GW+R+LK H +D +   FK
Sbjct: 502 ADAKQYGDERRTLIQQEK--RATYEARVID-EPVTVVVSQKGWVRALKGHGLDTAGFTFK 558

Query: 547 EGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAF 606
            GD L  A    T D ++   ++G+ Y++   +L  GRG G  +  LI+L     ++  +
Sbjct: 559 AGDGLYAAFQCRTPDTLVAWGSNGRVYSVAVASLPGGRGDGVPVTSLIELESGSHLMHYY 618

Query: 607 VYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSE----EKMKLVVKVTGDHVA 662
              +   LL+ SS G  FI +  ++++  + GK+F+ + +       M L+   +   VA
Sbjct: 619 AASADQALLLASSNGFGFIAKVGDMVSRVKAGKSFMTIDAGAVPLAPMPLLPDAS--QVA 676

Query: 663 VVGENRKLLIFSIDQIPEMS-RGKGVRLQSYKD 694
            +    +LL+F ID++  +S  G+GV L +  D
Sbjct: 677 CLSSTGRLLVFGIDEMKTLSGGGRGVTLMALDD 709


>gi|330501588|ref|YP_004378457.1| DNA topoisomerase IV subunit A [Pseudomonas mendocina NK-01]
 gi|328915874|gb|AEB56705.1| DNA topoisomerase IV subunit A [Pseudomonas mendocina NK-01]
          Length = 749

 Score =  518 bits (1333), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 281/760 (36%), Positives = 453/760 (59%), Gaps = 27/760 (3%)

Query: 6   ISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMG 65
           +S S  L  E V+  SL    E+ YL Y++  I +RA+P + DG KPV RRI++AMSE+G
Sbjct: 1   MSESLDLSLEGVERRSLADFTEQAYLNYSMYVIMDRALPHIGDGLKPVQRRIVYAMSELG 60

Query: 66  LDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-D 124
           LD  +  KKSAR VG+V+GK HPHGD + Y+++V +AQPF  RY L+ GQGN+G  D   
Sbjct: 61  LDADSKHKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYTLVDGQGNWGAPDDPK 120

Query: 125 SAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIA 184
           S AA RYTEAR+++ +E++L  + +  VD+   ++   +EP   P++ PNLL NGT+GIA
Sbjct: 121 SFAAMRYTEARLSRYSEVLLSELGQGTVDWVPNFDGTMNEPATLPARLPNLLLNGTTGIA 180

Query: 185 VGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYR 244
           VGMAT +P HN++E+  A + L+D P  ++E+L E++ GPDFPT   ++  +  +++ Y 
Sbjct: 181 VGMATDVPPHNLREVAAACVRLLDEPSATVEQLCEHVEGPDFPTEAEVITPKADLLKLYE 240

Query: 245 LGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDE 304
            GRG  R+RA + VE+       IVVT +P+QV  ++++E+IA  + AK++P++ D+RDE
Sbjct: 241 TGRGSVRMRAVYRVED-----GDIVVTALPHQVSGAKVLEQIAAQMQAKKLPMVADLRDE 295

Query: 305 SAED--VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILK 362
           S  +   RIV+ P++  +D D LM  +F  +D+E+ + +N NV+ +   PQV  L  +L 
Sbjct: 296 SDHENPTRIVIIPRSNRVDADELMTHLFATTDLESSYRVNTNVIGLDGKPQVKDLRTLLS 355

Query: 363 EWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFS 422
           EWL +R   + RR  FR+  +++R+ +L+GLLIA+LN+DE+I IIR ED PKPV++  F 
Sbjct: 356 EWLVYRVGTVRRRLQFRLDKVEKRLHLLEGLLIAFLNLDEVIRIIRTEDSPKPVLMETFG 415

Query: 423 LTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREV 482
           LT+ Q D IL+ RLR L +LEE +I+ E D L  E+EK+ +LL+S  +    +  EI E 
Sbjct: 416 LTDVQADYILDTRLRQLARLEEMKIRGEQDELAKEREKLLALLSSEAKLKKLVRKEILED 475

Query: 483 KEIFSKSTDLGRRRTTFCEVSRAD-KATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLS 541
            E +        RR+    V+RA+ KA  +  ++  EP+TVV+S +GW+R  K H +D +
Sbjct: 476 AEKYGDD-----RRSPI--VARAEAKALSETELMPTEPVTVVLSEKGWVRCAKGHDIDAT 528

Query: 542 ALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQD 601
            L +K GD  K A    +    + + + G++Y+L A +L S RG GE +   +       
Sbjct: 529 GLSYKAGDGFKAAAPGRSNQYAVFIDSTGRSYSLTAHSLPSARGQGEPLTGRLTPPPGAT 588

Query: 602 IVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTG 658
                + + +   ++ S  G  F+V+  ++ A  + GK  L + +  K+   K V  +  
Sbjct: 589 FECVMLPEDSALYVIASDAGYGFVVKGEDLQAKNKAGKALLTLPNGAKVVAPKPVNNLED 648

Query: 659 DHVAVVGENRKLLIFSIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTW 711
           D +A V    +LL+F +  +P++ +GKG ++        + ++  ++D+        L  
Sbjct: 649 DWLAAVTTEGRLLLFKVTDLPQLGKGKGNKIIGIPGERVASREEYLTDLAVLPSGSSLV- 707

Query: 712 IDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKFL 751
           + +  R+     +DL  + G+RG  G+ +P+GF R  + L
Sbjct: 708 LQAGKRTLTLKADDLEHYKGERGRRGNKLPRGFQRVDQLL 747


>gi|300724858|ref|YP_003714183.1| DNA topoisomerase IV subunit A [Xenorhabdus nematophila ATCC 19061]
 gi|297631400|emb|CBJ92097.1| DNA topoisomerase IV, subunit A [Xenorhabdus nematophila ATCC
           19061]
          Length = 750

 Score =  518 bits (1333), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 276/752 (36%), Positives = 445/752 (59%), Gaps = 33/752 (4%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           +  + V+   L    E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL   A 
Sbjct: 4   ITHDGVERQPLHTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLSSSAK 63

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 64  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 123

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AEL+L  + +  VD+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 124 YTESRLSKYAELLLSELGQGTVDWVPNFDGTLQEPKMLPARLPNILLNGTTGIAVGMATD 183

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HN +E+  A +A++D PE+S+++ +EYI GPD+PT   I+  ++ I + Y+ GRG  
Sbjct: 184 IPPHNAREVASALIAMLDKPELSLDEAMEYIKGPDYPTEAEIITPKDDIRKIYKNGRGSV 243

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  EE       +++T +P+QV  ++++E+IA  + AK++P+++D+RDES  +  
Sbjct: 244 RMRAIWSKEE-----GNVIITALPHQVSGAKVLEQIASQMRAKKLPMVDDLRDESDHENP 298

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P+   +D + +M  +F  +D+E  + +N+N++ +   P V  L  IL EWL +R
Sbjct: 299 TRLVIVPRTNRVDVEQVMNHLFATTDLERSYRVNLNMIGLDNRPAVKGLVEILSEWLVYR 358

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           RE +  R + R++ + +R+ IL GLL AYLNIDE+I +IRNED+PKPV++ RF LTE Q 
Sbjct: 359 RETVRNRLNHRLEKVLKRLHILDGLLAAYLNIDEVIHLIRNEDEPKPVLMQRFGLTETQA 418

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +A+L L+LR L KLEE +I+ E D L  E++K+ S+L S +++ N +       KEI + 
Sbjct: 419 EAVLELKLRHLAKLEEVKIRGEQDELSKERDKLQSILGS-ERKLNTLLK-----KEIIAD 472

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
           +   G  R +  +     KA     ++  EPITVV+S  GW+RS K H +D + L++K G
Sbjct: 473 AESYGDDRRSPLKERIEAKAMSDHDILPSEPITVVMSEMGWVRSAKGHEIDPAGLNYKSG 532

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           DS + A+   +   ++ + T G++Y++   +L S RG GE +   + L     +    + 
Sbjct: 533 DSFRSAVRGKSNQPVVFIDTTGRSYSVDPLDLPSARGQGEPLTGKLALPAGALVEHLLMA 592

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH---VAVVG 665
               K L+ S  G  FI   S++IA  R GK  + +    K+   +++  +    +  + 
Sbjct: 593 KEEQKFLMASDAGYGFICTFSDLIAKNRAGKALITLPENAKVMEPLEINNEQDEMLLAIT 652

Query: 666 ENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTW-----------IDS 714
           +  ++L+F +  +P++S+GKG ++ S     I         + L+W           +  
Sbjct: 653 KAGRMLMFPVSDLPQLSKGKGNKIVS-----IPAAQAVSGEDTLSWLLVLSPQSTITLYF 707

Query: 715 AGRSYNRSENDLLGWLGKRGGVGSLVPKGFPR 746
             R       DL  +  +RG  G+ +P+G  R
Sbjct: 708 GKRKLQLRPEDLQKFRAERGRKGTSLPRGLQR 739


>gi|149693017|emb|CAK55543.1| topoisomerase IV subunit [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|149693019|emb|CAK55544.1| topoisomerase IV subunit [Salmonella enterica subsp. enterica
           serovar Typhi]
          Length = 752

 Score =  517 bits (1332), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 275/740 (37%), Positives = 448/740 (60%), Gaps = 29/740 (3%)

Query: 23  RFALEE----RYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARI 78
           R AL E     YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A FKKSAR 
Sbjct: 7   RLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNATAKFKKSART 66

Query: 79  VGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMT 137
           VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE+R++
Sbjct: 67  VGDVLGKYHPHGDIACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLS 126

Query: 138 QVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQ 197
           + AEL+L  + +   D+   ++    EP + P++ PN+L NGT+GIAVGMAT IP HN++
Sbjct: 127 KYAELLLSELGQGTADWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLR 186

Query: 198 EICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWC 257
           E+ +AA+ LI+ P+ ++++LL+ + GPD+PT   I+  R  I + Y  GRG  R+RA W 
Sbjct: 187 EVAKAAITLIEQPKTTLDQLLDIVQGPDYPTEAEIIIPRAEIRKIYENGRGSVRMRAVWT 246

Query: 258 VEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIVLFP 315
            E+       +V+T +P+QV  ++++E+IA  +  K++P+++D+RDES  +   R+V+ P
Sbjct: 247 KED-----GAVVITALPHQVSGAKVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIVP 301

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           ++  +D + +M  +F  +D+E  + +N+N++ +   P V  L  IL EWLA RR+ + RR
Sbjct: 302 RSNRVDMEQVMNHLFATTDLEKSYRINLNMIGLDGRPAVKNLLEILTEWLAFRRDTVRRR 361

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
            ++R++ + +R+ IL+GLL+A+LNIDE+I IIRNED+PKP ++SRF ++E Q +AIL L+
Sbjct: 362 LNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEPKPALMSRFGISETQAEAILELK 421

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LR L KLEE +I+ E D L  E++++  +L S ++    +  E++   + +        R
Sbjct: 422 LRHLAKLEEMKIRGEQDELEKERDQLQGILASERKMNTLLKKELQADSDAYGDD-----R 476

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           R+   E   A KA  +  M+  EP+T+V+S  GW+RS K H +D   L++K GDS K A+
Sbjct: 477 RSPLREREEA-KAMSEHDMLPSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAV 535

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
              +   ++ + T G++Y +    L S RG GE +   + L     +    +     KLL
Sbjct: 536 KGKSNQPVVFIDTTGRSYAIDPITLPSARGQGEPLTGKLTLPPGATVEHMLMEGDDQKLL 595

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGDHVAVVGENRKLLIF 673
           + S  G  F+   ++++A  R GKT + +     +   LV+K   D +  + +  ++L+F
Sbjct: 596 MASDAGYGFVCTFNDLVARNRAGKTLITLPENAHVMPPLVIKDEHDMLLAITQAGRMLMF 655

Query: 674 SIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDL 726
            +D +P++S+GKG ++        +  D G++ +        LT I    R       +L
Sbjct: 656 PVDSLPQLSKGKGNKIINIPSAEAAKGDDGLAHLYVLPPQSTLT-IHVGKRKIKLRPEEL 714

Query: 727 LGWLGKRGGVGSLVPKGFPR 746
              +G+RG  G+L+ +G  R
Sbjct: 715 QKVVGERGRRGTLM-RGLQR 733


>gi|331684662|ref|ZP_08385254.1| DNA topoisomerase IV, A subunit [Escherichia coli H299]
 gi|331078277|gb|EGI49483.1| DNA topoisomerase IV, A subunit [Escherichia coli H299]
          Length = 752

 Score =  517 bits (1332), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 273/740 (36%), Positives = 446/740 (60%), Gaps = 29/740 (3%)

Query: 23  RFALEE----RYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARI 78
           R AL E     YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A FKKSAR 
Sbjct: 7   RLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAKFKKSART 66

Query: 79  VGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMT 137
           VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE+R++
Sbjct: 67  VGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLS 126

Query: 138 QVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQ 197
           + +EL+L  + +   D+   ++    EP + P++ PN+L NGT+GIAVGMAT IP HN++
Sbjct: 127 KYSELLLSELGQGTADWVPNFDGTLQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLR 186

Query: 198 EICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWC 257
           E+ +AA+ALID P+ ++++LL+ + GPD+PT   I+ SR  I + Y  GRG  R+RA W 
Sbjct: 187 EVAQAAIALIDQPKTTLDQLLDIVQGPDYPTEAEIITSRAEIRKIYENGRGSVRIRAVWK 246

Query: 258 VEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIVLFP 315
            E+       +V++ +P+QV  +R++E+IA  +  K++P+++D+RDES  +   R+V+ P
Sbjct: 247 KED-----GAVVISALPHQVSGARVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIVP 301

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           ++  +D D +M  +F  +D+E  + +N+N++ +   P V  L  IL EWL  RR+ + RR
Sbjct: 302 RSNRVDMDQVMNHLFATTDLEKSYRINLNMIGLDGRPAVKNLLEILSEWLVFRRDTVRRR 361

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
            ++R++ + +R+ IL+GLL+A+LNIDE+I IIRNED+PKP ++SRF LTE Q +AIL L+
Sbjct: 362 LNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEPKPALMSRFGLTETQAEAILELK 421

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LR L KLEE +I+ E   L  E++++  +L S ++  N +  E++   + +        R
Sbjct: 422 LRHLAKLEEMKIRGEQSELEKERDQLQGILASERKMNNLLKKELQADAQAYGDE-----R 476

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           R+   E   A KA  +  M+  EP+T+V+S  GW+RS K H +D   L++K GDS K A+
Sbjct: 477 RSPLQEREEA-KAMSEHDMLPSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAV 535

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
              +   ++ + + G++Y +    L S RG GE +   + L     +    +     KLL
Sbjct: 536 KGKSNQPVVFVDSTGRSYAIDPITLPSARGQGEPLTGKLTLPPGATVDHMLMESDDQKLL 595

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGDHVAVVGENRKLLIF 673
           + S  G  F+   ++++A  R GK  + +     +   +V++   D +  + +  ++L+F
Sbjct: 596 MASDAGYGFVCTFNDLVARNRAGKALITLPENAHVMPPVVIEDASDMLLAITQAGRMLMF 655

Query: 674 SIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDL 726
            +  +P++S+GKG ++        +  + G++ +        LT I    R       +L
Sbjct: 656 PVSDLPQLSKGKGNKIINIPSAEAARGEDGLAQLYVLPPQSTLT-IHVGKRKIKLRPEEL 714

Query: 727 LGWLGKRGGVGSLVPKGFPR 746
               G+RG  G+L+ +G  R
Sbjct: 715 QKVTGERGRRGTLM-RGLQR 733


>gi|146284119|ref|YP_001174272.1| DNA topoisomerase IV subunit A [Pseudomonas stutzeri A1501]
 gi|145572324|gb|ABP81430.1| DNA topoisomerase IV, A subunit [Pseudomonas stutzeri A1501]
          Length = 750

 Score =  517 bits (1332), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 281/753 (37%), Positives = 446/753 (59%), Gaps = 23/753 (3%)

Query: 6   ISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMG 65
           +S S  L  + V+  SL    E+ YL Y++  I +RA+P + DG KPV RRI++AMSE+G
Sbjct: 1   MSESLDLSLDGVERRSLADFTEQAYLNYSMYVIMDRALPHIGDGLKPVQRRIVYAMSELG 60

Query: 66  LDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-D 124
           L+  A  KKSAR VG+V+GK HPHGD + Y+++V +AQPF  RY L+ GQGN+G  D   
Sbjct: 61  LNADAKHKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYTLVDGQGNWGAPDDPK 120

Query: 125 SAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIA 184
           S AA RYTEAR+++ +E++L  + +  VD+   ++    EP   P++ PNLL NGT+GIA
Sbjct: 121 SFAAMRYTEARLSRYSEVLLSELGQGTVDWVPNFDGTLDEPATLPARLPNLLLNGTTGIA 180

Query: 185 VGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYR 244
           VGMAT +P HN++E+  A + L+D P  S+E+L E++ GPDFPT   IV  R  +++ Y 
Sbjct: 181 VGMATDVPPHNLREVAAACVRLLDEPSASVEQLCEHVQGPDFPTEAEIVTPRADLLKIYE 240

Query: 245 LGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDE 304
            GRG  R+RA + VE+       IVVT +P+QV  S+++E+IA  + AK++P++ D+RDE
Sbjct: 241 TGRGSVRMRAVYRVED-----GDIVVTALPHQVSGSKVLEQIAGQMQAKKLPMVADLRDE 295

Query: 305 SAED--VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILK 362
           S  +   RIV+ P++  +D + LM+ +F  +D+E+ + +N NV+ +   PQV  L  +L 
Sbjct: 296 SDHENPCRIVIIPRSNRVDVEALMQHLFATTDLESSYRVNTNVIGLDGRPQVKNLRTLLS 355

Query: 363 EWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFS 422
           EWL +R   + RR  FR+  +++R+ +L+GLL+A+LN+DE+I IIR ED+PKPV+++RF 
Sbjct: 356 EWLTYRIGTVRRRLQFRLDKVEKRLHLLEGLLVAFLNLDEVIHIIRTEDQPKPVLMARFE 415

Query: 423 LTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREV 482
           L+E Q D IL+ RLR L +LEE +I+ E D L  E+E++ +LL S  +    +  E+ E 
Sbjct: 416 LSELQADYILDTRLRQLARLEEMKIRGEQDELAKERERLLALLGSEAKLKKLVRKELLED 475

Query: 483 KEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSA 542
            E +        RR+   E + A +A  +  ++  EP+TVVIS +GW R  K H +D   
Sbjct: 476 AETYGDD-----RRSPIVERAEA-RALTENELLPSEPVTVVISEKGWARCAKGHDIDAGG 529

Query: 543 LHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDI 602
           L +K GD+ K A    +    + + + G++Y+L A  L S RG GE +   +        
Sbjct: 530 LSYKAGDNFKAAAAGRSNQYAVFIDSTGRSYSLAAHTLPSARGQGEPLTGRLTPPPGASF 589

Query: 603 VTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGD 659
               + D     ++ S  G  F+V+  ++ A  + GK  L + +  ++   + +     D
Sbjct: 590 ECVLLPDDEALYVIASDAGYGFVVKGEDLQAKNKAGKALLSLPAGARVVAPRPLASREDD 649

Query: 660 HVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISD-----VICFKICEGLTWIDS 714
            +A V    +LL+F +  +P++ +GKG ++       ++      V    +  G T +  
Sbjct: 650 WLAAVTTEGRLLVFPVRDLPQLGKGKGNKIIGIPGERVASREEYLVDLAVLPAGATLVLQ 709

Query: 715 AG-RSYNRSENDLLGWLGKRGGVGSLVPKGFPR 746
           AG R+ +    DL  + G+RG  G+ +P+GF R
Sbjct: 710 AGKRTLSLKAEDLEHYKGERGRRGNKLPRGFQR 742


>gi|9971918|gb|AAG10480.1|AF279106_42 predicted topoisomerase IV subunit A [uncultured marine gamma
           proteobacterium EBAC31A08]
          Length = 749

 Score =  517 bits (1332), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 273/750 (36%), Positives = 462/750 (61%), Gaps = 22/750 (2%)

Query: 13  VEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAF 72
           ++E + ++SL+   EE YL YA+  I +RA+P++ DG KPV RRI++AMSE+GLD G+ +
Sbjct: 1   MKEQITSISLKQYAEESYLNYAMYVILDRALPNIGDGLKPVQRRILYAMSELGLDAGSKY 60

Query: 73  KKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRY 131
           KKSAR VG+VIGK HPHGD + Y+++V +AQ F  +YP + GQGN+G+ D   S AA RY
Sbjct: 61  KKSARTVGDVIGKFHPHGDGAAYEAMVLMAQNFSFKYPFVDGQGNWGSQDDPKSFAAMRY 120

Query: 132 TEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSI 191
           TE+++T+ A L++  +    VD++  ++    EPV+FP+K P++L NGTSGIAVGMAT I
Sbjct: 121 TESKLTKFANLLISELKSGTVDWQPNFDGSLLEPVIFPAKLPSILLNGTSGIAVGMATDI 180

Query: 192 PSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFR 251
           PSHN+ EI +A + LIDNP+  +  LL+ I GPDF     I+ S++ + E Y  G+GGF+
Sbjct: 181 PSHNINEIIDATVHLIDNPKSQLVDLLKIINGPDFSNNSPIIASKDELNEIYSTGKGGFK 240

Query: 252 VRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDES--AEDV 309
            +A+W  ++       I++  +PYQ   S+++E+IA+ ++ K+IP++ D+ DE    E V
Sbjct: 241 AQAQWAQDKN-----QIIINALPYQASGSKILEQIADQMLKKKIPMVVDLTDEGDHKEPV 295

Query: 310 RIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRR 369
           R+V+  K+  ++ + +M  +F  +D++  + +NMN++S+   P+V  L  +LKEWL  R+
Sbjct: 296 RLVITLKSNRVNAEDVMNHLFASTDLQKNYRVNMNLISLKGGPKVFSLVDLLKEWLVFRK 355

Query: 370 EVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVD 429
           E + R+   R+  ++ R+ IL+GLLI YL++D++I IIR  D+PK  +++ F L++ Q +
Sbjct: 356 ETVIRKLEHRLDQVNDRLHILEGLLIVYLDLDKVIKIIRESDEPKKDIITAFKLSDIQAN 415

Query: 430 AILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKS 489
           AIL +RLR L KLE+ +++ E D L+AE+  I+ +L+S  +    I  E+ E+K+ F + 
Sbjct: 416 AILEIRLRQLAKLEQIKLEQERDTLVAEQTDIEKILSSKTRLKTLIKNELIEIKDEFGEV 475

Query: 490 TDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGD 549
                R +   E + A   + ++ ++  EPITVV+S  GWIRS K H +D S+L ++  D
Sbjct: 476 -----RXSPIREATEAKVFSEEETLV-TEPITVVLSAAGWIRSAKGHEIDPSSLSYRGED 529

Query: 550 SLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYD 609
            L+      +    + L ++GKAY+L + +L S RG G+ I   +  +     +++ + +
Sbjct: 530 VLQDYGRGKSNQVSVFLDSNGKAYSLASHSLPSARGMGDPITGRVSADSGVKFISSLIGN 589

Query: 610 STCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH--VAVVGEN 667
              K +++++ G  +I E   +++N + GK F+K+  E  +   +KV  DH  +A V   
Sbjct: 590 DEDKFMIMNTAGYGYISEFKNMVSNKKSGKAFMKIPHEADLLKAIKVRDDHLYIAAVSNI 649

Query: 668 RKLLIFSIDQIPEMSRGKG---VRLQSYKDGGISDVICFK--ICEGLTW-IDSAGRSYNR 721
            +LLIF ID++P + +GKG   + + + K     +++     + E  +  I+S  R    
Sbjct: 650 GRLLIFKIDELPTLGKGKGNKIINIPTAKFIAKEELMTHAQLVSEASSLRIESGKRFLTL 709

Query: 722 SENDLLGWLGKRGGVGSLVPKGFPRSGKFL 751
              DL  ++  R   G+++P+G+ +  K +
Sbjct: 710 KLKDLENYISTRAKRGNMLPQGYRKVDKMI 739


>gi|254482759|ref|ZP_05095997.1| DNA topoisomerase IV, A subunit [marine gamma proteobacterium
           HTCC2148]
 gi|214037118|gb|EEB77787.1| DNA topoisomerase IV, A subunit [marine gamma proteobacterium
           HTCC2148]
          Length = 750

 Score =  517 bits (1332), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 286/754 (37%), Positives = 457/754 (60%), Gaps = 31/754 (4%)

Query: 14  EENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK 73
           E+ ++ VSL+   E+ YL Y++  I +RA+P + DG KPV RRI++AMSE+GL   A FK
Sbjct: 9   EDGIEQVSLKTYAEKAYLDYSMYVILDRALPHVGDGLKPVQRRIVYAMSELGLKATAKFK 68

Query: 74  KSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYT 132
           KSAR VG+VIGK HPHGD + Y+++V +AQ F  RYPL+ GQGN+G+ D   S AA RYT
Sbjct: 69  KSARTVGDVIGKFHPHGDSAAYEAMVLMAQNFSYRYPLVDGQGNWGSPDDPKSFAAMRYT 128

Query: 133 EARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIP 192
           E+R+T  A+++L  + +  VD+   ++    EP V P++ PN+L NGT+GIAVGMAT +P
Sbjct: 129 ESRLTAYADVLLSELGQGTVDWSPNFDGTMDEPTVLPAQVPNVLLNGTTGIAVGMATDVP 188

Query: 193 SHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRV 252
            HN++E+  A + L+++P+ ++ +L E++  PDFPT   I+  RE I+  Y  GRG  ++
Sbjct: 189 PHNLREVVAATIHLLESPKATVAELCEHVQAPDFPTDAEIITPREDIMAMYETGRGALKM 248

Query: 253 RARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VR 310
           RA W  E        IVV+ +P+QV  S+++E+IA  + AK++P++ D+RDES  +   R
Sbjct: 249 RAVWEKE-----GPDIVVSALPHQVSGSKVLEQIAHQMQAKKLPMVADLRDESDHENPTR 303

Query: 311 IVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRRE 370
           +V+ P++  ++ + +M  +F  +D+E  + +N+N++ +   P V  LD ILKEWL  R E
Sbjct: 304 LVIVPRSNRVEVEAVMNHLFATTDLERSYRVNLNMIGIDGRPGVKGLDRILKEWLKFRTE 363

Query: 371 VLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDA 430
            + RR  +R++ + RR+ IL G L+A+LNIDE+I IIR EDKPKP ++ RF +++ Q +A
Sbjct: 364 TVRRRLEYRLERVLRRLHILDGYLVAFLNIDEVIHIIRTEDKPKPALMKRFGISDVQAEA 423

Query: 431 ILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKST 490
           IL+L+LR+L KLEE +I+ E D L  E++++ ++L S  +    I  E++ V E F    
Sbjct: 424 ILDLKLRNLAKLEEMKIRGEQDELEVERDQLQTILGSAARLKTLIKKELQSVAEKFGDD- 482

Query: 491 DLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDS 550
               RR+       A +A  +  ++  +PITVV+S +GWIR+ K H +D S+L +K GD 
Sbjct: 483 ----RRSPLMARGEA-QAFSELDLMTADPITVVMSEKGWIRAAKGHDIDPSSLSYKSGDG 537

Query: 551 LKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDS 610
            K+A    +    ++L + G+AYT+P+ NL S RG GE +   I+           + D 
Sbjct: 538 FKMAAKGRSNQPTVILDSTGRAYTVPSHNLPSARGQGEPVTGRINPPSGATFEGLMMGDE 597

Query: 611 TCKLLVVSSKGNAFIVEESEIIANTRKGKTFL---KVSSEEKMKLVVKVTGDHVAVVGEN 667
               L+ S  G  F+ +  E+    + GK  L   K S   +   + +  G  VA V   
Sbjct: 598 GDLYLLASDAGYGFVAKLGELQTKNKAGKGALNLPKGSGVMQPAAISEAEGAWVAAVTNE 657

Query: 668 RKLLIFSIDQIPEMSRGKG--------VRLQSYKDGGISDVICFKI-CEGLTWIDSAGRS 718
            +LL+F ++ +P+M+RGKG         R+QS ++     VI  ++  +  T +  AG+ 
Sbjct: 658 GRLLVFPLEDLPQMARGKGNKIIGIPTARVQSREEF----VIAVQVLTDKDTLVVYAGKR 713

Query: 719 YNRSE-NDLLGWLGKRGGVGSLVPKGFPRSGKFL 751
           +++ + +DL  + G+RG  G+ +P+GF +    L
Sbjct: 714 HHKLKFSDLKHYCGERGRRGNKLPRGFQKVDAML 747


>gi|167551913|ref|ZP_02345666.1| DNA topoisomerase IV, A subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205323307|gb|EDZ11146.1| DNA topoisomerase IV, A subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
          Length = 752

 Score =  517 bits (1332), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 273/740 (36%), Positives = 448/740 (60%), Gaps = 29/740 (3%)

Query: 23  RFALEE----RYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARI 78
           R AL E     YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A FKKSAR 
Sbjct: 7   RLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAKFKKSART 66

Query: 79  VGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMT 137
           VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE+R++
Sbjct: 67  VGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLS 126

Query: 138 QVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQ 197
           + AEL+L  + +   D+   ++    EP + P++ PN+L NGT+GIAVGMAT IP HN++
Sbjct: 127 KYAELLLSELGQGTADWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLR 186

Query: 198 EICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWC 257
           E+ +AA+ LI+ P+ ++++LL+ + GPD+PT   I+  R  I + Y  GRG  R+RA W 
Sbjct: 187 EVAKAAITLIEQPKTTLDQLLDIVQGPDYPTEAEIITPRAEIRKIYENGRGSVRMRAVWT 246

Query: 258 VEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIVLFP 315
            E+       +V++ +P+QV  ++++E+IA  +  K++P+++D+RDES  +   R+V+ P
Sbjct: 247 KED-----GAVVISALPHQVSGAKVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIVP 301

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           ++  +D + +M  +F  +D+E  + +N+N++ +   P V  L  IL EWLA RR+ + RR
Sbjct: 302 RSNRVDMEQVMNHLFATTDLEKSYRINLNMIGLDGRPAVKNLLEILTEWLAFRRDTVRRR 361

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
            ++R++ + +R+ IL+GLL+A+LNIDE+I IIRNED+PKP ++SRF ++E Q +AIL L+
Sbjct: 362 LNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEPKPALMSRFGISETQAEAILELK 421

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LR L KLEE +I+ E D L  E++++  +L S ++    +  E++   + +        R
Sbjct: 422 LRHLAKLEEMKIRGEQDELEKERDQLQGILASERKMNTLLKKELQADSDAYGDD-----R 476

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           R+   E   A KA  +  M+  EP+T+V+S  GW+RS K H +D   L++K GDS K A+
Sbjct: 477 RSPLREREEA-KAMSEHDMLPSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAV 535

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
              +   ++ + T G++Y +    L S RG GE +   + L     +    +     KLL
Sbjct: 536 KGKSNQPVVFIDTTGRSYAIDPITLPSARGQGEPLTGKLTLPPGATVEHMLMEGDDQKLL 595

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGDHVAVVGENRKLLIF 673
           + S  G  F+   ++++A  R GKT + +     +   LV++   D +  + +  ++L+F
Sbjct: 596 MASDAGYGFVCTFNDLVARNRAGKTLITLPENAHVMPPLVIEDEHDMLLAITQAGRMLMF 655

Query: 674 SIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDL 726
            +D +P++S+GKG ++        +  D G++ +        LT I    R       +L
Sbjct: 656 PVDSLPQLSKGKGNKIINIPSAEAAKGDDGLAHLYVLPPQSTLT-IHVGKRKIKLRPEEL 714

Query: 727 LGWLGKRGGVGSLVPKGFPR 746
              +G+RG  G+L+ +G  R
Sbjct: 715 QKVVGERGRRGTLM-RGLQR 733


>gi|326629208|gb|EGE35551.1| DNA topoisomerase IV subunit A [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 760

 Score =  517 bits (1331), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 272/747 (36%), Positives = 451/747 (60%), Gaps = 25/747 (3%)

Query: 12  LVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAA 71
           L+ +  + ++L    E  YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A 
Sbjct: 8   LMSDMAERLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNATAK 67

Query: 72  FKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYR 130
           FKKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA R
Sbjct: 68  FKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMR 127

Query: 131 YTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATS 190
           YTE+R+++ AEL+L  + +   D+   ++    EP + P++ PN+L NGT+GIAVGMAT 
Sbjct: 128 YTESRLSKYAELLLSELGQGTADWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATD 187

Query: 191 IPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGF 250
           IP HN++E+ +AA+ LI+ P+ ++++LL+ + GPD+PT   I+  R  I + Y  GRG  
Sbjct: 188 IPPHNLREVAKAAITLIEQPKTTLDQLLDIVQGPDYPTEAEIITPRAEIRKIYENGRGSV 247

Query: 251 RVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED-- 308
           R+RA W  E+       +V+T +P+QV  ++++E+IA  +  K++P+++D+RDES  +  
Sbjct: 248 RMRAVWTKED-----GAVVITALPHQVSGAKVLEQIAAQMRNKKLPMVDDLRDESDHENP 302

Query: 309 VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHR 368
            R+V+ P++  +D + +M  +F  +D+E  + +N+N++ +   P V  L  IL EWLA R
Sbjct: 303 TRLVIVPRSNRVDMEQVMNHLFATTDLEKSYRINLNMIGLDGRPAVKNLLEILTEWLAFR 362

Query: 369 REVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQV 428
           R+ + RR ++R++ + +R+ IL+GLL+A+LNIDE+I IIRNED+PKP ++SRF ++E Q 
Sbjct: 363 RDTVRRRLNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEPKPALMSRFGISETQA 422

Query: 429 DAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSK 488
           +AIL L+LR L KLEE +I+ E D L  E++++  +L S ++    +  E++   + +  
Sbjct: 423 EAILELKLRHLAKLEEMKIRGEQDELEKERDQLQGILASERKMNTLLKKELQADSDAYGD 482

Query: 489 STDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEG 548
                 RR+   E   A KA  +  M+  EP+T+V+S  GW+RS K H +D   L++K G
Sbjct: 483 D-----RRSPLREREEA-KAMSEHDMLPSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAG 536

Query: 549 DSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY 608
           DS K A+   +   ++ + T G++Y +    L S RG GE +   + L     +    + 
Sbjct: 537 DSFKAAVKGKSNQPVVFIDTTGRSYAIDPITLPSARGQGEPLTGKLTLPPGATVEHMLME 596

Query: 609 DSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGDHVAVVGE 666
               KLL+ S  G  F+   ++++A  R GK  + +     +   LV++   D +  + +
Sbjct: 597 GDDQKLLMASDAGYGFVCTFNDLVARNRAGKALITLPENAHVMPPLVIEDEHDMLLAITQ 656

Query: 667 NRKLLIFSIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSY 719
             ++L+F +D +P++S+GKG ++        +  D G++ +        LT I    R  
Sbjct: 657 AGRMLMFPVDSLPQLSKGKGNKIINIPSAEAAKGDDGLAHLYVLPPQSTLT-IHVGKRKI 715

Query: 720 NRSENDLLGWLGKRGGVGSLVPKGFPR 746
                +L   +G+RG  G+L+ +G  R
Sbjct: 716 KLRPEELQKVVGERGRRGTLM-RGLQR 741


>gi|254491713|ref|ZP_05104892.1| DNA topoisomerase IV, A subunit [Methylophaga thiooxidans DMS010]
 gi|224463191|gb|EEF79461.1| DNA topoisomerase IV, A subunit [Methylophaga thiooxydans DMS010]
          Length = 746

 Score =  517 bits (1331), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 283/747 (37%), Positives = 449/747 (60%), Gaps = 25/747 (3%)

Query: 11  TLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGA 70
           T++ ++++   LR   E+ YL Y++  I +RA+P + DG KPV RRI++AMSE+GL   +
Sbjct: 2   TIIVDDLEQQPLRDFTEKAYLDYSMYVILDRALPHIGDGLKPVQRRIVYAMSELGLSALS 61

Query: 71  AFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAY 129
             KKSAR VG+V+GK HPHGD + Y+++V +AQPF  RY LI GQGN+G++D   S AA 
Sbjct: 62  KHKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYTLIDGQGNWGSMDDPKSFAAM 121

Query: 130 RYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMAT 189
           RYTEAR+   A+++L  + +   D+   ++    EP + P++ PNLL NGT+GIAVGMAT
Sbjct: 122 RYTEARLAPYAQVLLSELGQGTADWVPNFDGTMDEPSLLPARLPNLLLNGTTGIAVGMAT 181

Query: 190 SIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGG 249
            IP HN++E+  A+L L+ +P +++++LLE I GPDFPTG  I+ S++ I + Y  G G 
Sbjct: 182 DIPPHNLREVVSASLKLLKSPRVTLDELLEDIQGPDFPTGAEIISSQDEIRKIYETGHGS 241

Query: 250 FRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED- 308
            + RA +  E+       I++  +PYQV  ++++E+IA  + AK++P++ D+RDES  + 
Sbjct: 242 VKQRASYNKED-----GEIIIDALPYQVSGAKILEQIAAQMNAKKLPMVADLRDESDHEH 296

Query: 309 -VRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAH 367
            VR+V+ P++  +D D LM  +F  +D+E    +NMN++ M   PQV  L  +L EWL +
Sbjct: 297 PVRLVIVPRSNRVDIDSLMSHLFATTDLERSHRVNMNMIGMDGRPQVKNLRDMLIEWLGY 356

Query: 368 RREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQ 427
           R E + RR  +R+  +  R+ +L+GLLIAYLNIDE+IAIIR+ED PK VM+ RFS+T+ Q
Sbjct: 357 RVETVRRRLQYRLDKVLDRMHVLEGLLIAYLNIDEVIAIIRHEDDPKAVMMERFSITDRQ 416

Query: 428 VDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFS 487
            ++IL LRLR L KLEE +I+ E+D L  E+++++ LL+S  +    I  E+    E F 
Sbjct: 417 AESILELRLRHLAKLEEMKIRGEMDELSKERKQLELLLSSDTRLKTLIRKELTADAEKFG 476

Query: 488 KSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKE 547
                  RR+   E  +A KA     ++  EP+T+V+S  GW+++ K H VD ++L+F+ 
Sbjct: 477 DD-----RRSQIVE-RKASKALDATELLPTEPLTIVLSESGWVKAAKGHDVDPTSLNFRT 530

Query: 548 GDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFV 607
           GD    ++ A +  +I+ L   G++Y+L A  L S RG GE +   +        V+   
Sbjct: 531 GDRYLTSVKARSNQQIVFLDETGRSYSLSAHTLPSARGQGEPLSGRLQSAPEVRFVSVLA 590

Query: 608 YDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVV 664
            ++   +L+ ++ G  F+     ++A  + GK    +    ++    L+     D +AV 
Sbjct: 591 VEADKTILLTNTAGYGFVTTLENLLAKNKAGKALFNLPKGAQILPPLLLEDQDNDQMAVA 650

Query: 665 GENRKLLIFSIDQIPEMSRGKGVRL----QSYKDGG---ISDVICFKICEGLTWIDSAGR 717
             + +LL+F+  +IP +++GKGVRL    Q+   GG   +  VI       LT + +  R
Sbjct: 651 SGDGRLLVFAASEIPTLNKGKGVRLINIPQARFTGGQEWMQSVIIVPQQRSLT-LHAGRR 709

Query: 718 SYNRSENDLLGWLGKRGGVGSLVPKGF 744
                  DL  + G+RG  G  +P+G 
Sbjct: 710 HLTLKPADLEHYAGERGKRGHKLPRGL 736


>gi|323971855|gb|EGB67080.1| DNA topoisomerase IV [Escherichia coli TA007]
          Length = 752

 Score =  517 bits (1331), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 273/740 (36%), Positives = 446/740 (60%), Gaps = 29/740 (3%)

Query: 23  RFALEE----RYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARI 78
           R AL E     YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A FKKSAR 
Sbjct: 7   RLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAKFKKSART 66

Query: 79  VGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMT 137
           VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE+R++
Sbjct: 67  VGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLS 126

Query: 138 QVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQ 197
           + +EL+L  + +   D+   ++    EP + P++ PN+L NGT+GIAVGMAT IP HN++
Sbjct: 127 KYSELLLSELGQGTADWMPNFDGTLQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLR 186

Query: 198 EICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWC 257
           E+ +AA+ALID P+ ++++LL+ + GPD+PT   I+ SR  I + Y  GRG  R+RA W 
Sbjct: 187 EVAQAAIALIDQPKTTLDQLLDIVQGPDYPTEAEIITSRAEIRKIYENGRGSVRMRAVWK 246

Query: 258 VEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIVLFP 315
            E+       +V++ +P+QV  +R++E+IA  +  K++P+++D+RDES  +   R+V+ P
Sbjct: 247 KED-----GAVVISALPHQVSGARVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIVP 301

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           ++  +D D +M  +F  +D+E  + +N+N++ +   P V  L  IL EWL  RR+ + RR
Sbjct: 302 RSNRVDMDQVMNHLFATTDLEKSYRINLNMIGLDGRPAVKNLLEILSEWLVFRRDTVRRR 361

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
            ++R++ + +R+ IL+GLL+A+LNIDE+I IIRNED+PKP ++SRF LTE Q +AIL L+
Sbjct: 362 LNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEPKPALMSRFGLTETQAEAILELK 421

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LR L KLEE +I+ E   L  E++++  +L S ++  N +  E++   + +        R
Sbjct: 422 LRHLAKLEEMKIRGEQSELEKERDQLQGILASERKMNNLLKKELQADAQAYGDD-----R 476

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           R+   E   A KA  +  M+  EP+T+V+S  GW+RS K H +D   L++K GDS K A+
Sbjct: 477 RSPLQEREEA-KAMSEHDMLPSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAV 535

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
              +   ++ + + G++Y +    L S RG GE +   + L     +    +     KLL
Sbjct: 536 KGKSNQPVVFVDSTGRSYAIDPITLPSARGQGEPLTGKLTLPPGATVDHMLMESDDQKLL 595

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGDHVAVVGENRKLLIF 673
           + S  G  F+   ++++A  R GK  + +     +   +V++   D +  + +  ++L+F
Sbjct: 596 MASDAGYGFVCTFNDLVARNRAGKALITLPENAHVMPPVVIEDASDMLLAITQAGRMLMF 655

Query: 674 SIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDL 726
            +  +P++S+GKG ++        +  + G++ +        LT I    R       +L
Sbjct: 656 PVSDLPQLSKGKGNKIINIPSAEAARGEDGLAQLYVLPPQSTLT-IHVGKRKIKLRPEEL 714

Query: 727 LGWLGKRGGVGSLVPKGFPR 746
               G+RG  G+L+ +G  R
Sbjct: 715 QKVTGERGRRGTLM-RGLQR 733


>gi|170765566|ref|ZP_02900377.1| DNA topoisomerase IV, A subunit [Escherichia albertii TW07627]
 gi|170124712|gb|EDS93643.1| DNA topoisomerase IV, A subunit [Escherichia albertii TW07627]
          Length = 752

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 272/740 (36%), Positives = 450/740 (60%), Gaps = 29/740 (3%)

Query: 23  RFALEE----RYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARI 78
           R AL E     YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A FKKSAR 
Sbjct: 7   RLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAKFKKSART 66

Query: 79  VGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMT 137
           VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE+R++
Sbjct: 67  VGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLS 126

Query: 138 QVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQ 197
           + +EL+L  + +   D+   ++    EP + P++ PN+L NGT+GIAVGMAT IP HN++
Sbjct: 127 KYSELLLSELGQGTADWVPNFDGTLQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLR 186

Query: 198 EICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWC 257
           E+ +AA+ALID P+ ++++LL+ + GPD+PT   I+ SR  I + Y  GRG  R+RA W 
Sbjct: 187 EVAQAAIALIDEPKTTLDQLLDIVQGPDYPTEAEIITSRAEIRKIYENGRGSVRMRAVWK 246

Query: 258 VEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIVLFP 315
            E+       +V++ +P+QV  +R++E+IA  +  K++P+++D+RDES  +  +R+V+ P
Sbjct: 247 KED-----GAVVISALPHQVSGARVLEQIAAQMRNKKLPMVDDLRDESDHENPIRLVIVP 301

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           ++  +D D +M  +F  +D+E  + +N+N++ +   P V  L  IL EWL  RR+ + RR
Sbjct: 302 RSNRVDMDQVMNHLFATTDLEKSYRINLNMIGLDGRPAVKNLLEILSEWLVFRRDTVRRR 361

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
            ++R++ + +R+ IL+GLL+A+LNIDE+I IIR+ED+PKP ++SRF +TE Q +AIL L+
Sbjct: 362 LNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRSEDEPKPKLMSRFGITETQAEAILELK 421

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LR L KLEE +I+ E + L  E++++ S+L S ++  N +  E++   + +        R
Sbjct: 422 LRHLAKLEEMKIRGEQNELEKERDQLQSILASERKMNNLLKKELQADAQAYGDE-----R 476

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           R+   E   A KA  +  M+  EP+T+V+S  GW+RS K H +D   L++K GDS K A+
Sbjct: 477 RSPLQEREEA-KAMSEHDMLPSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAV 535

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
              +   ++ + + G++Y +    L S RG GE +   + L     +    +     KLL
Sbjct: 536 KGKSNQPVVFVDSTGRSYAIDPITLPSARGQGEPLTGKLTLPPGATVDHMLMESDDQKLL 595

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGDHVAVVGENRKLLIF 673
           + S  G  F+   ++++A  R GK  + +     +   +V++   D +  + +  ++L+F
Sbjct: 596 MASDAGYGFVCTFNDLVARNRAGKALITLPENAHVMPPVVIEDASDMLLAITQAGRMLMF 655

Query: 674 SIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDL 726
            +  +P++S+GKG ++        +  + G++ +    +   LT I    R       +L
Sbjct: 656 PVSDLPQLSKGKGNKIINIPSAEAARGEDGLAQLYVLPLQSTLT-IHVGKRKIKLRPEEL 714

Query: 727 LGWLGKRGGVGSLVPKGFPR 746
               G+RG  G+L+ +G  R
Sbjct: 715 QKVTGERGRRGTLM-RGLQR 733


>gi|88797643|ref|ZP_01113232.1| DNA topoisomerase IV, A subunit [Reinekea sp. MED297]
 gi|88779815|gb|EAR11001.1| DNA topoisomerase IV, A subunit [Reinekea sp. MED297]
          Length = 747

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 281/740 (37%), Positives = 450/740 (60%), Gaps = 25/740 (3%)

Query: 18  KAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSAR 77
           + +SL    E+ YL Y++  I +RA+P + DG KPV RRI++AMSE+GL   A +KKSAR
Sbjct: 9   ETISLGQFTEKAYLDYSMYVILDRALPHVGDGLKPVQRRIVYAMSELGLRNTAKYKKSAR 68

Query: 78  IVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARM 136
            VG+V+GK HPHGD + Y+++V +AQ F  RYPL+ GQGN+G+ D   S AA RYTE+R+
Sbjct: 69  TVGDVLGKYHPHGDSACYEAMVLMAQSFSYRYPLVDGQGNWGSPDDPKSFAAMRYTESRL 128

Query: 137 TQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNV 196
            + A L+L+ + +  VD+   ++    EP V P++ P++L NGT+GIAVGMAT IP HN+
Sbjct: 129 HKNAHLLLEELGQGTVDWVPNFDGTMDEPSVLPARLPHVLLNGTTGIAVGMATDIPPHNL 188

Query: 197 QEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARW 256
           +E+  A + LID P+ S+  L+ ++ GPDFPTG  ++  +E I + Y  GRG  R+R+++
Sbjct: 189 KELAAACVHLIDQPDASVTDLMMHVRGPDFPTGAELISPKEDIRKIYEGGRGTLRLRSKY 248

Query: 257 CVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIVLF 314
             E        IV+TE+P+QV  S+++E+IA+ + AK++P++ D+RDES  +   R+V+ 
Sbjct: 249 IQE-----GTDIVITELPHQVSGSKILEQIAQQMQAKKLPMVADLRDESDHENPTRLVIE 303

Query: 315 PKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFR 374
           P++  +D D LM  +F  +D+E    +N+N++ +   PQV PL+ IL EWL  R E + R
Sbjct: 304 PRSNRVDTDALMNHLFATTDLEKTIRVNLNMIGIDGKPQVKPLNHILSEWLEFRTETVRR 363

Query: 375 RSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNL 434
           R  +R+  +  R+ IL GLLIAYLNIDE+I IIR EDKPK  +++RF L++ Q +AIL +
Sbjct: 364 RLQYRLDKVLARLHILDGLLIAYLNIDEVIDIIRTEDKPKEELMARFGLSDVQAEAILEI 423

Query: 435 RLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGR 494
           +LR L KLEE +I+ E D L  E+++++ +L S  +    I       KEI + +   G 
Sbjct: 424 KLRQLAKLEEIKIRGEQDELSKERDQLEKILGSKARMRTLIK------KEILADAETYGD 477

Query: 495 RRTTFCEVSRADKATLQQA-MIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKI 553
            R T   VSRA+ +   +  ++  E +TVV+S RGWIRS K H ++   L++K GDS   
Sbjct: 478 DRRTLL-VSRAEASAFSETEILPSEAVTVVLSERGWIRSGKGHELEPEGLNYKSGDSFAF 536

Query: 554 ALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCK 613
           A    +    +LL + G++Y+L    L S RG GE I   ++      +    + +   +
Sbjct: 537 AARGKSNQATVLLDSTGRSYSLQTHTLPSARGQGEPITTRLNPPPGAAMKGLLLGNPDDQ 596

Query: 614 LLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM---KLVVKVTGDHVAVVGENRKL 670
            L+ S  G  FI + S++++  + GK  L +    ++   + V +++ D++A +    +L
Sbjct: 597 YLLTSDAGYGFIGKLSDMVSKNKAGKALLSLPKGAEVMPPQPVKQLSTDYLAAISNEGRL 656

Query: 671 LIFSIDQIPEMSRGKG---VRLQSYKDGGISDVICFKICEGL--TWIDSAG-RSYNRSEN 724
           L+F +  +PE+++GKG   + + S +     +++   +  G   T +  AG R      +
Sbjct: 657 LVFPVRDLPELAKGKGNKIINIPSSRAAAREELMVGAVVLGADDTLLVYAGKRKLKLRGS 716

Query: 725 DLLGWLGKRGGVGSLVPKGF 744
           DL  +LG+RG  G+ +P+GF
Sbjct: 717 DLEHYLGERGRRGNKLPRGF 736


>gi|168819764|ref|ZP_02831764.1| DNA topoisomerase IV, A subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205343323|gb|EDZ30087.1| DNA topoisomerase IV, A subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|320087625|emb|CBY97389.1| topoisomerase IV subunit A [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 752

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 273/740 (36%), Positives = 447/740 (60%), Gaps = 29/740 (3%)

Query: 23  RFALEE----RYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARI 78
           R AL E     YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A FKKSAR 
Sbjct: 7   RLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAKFKKSART 66

Query: 79  VGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMT 137
           VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE+R++
Sbjct: 67  VGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLS 126

Query: 138 QVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQ 197
           + AEL+L  + +   D+   ++    EP + P++ PN+L NGT+GIAVGMAT IP HN++
Sbjct: 127 KYAELLLSELGQGTADWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLR 186

Query: 198 EICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWC 257
           E+ +AA+ LI+ P+ ++++LL+ + GPD+PT   I+  R  I + Y  GRG  R+RA W 
Sbjct: 187 EVAKAAITLIEQPKTTLDQLLDIVQGPDYPTEAEIITPRAEIRKIYENGRGSVRMRAVWT 246

Query: 258 VEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIVLFP 315
            E+       +V+T +P+QV  ++++E+IA  +  K++P+++D+RDES  +   R+V+ P
Sbjct: 247 KED-----GAVVITALPHQVSGAKVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIVP 301

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           ++  +D + +M  +F  +D+E  + +N+N++ +   P V  L  IL EWLA RR+ + RR
Sbjct: 302 RSNRVDMEQVMNHLFATTDLEKSYRINLNMIGLDGRPAVKNLLEILTEWLAFRRDTVRRR 361

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
            ++R++ + +R+ IL+GLL+A+LNIDE+I IIRNED+PKP ++SRF ++E Q +AIL L+
Sbjct: 362 LNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEPKPALMSRFGISETQAEAILELK 421

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LR L KLEE +I+ E D L  E++++  +L S ++    +  E++   + +        R
Sbjct: 422 LRHLAKLEEMKIRGEQDELEKERDQLQGILASERKMNTLLKKELQADSDAYGDD-----R 476

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           R+   E   A KA  +  M+  EP+T+V+S  GW+RS K H +D   L++K GDS K A+
Sbjct: 477 RSPLREREEA-KAMSEHDMLPSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAV 535

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
              +   ++ + T G++Y +    L S RG GE +   + L     +    +     KLL
Sbjct: 536 KGKSNQPVVFIDTTGRSYAIDPITLPSARGQGEPLTGKLTLPPGATVEHMLMEGDDQKLL 595

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGDHVAVVGENRKLLIF 673
           + S  G  F+   ++++A  R GK  + +     +   LV++   D +  + +  ++L+F
Sbjct: 596 MASDAGYGFVCTFNDLVARNRAGKALITLPENAHVMPPLVIEDEHDMLLAITQAGRMLMF 655

Query: 674 SIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDL 726
            +D +P++S+GKG ++        +  D G++ +        LT I    R       +L
Sbjct: 656 PVDSLPQLSKGKGNKIINIPSAEAAKGDDGLAHLYVLPPQSTLT-IHVGKRKIKLRPEEL 714

Query: 727 LGWLGKRGGVGSLVPKGFPR 746
              +G+RG  G+L+ +G  R
Sbjct: 715 QKVVGERGRRGTLM-RGLQR 733


>gi|323168137|gb|EFZ53824.1| DNA topoisomerase IV, A subunit [Shigella sonnei 53G]
          Length = 752

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 273/740 (36%), Positives = 446/740 (60%), Gaps = 29/740 (3%)

Query: 23  RFALEE----RYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARI 78
           R AL E     YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A FKKSAR 
Sbjct: 7   RLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAKFKKSART 66

Query: 79  VGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMT 137
           VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE+R++
Sbjct: 67  VGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLS 126

Query: 138 QVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQ 197
           + +EL+L  + +   D+   ++    EP + P++ PN+L NGT+GIAVGMAT IP HN++
Sbjct: 127 KYSELLLSELGQGTADWVPNFDGTLQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLR 186

Query: 198 EICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWC 257
           E+ +AA+ALID P+ ++++LL+ + GPD+PT   I+ SR  I + Y  GRG  R+RA W 
Sbjct: 187 EVAQAAIALIDQPKTTLDQLLDIVQGPDYPTEAEIITSRAEIRKIYENGRGSVRMRAVWK 246

Query: 258 VEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIVLFP 315
            E+       +V++ +P+QV  +R++E+IA  +  K++P+++D+RDES  +   R+V+ P
Sbjct: 247 KED-----GAVVISALPHQVSGARVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIVP 301

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           ++  +D D +M  +F  +D+E  + +N+N++ +   P V  L  IL EWL  RR+ + RR
Sbjct: 302 RSNRVDMDQVMNHLFATTDLEKSYRINLNMIGLDGRPAVKNLLEILSEWLVFRRDTVRRR 361

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
            ++R++ + +R+ IL+GLL+A+LNIDE+I IIRNED+PKP ++SRF LTE Q +AIL L+
Sbjct: 362 LNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEPKPALMSRFGLTETQAEAILELK 421

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LR L KLEE +I+ E   L  E++++  +L S ++  N +  E++   + +        R
Sbjct: 422 LRHLAKLEEMKIRGEQSELEKERDQLQGILASERKMNNLLKKELQADAQAYGDD-----R 476

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           R+   E   A KA  +  M+  EP+T+V+S  GW+RS K H +D   L++K GDS K A+
Sbjct: 477 RSPLQEREEA-KAMSEHDMLPSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAV 535

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
              +   ++ + + G++Y +    L S RG GE +   + L     +    +     KLL
Sbjct: 536 KGKSNQSVVFVDSTGRSYAIDPITLPSARGQGEPLTGKLTLPPGATVDHMLMESDDQKLL 595

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGDHVAVVGENRKLLIF 673
           + S  G  F+   ++++A  R GK  + +     +   +V++   D +  + +  ++L+F
Sbjct: 596 MASDAGYGFVCTFNDLVARNRAGKALITLPENAHVMPPVVIEDASDMLLAITQAGRMLMF 655

Query: 674 SIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDL 726
            +  +P++S+GKG ++        +  + G++ +        LT I    R       +L
Sbjct: 656 PVSDLPQLSKGKGNKIINIPSAEAARGEDGLAQLYVLPPQSTLT-IHVGKRKIKLRPEEL 714

Query: 727 LGWLGKRGGVGSLVPKGFPR 746
               G+RG  G+L+ +G  R
Sbjct: 715 QKVTGERGRRGTLM-RGLQR 733


>gi|300937506|ref|ZP_07152328.1| DNA topoisomerase IV, A subunit [Escherichia coli MS 21-1]
 gi|300457445|gb|EFK20938.1| DNA topoisomerase IV, A subunit [Escherichia coli MS 21-1]
          Length = 752

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 273/740 (36%), Positives = 446/740 (60%), Gaps = 29/740 (3%)

Query: 23  RFALEE----RYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARI 78
           R AL E     YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A FKKSAR 
Sbjct: 7   RLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAKFKKSART 66

Query: 79  VGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMT 137
           VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE+R++
Sbjct: 67  VGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLS 126

Query: 138 QVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQ 197
           + +EL+L  + +   D+   ++    EP + P++ PN+L NGT+GIAVGMAT IP HN++
Sbjct: 127 KYSELLLSELGQGTADWVPNFDGTLQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLR 186

Query: 198 EICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWC 257
           E+ +AA+ALID P+ ++++LL+ + GPD+PT   I+ SR  I + Y  GRG  R+RA W 
Sbjct: 187 EVAQAAIALIDQPKTTLDQLLDIVQGPDYPTEAEIITSRAEIRKIYENGRGSVRMRAVWK 246

Query: 258 VEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIVLFP 315
            E+       +V++ +P+QV  +R++E+IA  +  K++P+++D+RDES  +   R+V+ P
Sbjct: 247 KED-----GAVVISSLPHQVSGARVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIVP 301

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           ++  +D D +M  +F  +D+E  + +N+N++ +   P V  L  IL EWL  RR+ + RR
Sbjct: 302 RSNRVDMDQVMNHLFATTDLEKSYRINLNMIGLDGRPAVKNLLEILSEWLVFRRDTVRRR 361

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
            ++R++ + +R+ IL+GLL+A+LNIDE+I IIRNED+PKP ++SRF LTE Q +AIL L+
Sbjct: 362 LNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEPKPALMSRFGLTETQAEAILELK 421

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LR L KLEE +I+ E   L  E++++  +L S ++  N +  E++   + +        R
Sbjct: 422 LRHLAKLEEMKIRGEQSELEKERDQLQGILASERKMNNLLKKELQADAQAYGDD-----R 476

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           R+   E   A KA  +  M+  EP+T+V+S  GW+RS K H +D   L++K GDS K A+
Sbjct: 477 RSPLQEREEA-KAMSEHDMLPSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAV 535

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
              +   ++ + + G++Y +    L S RG GE +   + L     +    +     KLL
Sbjct: 536 KGKSNQPVVFVDSTGRSYAIDPITLPSARGQGEPLTGKLTLPPGATVDHMLMESDDQKLL 595

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGDHVAVVGENRKLLIF 673
           + S  G  F+   ++++A  R GK  + +     +   +V++   D +  + +  ++L+F
Sbjct: 596 MASDAGYGFVCTFNDLVARNRAGKALITLPENAHVMPPVVIEDASDMLLAITQAGRMLMF 655

Query: 674 SIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDL 726
            +  +P++S+GKG ++        +  + G++ +        LT I    R       +L
Sbjct: 656 PVSDLPQLSKGKGNKIINIPSAEAARGEDGLAQLYVLPPQSTLT-IHVGKRKIKLRPEEL 714

Query: 727 LGWLGKRGGVGSLVPKGFPR 746
               G+RG  G+L+ +G  R
Sbjct: 715 QKVTGERGRRGTLM-RGLQR 733


>gi|26249591|ref|NP_755631.1| DNA topoisomerase IV subunit A [Escherichia coli CFT073]
 gi|110643262|ref|YP_670992.1| DNA topoisomerase IV subunit A [Escherichia coli 536]
 gi|227887731|ref|ZP_04005536.1| DNA topoisomerase IV subunit A [Escherichia coli 83972]
 gi|293412396|ref|ZP_06655119.1| DNA topoisomerase IV [Escherichia coli B354]
 gi|300973292|ref|ZP_07172131.1| DNA topoisomerase IV, A subunit [Escherichia coli MS 45-1]
 gi|301020007|ref|ZP_07184139.1| DNA topoisomerase IV, A subunit [Escherichia coli MS 196-1]
 gi|301048157|ref|ZP_07195194.1| DNA topoisomerase IV, A subunit [Escherichia coli MS 185-1]
 gi|331648814|ref|ZP_08349902.1| DNA topoisomerase IV, A subunit [Escherichia coli M605]
 gi|26109999|gb|AAN82204.1|AE016766_292 Topoisomerase IV subunit A [Escherichia coli CFT073]
 gi|110344854|gb|ABG71091.1| topoisomerase IV subunit A [Escherichia coli 536]
 gi|227835127|gb|EEJ45593.1| DNA topoisomerase IV subunit A [Escherichia coli 83972]
 gi|284923042|emb|CBG36135.1| topoisomerase IV subunit A [Escherichia coli 042]
 gi|291469167|gb|EFF11658.1| DNA topoisomerase IV [Escherichia coli B354]
 gi|299881964|gb|EFI90175.1| DNA topoisomerase IV, A subunit [Escherichia coli MS 196-1]
 gi|300299993|gb|EFJ56378.1| DNA topoisomerase IV, A subunit [Escherichia coli MS 185-1]
 gi|300410872|gb|EFJ94410.1| DNA topoisomerase IV, A subunit [Escherichia coli MS 45-1]
 gi|307555117|gb|ADN47892.1| topoisomerase IV subunit A [Escherichia coli ABU 83972]
 gi|315295061|gb|EFU54398.1| DNA topoisomerase IV, A subunit [Escherichia coli MS 153-1]
 gi|330909081|gb|EGH37595.1| topoisomerase 4 subunit A [Escherichia coli AA86]
 gi|331042561|gb|EGI14703.1| DNA topoisomerase IV, A subunit [Escherichia coli M605]
          Length = 752

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 273/740 (36%), Positives = 446/740 (60%), Gaps = 29/740 (3%)

Query: 23  RFALEE----RYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARI 78
           R AL E     YL Y++  I +RA+P + DG KPV RRI++AMSE+GL+  A FKKSAR 
Sbjct: 7   RLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAKFKKSART 66

Query: 79  VGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMT 137
           VG+V+GK HPHGD + Y+++V +AQPF  RYPL+ GQGN+G  D   S AA RYTE+R++
Sbjct: 67  VGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLS 126

Query: 138 QVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQ 197
           + +EL+L  + +   D+   ++    EP + P++ PN+L NGT+GIAVGMAT IP HN++
Sbjct: 127 KYSELLLSELGQGTADWVPNFDGTLQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLR 186

Query: 198 EICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWC 257
           E+ +AA+ALID P+ ++++LL+ + GPD+PT   I+ SR  I + Y  GRG  R+RA W 
Sbjct: 187 EVAQAAIALIDQPKTTLDQLLDIVQGPDYPTEAEIITSRAEIRKIYENGRGSVRMRAVWK 246

Query: 258 VEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIVLFP 315
            E+       +V++ +P+QV  +R++E+IA  +  K++P+++D+RDES  +   R+V+ P
Sbjct: 247 KED-----GAVVISALPHQVSGARVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIVP 301

Query: 316 KNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRR 375
           ++  +D D +M  +F  +D+E  + +N+N++ +   P V  L  IL EWL  RR+ + RR
Sbjct: 302 RSNRVDMDQVMNHLFATTDLEKSYRINLNMIGLDGRPAVKNLLEILSEWLVFRRDTVRRR 361

Query: 376 SSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR 435
            ++R++ + +R+ IL+GLL+A+LNIDE+I IIRNED+PKP ++SRF LTE Q +AIL L+
Sbjct: 362 LNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEPKPALMSRFGLTETQAEAILELK 421

Query: 436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRR 495
           LR L KLEE +I+ E   L  E++++  +L S ++  N +  E++   + +        R
Sbjct: 422 LRHLAKLEEMKIRGEQSELEKERDQLQGILASERKMNNLLKKELQADAQAYGDE-----R 476

Query: 496 RTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIAL 555
           R+   E   A KA  +  M+  EP+T+V+S  GW+RS K H +D   L++K GDS K A+
Sbjct: 477 RSPLQEREEA-KAMSEHDMLPSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAV 535

Query: 556 HAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLL 615
              +   ++ + + G++Y +    L S RG GE +   + L     +    +     KLL
Sbjct: 536 KGKSNQPVVFVDSTGRSYAIDPITLPSARGQGEPLTGKLTLPPGATVDHMLMESDDQKLL 595

Query: 616 VVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM--KLVVKVTGDHVAVVGENRKLLIF 673
           + S  G  F+   ++++A  R GK  + +     +   +V++   D +  + +  ++L+F
Sbjct: 596 MASDAGYGFVCTFNDLVARNRAGKALITLPENAHVMPPVVIEDASDMLLAITQAGRMLMF 655

Query: 674 SIDQIPEMSRGKGVRL-------QSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDL 726
            +  +P++S+GKG ++        +  + G++ +        LT I    R       +L
Sbjct: 656 PVSDLPQLSKGKGNKIINIPSAEAARGEDGLAQLYVLPPQSTLT-IHVGKRKIKLRPEEL 714

Query: 727 LGWLGKRGGVGSLVPKGFPR 746
               G+RG  G+L+ +G  R
Sbjct: 715 QKVTGERGRRGTLM-RGLQR 733


>gi|15803563|ref|NP_289596.1| DNA topoisomerase IV subunit A [Escherichia coli O157:H7 EDL933]
 gi|15833157|ref|NP_311930.1| DNA topoisomerase IV subunit A [Escherichia coli O157:H7 str.
           Sakai]
 gi|16130915|ref|NP_417491.1| DNA topoisomerase IV, subunit A [Escherichia coli str. K-12 substr.
           MG1655]
 gi|24114324|ref|NP_708834.1| DNA topoisomerase IV subunit A [Shigella flexneri 2a str. 301]
 gi|30064372|ref|NP_838543.1| DNA topoisomerase IV subunit A [Shigella flexneri 2a str. 2457T]
 gi|89109789|ref|AP_003569.1| DNA topoisomerase IV, subunit A [Escherichia coli str. K-12 substr.
           W3110]
 gi|110806916|ref|YP_690436.1| DNA topoisomerase IV subunit A [Shigella flexneri 5 str. 8401]
 gi|157158561|ref|YP_001464484.1| DNA topoisomerase IV subunit A [Escherichia coli E24377A]
 gi|157162495|ref|YP_001459813.1| DNA topoisomerase IV subunit A [Escherichia coli HS]
 gi|168747473|ref|ZP_02772495.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC4113]
 gi|168753987|ref|ZP_02778994.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC4401]
 gi|168760178|ref|ZP_02785185.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC4501]
 gi|168767040|ref|ZP_02792047.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC4486]
 gi|168773326|ref|ZP_02798333.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC4196]
 gi|168781893|ref|ZP_02806900.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC4076]
 gi|168785891|ref|ZP_02810898.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC869]
 gi|168797609|ref|ZP_02822616.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC508]
 gi|170018727|ref|YP_001723681.1| DNA topoisomerase IV subunit A [Escherichia coli ATCC 8739]
 gi|170082562|ref|YP_001731882.1| DNA topoisomerase IV, subunit A [Escherichia coli str. K-12 substr.
           DH10B]
 gi|188494635|ref|ZP_03001905.1| DNA topoisomerase IV, A subunit [Escherichia coli 53638]
 gi|193062029|ref|ZP_03043125.1| DNA topoisomerase IV, A subunit [Escherichia coli E22]
 gi|193067270|ref|ZP_03048238.1| DNA topoisomerase IV, A subunit [Escherichia coli E110019]
 gi|194426504|ref|ZP_03059059.1| DNA topoisomerase IV, A subunit [Escherichia coli B171]
 gi|194431598|ref|ZP_03063889.1| DNA topoisomerase IV, A subunit [Shigella dysenteriae 1012]
 gi|194436767|ref|ZP_03068867.1| DNA topoisomerase IV, A subunit [Escherichia coli 101-1]
 gi|195937163|ref|ZP_03082545.1| DNA topoisomerase IV subunit A [Escherichia coli O157:H7 str.
           EC4024]
 gi|208806097|ref|ZP_03248434.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC4206]
 gi|208812217|ref|ZP_03253546.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC4045]
 gi|208818498|ref|ZP_03258818.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC4042]
 gi|209398989|ref|YP_002272495.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC4115]
 gi|209920494|ref|YP_002294578.1| DNA topoisomerase IV subunit A [Escherichia coli SE11]
 gi|217326967|ref|ZP_03443050.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           TW14588]
 gi|218555592|ref|YP_002388505.1| DNA topoisomerase IV subunit A [Escherichia coli IAI1]
 gi|218696728|ref|YP_002404395.1| DNA topoisomerase IV subunit A [Escherichia coli 55989]
 gi|218701791|ref|YP_002409420.1| DNA topoisomerase IV subunit A [Escherichia coli IAI39]
 gi|218706646|ref|YP_002414165.1| DNA topoisomerase IV subunit A [Escherichia coli UMN026]
 gi|238902132|ref|YP_002927928.1| DNA topoisomerase IV, subunit A [Escherichia coli BW2952]
 gi|254794973|ref|YP_003079810.1| DNA topoisomerase IV subunit A [Escherichia coli O157:H7 str.
           TW14359]
 gi|256019060|ref|ZP_05432925.1| DNA topoisomerase IV subunit A [Shigella sp. D9]
 gi|256024399|ref|ZP_05438264.1| DNA topoisomerase IV subunit A [Escherichia sp. 4_1_40B]
 gi|260845776|ref|YP_003223554.1| DNA topoisomerase IV subunit A [Escherichia coli O103:H2 str.
           12009]
 gi|260869776|ref|YP_003236178.1| DNA topoisomerase IV subunit A [Escherichia coli O111:H- str.
           11128]
 gi|261228033|ref|ZP_05942314.1| DNA topoisomerase IV, subunit A [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261254889|ref|ZP_05947422.1| DNA topoisomerase IV subunit A [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291284399|ref|YP_003501217.1| DNA topoisomerase 4 subunit A [Escherichia coli O55:H7 str. CB9615]
 gi|293406635|ref|ZP_06650561.1| DNA topoisomerase IV subunit A [Escherichia coli FVEC1412]
 gi|293416461|ref|ZP_06659100.1| DNA topoisomerase IV [Escherichia coli B185]
 gi|293449364|ref|ZP_06663785.1| DNA topoisomerase IV [Escherichia coli B088]
 gi|298382374|ref|ZP_06991971.1| DNA topoisomerase 4 subunit A [Escherichia coli FVEC1302]
 gi|300821604|ref|ZP_07101750.1| DNA topoisomerase IV, A subunit [Escherichia coli MS 119-7]
 gi|300901399|ref|ZP_07119485.1| DNA topoisomerase IV, A subunit [Escherichia coli MS 198-1]
 gi|300916873|ref|ZP_07133576.1| DNA topoisomerase IV, A subunit [Escherichia coli MS 115-1]
 gi|300923678|ref|ZP_07139705.1| DNA topoisomerase IV, A subunit [Escherichia coli MS 182-1]
 gi|300931905|ref|ZP_07147202.1| DNA topoisomerase IV, A subunit [Escherichia coli MS 187-1]
 gi|301325632|ref|ZP_07219096.1| DNA topoisomerase IV, A subunit [Escherichia coli MS 78-1]
 gi|307139708|ref|ZP_07499064.1| DNA topoisomerase IV subunit A [Escherichia coli H736]
 gi|307310350|ref|ZP_07589998.1| DNA topoisomerase IV, A subunit [Escherichia coli W]
 gi|312972719|ref|ZP_07786892.1| DNA topoisomerase IV, A subunit [Escherichia coli 1827-70]
 gi|331643719|ref|ZP_08344850.1| DNA topoisomerase IV, A subunit [Escherichia coli H736]
 gi|331654626|ref|ZP_08355626.1| DNA topoisomerase IV, A subunit [Escherichia coli M718]
 gi|331669960|ref|ZP_08370805.1| DNA topoisomerase IV, A subunit [Escherichia coli TA271]
 gi|331679092|ref|ZP_08379764.1| DNA topoisomerase IV, A subunit [Escherichia coli H591]
 gi|332280161|ref|ZP_08392574.1| topoisomerase IV subunit [Shigella sp. D9]
 gi|84028840|sp|P0AFI3|PARC_ECO57 RecName: Full=DNA topoisomerase 4 subunit A; AltName:
           Full=Topoisomerase IV subunit A
 gi|84028841|sp|P0AFI2|PARC_ECOLI RecName: Full=DNA topoisomerase 4 subunit A; AltName:
           Full=Topoisomerase IV subunit A
 gi|84028842|sp|P0AFI4|PARC_SHIFL RecName: Full=DNA topoisomerase 4 subunit A; AltName:
           Full=Topoisomerase IV subunit A
 gi|12517588|gb|AAG58155.1|AE005531_8 DNA topoisomerase IV subunit A [Escherichia coli O157:H7 str.
           EDL933]
 gi|882549|gb|AAA69187.1| topoisomerase IV subunit [Escherichia coli str. K-12 substr.
           MG1655]
 gi|1789396|gb|AAC76055.1| DNA topoisomerase IV, subunit A [Escherichia coli str. K-12 substr.
           MG1655]
 gi|13363375|dbj|BAB37326.1| DNA topoisomerase IV subunit A [Escherichia coli O157:H7 str.
           Sakai]
 gi|24053483|gb|AAN44541.1| DNA topoisomerase IV subunit A [Shigella flexneri 2a str. 301]
 gi|30042629|gb|AAP18353.1| DNA topoisomerase IV subunit A [Shigella flexneri 2a str. 2457T]
 gi|85675822|dbj|BAE77075.1| DNA topoisomerase IV, subunit A [Escherichia coli str. K12 substr.
           W3110]
 gi|110616464|gb|ABF05131.1| DNA topoisomerase IV subunit A [Shigella flexneri 5 str. 8401]
 gi|157068175|gb|ABV07430.1| DNA topoisomerase IV, A subunit [Escherichia coli HS]
 gi|157080591|gb|ABV20299.1| DNA topoisomerase IV, A subunit [Escherichia coli E24377A]
 gi|169753655|gb|ACA76354.1| DNA topoisomerase IV, A subunit [Escherichia coli ATCC 8739]
 gi|169890397|gb|ACB04104.1| DNA topoisomerase IV, subunit A [Escherichia coli str. K-12 substr.
           DH10B]
 gi|187770984|gb|EDU34828.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC4196]
 gi|188017906|gb|EDU56028.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC4113]
 gi|188489834|gb|EDU64937.1| DNA topoisomerase IV, A subunit [Escherichia coli 53638]
 gi|189000605|gb|EDU69591.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC4076]
 gi|189358753|gb|EDU77172.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC4401]
 gi|189363711|gb|EDU82130.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC4486]
 gi|189369288|gb|EDU87704.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC4501]
 gi|189373963|gb|EDU92379.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC869]
 gi|189379712|gb|EDU98128.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC508]
 gi|192932249|gb|EDV84847.1| DNA topoisomerase IV, A subunit [Escherichia coli E22]
 gi|192959227|gb|EDV89662.1| DNA topoisomerase IV, A subunit [Escherichia coli E110019]
 gi|194415812|gb|EDX32079.1| DNA topoisomerase IV, A subunit [Escherichia coli B171]
 gi|194419954|gb|EDX36032.1| DNA topoisomerase IV, A subunit [Shigella dysenteriae 1012]
 gi|194424249|gb|EDX40236.1| DNA topoisomerase IV, A subunit [Escherichia coli 101-1]
 gi|208725898|gb|EDZ75499.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC4206]
 gi|208733494|gb|EDZ82181.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC4045]
 gi|208738621|gb|EDZ86303.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC4042]
 gi|209160389|gb|ACI37822.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           EC4115]
 gi|209759598|gb|ACI78111.1| DNA topoisomerase IV subunit A [Escherichia coli]
 gi|209759600|gb|ACI78112.1| DNA topoisomerase IV subunit A [Escherichia coli]
 gi|209759602|gb|ACI78113.1| DNA topoisomerase IV subunit A [Escherichia coli]
 gi|209759604|gb|ACI78114.1| DNA topoisomerase IV subunit A [Escherichia coli]
 gi|209759606|gb|ACI78115.1| DNA topoisomerase IV subunit A [Escherichia coli]
 gi|209913753|dbj|BAG78827.1| DNA topoisomerase IV subunit A [Escherichia coli SE11]
 gi|217319334|gb|EEC27759.1| DNA topoisomerase IV, A subunit [Escherichia coli O157:H7 str.
           TW14588]
 gi|218353460|emb|CAU99553.1| DNA topoisomerase IV, subunit A [Escherichia coli 55989]
 gi|218362360|emb|CAQ99983.1| DNA topoisomerase IV, subunit A [Escherichia coli IAI1]
 gi|218371777|emb|CAR19630.1| DNA topoisomerase IV, subunit A [Escherichia coli IAI39]
 gi|218433743|emb|CAR14660.1| DNA topoisomerase IV, subunit A [Escherichia coli UMN026]
 gi|238860846|gb|ACR62844.1| DNA topoisomerase IV, subunit A [Escherichia coli BW2952]
 gi|254594373|gb|ACT73734.1| DNA topoisomerase IV, subunit A [Escherichia coli O157:H7 str.
           TW14359]
 gi|257760923|dbj|BAI32420.1| DNA topoisomerase IV subunit A [Escherichia coli O103:H2 str.
           12009]
 gi|257766132|dbj|BAI37627.1| DNA topoisomerase IV subunit A [Escherichia coli O111:H- str.
           11128]
 gi|260447945|gb|ACX38367.1| DNA topoisomerase IV, A subunit [Escherichia coli DH1]
 gi|290764272|gb|ADD58233.1| DNA topoisomerase 4 subunit A [Escherichia coli O55:H7 str. CB9615]
 gi|291322454|gb|EFE61883.1| DNA topoisomerase IV [Escherichia coli B088]
 gi|291426641|gb|EFE99673.1| DNA topoisomerase IV subunit A [Escherichia coli FVEC1412]
 gi|291431817|gb|EFF04800.1| DNA topoisomerase IV [Escherichia coli B185]
 gi|298277514|gb|EFI19030.1| DNA topoisomerase 4 subunit A [Escherichia coli FVEC1302]
 gi|300355171|gb|EFJ71041.1| DNA topoisomerase IV, A subunit [Escherichia coli MS 198-1]
 gi|300415843|gb|EFJ99153.1| DNA topoisomerase IV, A subunit [Escherichia coli MS 115-1]
 gi|300420045|gb|EFK03356.1| DNA topoisomerase IV, A subunit [Escherichia coli MS 182-1]
 gi|300460328|gb|EFK23821.1| DNA topoisomerase IV, A subunit [Escherichia coli MS 187-1]
 gi|300525742|gb|EFK46811.1| DNA topoisomerase IV, A subunit [Escherichia coli MS 119-7]
 gi|300847550|gb|EFK75310.1| DNA topoisomerase IV, A subunit [Escherichia coli MS 78-1]
 gi|306909245|gb|EFN39740.1| DNA topoisomerase IV, A subunit [Escherichia coli W]
 gi|309703450|emb|CBJ02790.1| topoisomerase IV subunit A [Escherichia coli ETEC H10407]
 gi|310332661|gb|EFP99874.1| DNA topoisomerase IV, A subunit [Escherichia coli 1827-70]
 gi|313648136|gb|EFS12582.1| DNA topoisomerase IV, A subunit [Shigella flexneri 2a str. 2457T]
 gi|315062333|gb|ADT76660.1| DNA topoisomerase IV, subunit A [Escherichia coli W]
 gi|315137612|dbj|BAJ44771.1| DNA topoisomerase 4 subunit A [Escherichia coli DH1]
 gi|315615025|gb|EFU95663.1| DNA topoisomerase IV, A subunit [Escherichia coli 3431]
 gi|320180953|gb|EFW55874.1| Topoisomerase IV subunit A [Shigella boydii ATCC 9905]
 gi|320189372|gb|EFW64031.1| Topoisomerase IV subunit A [Escherichia coli O157:H7 str. EC1212]
 gi|320201934|gb|EFW76509.1| Topoisomerase IV subunit A [Escherichia coli EC4100B]
 gi|320640095|gb|EFX09667.1| DNA topoisomerase IV subunit A [Escherichia coli O157:H7 str.
           G51