PSIBLAST alignment of GI: 254780353 and protein with PDB id: 1suu

>gi|48425718|pdb|1SUU|A Chain A, Structure Of Dna Gyrase A C-Terminal Domain Length = 312
 Score =  127 bits (320), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 52/259 (20%), Positives = 106/259 (40%), Gaps = 17/259 (6%)

Query: 511 QQAMIEKEPITVVISNRGWIRSLKSHSV--------DLSALHFKEGDSLKIALHAHTTDR 562
              +++KE I V+++ +G+++ L  +           LS+    +GD + IAL  +T D 
Sbjct: 1   MSDLMQKENIVVMLTKKGFLKRLSQNEYKLQGTGGKGLSSFDLNDGDEIVIALCVNTHDY 60

Query: 563 ILLLSTDGKAYTLPAGNLLSGRGHGEAIQLL--IDLNHNQDIVTAF---VYDSTCKLLVV 617
           + ++S +GK Y + A  +       +   +   I+L   ++I+T            LL+ 
Sbjct: 61  LFMISNEGKLYLINAYEIKDSSRASKGQNISELINLGDQEEILTIKNSKDLTDDAYLLLT 120

Query: 618 SSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH-VAVVGENRKLLIFSID 676
           ++ G     E ++  A   +G   +K++ ++ +     V  D  V  + +     IF+  
Sbjct: 121 TASGKIARFESTDFKAVKSRGVIVIKLNDKDFVTSAEIVFKDEKVICLSKKGSAFIFNSR 180

Query: 677 QIPEMSRG-KGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGG 735
            +   +RG +GV     K+G +  V    + E    +  +   Y +  N       KRG 
Sbjct: 181 DVRLTNRGTQGVCGMKLKEGDL-FVKVLSVKENPYLLIVSENGYGKRLNMSKISELKRGA 239

Query: 736 VGSLVPKGFPRS-GKFLSS 753
            G    K   +  G  + +
Sbjct: 240 TGYTSYKKSDKKAGSVVDA 258