PSIBLAST alignment of GI: 254780353 and protein with PDB id: 1ab4

>gi|157829780|pdb|1AB4|A Chain A, 59kda Fragment Of Gyrase A From E. Coli Length = 493
 Score =  444 bits (1143), Expect = e-122,   Method: Composition-based stats.
 Identities = 209/499 (41%), Positives = 296/499 (59%), Gaps = 45/499 (9%)

Query: 39  KERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSL 98
             RA+PD+RDG KPVHRR+++AM+ +G D+  A+KKSAR+VG+VIGK HPHGD +VYD++
Sbjct: 1   VGRALPDVRDGLKPVHRRVLYAMNVLGNDWNKAYKKSARVVGDVIGKYHPHGDSAVYDTI 60

Query: 99  VRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTY 158
           VR+AQPF  RY L+ GQGNFG+IDGDSAAA RYTE R+ ++A  ++  ++++ VDF D Y
Sbjct: 61  VRMAQPFSLRYMLVDGQGNFGSIDGDSAAAMRYTEIRLAKIAHELMADLEKETVDFVDNY 120

Query: 159 NEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLL 218
           +  +  P V P+K PNLL NG+SGIAVGMAT+IP HN+ E+    LA ID+ +ISIE L+
Sbjct: 121 DGTEKIPDVMPTKIPNLLVNGSSGIAVGMATNIPPHNLTEVINGCLAYIDDEDISIEGLM 180

Query: 219 EYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVE-EVGRGSWCIVVTEIPYQV 277
           E+I GPDFPT   I+  R  I E+YR GRG   +RAR  VE +   G   I+V EIPYQV
Sbjct: 181 EHIPGPDFPTAA-IINGRRGIEEAYRTGRGKVYIRARAEVEVDAKTGRETIIVHEIPYQV 239

Query: 278 QKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMET 337
            K+RLIEKIAEL+  KR+  +  +RDES +D   ++    R    ++++ +++  + ++ 
Sbjct: 240 NKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIEVKRDAVGEVVLNNLYSQTQLQV 299

Query: 338 RFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAY 397
            F +NM  L     P++M L  I+  ++ HRREV+ RR+ F ++    R  IL+ L +A 
Sbjct: 300 SFGINMVAL-HHGQPKIMNLKDIIAAFVRHRREVVTRRTIFELRKARDRAHILEALAVAL 358

Query: 398 LNIDEIIAIIRNEDKPKP-------------------------------------VMVSR 420
            NID II +IR+   P                                       V    
Sbjct: 359 ANIDPIIELIRHAPTPAEAKTALVANPWQLGNVAAMLERAGDDAARPEWLEPEFGVRDGL 418

Query: 421 FSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIR 480
           + LTE Q  AIL+LRL+ L  LE  ++  E   LL +  ++  +L S  +    I  E+ 
Sbjct: 419 YYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLDQIAELLRILGSADRLMEVIREELE 478

Query: 481 EVKEIFSKSTDLGRRRTTF 499
            V+E F       +RRT  
Sbjct: 479 LVREQFGD-----KRRTEI 492