PSIBLAST alignment of GI: 254780353 and protein with PDB id: 1bgw

>gi|157830305|pdb|1BGW|A Chain A, Topoisomerase Residues 410-1202 Length = 793
>gi|157830349|pdb|1BJT|A Chain A, Topoisomerase Ii Residues 409-1201 Length = 793
 Score =  198 bits (504), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 84/405 (20%), Positives = 159/405 (39%), Gaps = 37/405 (9%)

Query: 8   NSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLD 67
              T+++  +K + +   + +  + ++L+    R+IP++ DGFKP  R++++   +  L 
Sbjct: 250 EPGTVLDPTLKEIPISDFINKELILFSLADNI-RSIPNVLDGFKPGQRKVLYGCFKKNLK 308

Query: 68  FGAAFKKSARIVGEVIG--KLHPHGDQSVYDSLVRLAQPF--VQRYPLISGQGNFGNI-- 121
                 K A++   V      H HG+QS+  +++ LAQ F       L+   G FG    
Sbjct: 309 SE---LKVAQLAPYVSECTAYH-HGEQSLAQTIIGLAQNFVGSNNIYLLLPNGAFGTRAT 364

Query: 122 DGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTS 181
            G  AAA RY    + ++   I    D+    +    +E+  EP  +    P +L NG  
Sbjct: 365 GGKDAAAARYIYTELNKLTRKIFHPADDPLYKYI-QEDEKTVEPEWYLPILPMILVNGAE 423

Query: 182 GIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVE 241
           GI  G +T IP  N  EI +    L+++ E  +E++  +  G           + E I  
Sbjct: 424 GIGTGWSTYIPPFNPLEIIKNIRHLMNDEE--LEQMHPWFRG--------WTGTIEEIEP 473

Query: 242 SYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEK--IAELIIAKRIPLLE 299
                   +R+  R        G   + +TE+P +   S + E   +      K  P ++
Sbjct: 474 L------RYRMYGRIE----QIGDNVLEITELPARTWTSTIKEYLLLGLSGNDKIKPWIK 523

Query: 300 DIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLS--MGRVPQVMPL 357
           D+ ++   D    +   +            +    + +   L   V     G++ +   +
Sbjct: 524 DMEEQHD-DNIKFIITLSPEEMAKTRKIGFYERFKLISPISLMNMVAFDPHGKIKKYNSV 582

Query: 358 DGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDE 402
           + IL E+   R E   +R     + +   VE     +     I E
Sbjct: 583 NEILSEFYYVRLEYYQKRKDHMSERLQWEVEKYSFQVKFIKMIIE 627