PSIBLAST alignment of GI: 254780353 and protein with PDB id: 1zi0

>gi|67463753|pdb|1ZI0|A Chain A, A Superhelical Spiral In Escherichia Coli Dna Gyrase A C- Terminal Domain Imparts Unidirectional Supercoiling Bias Length = 307
>gi|67463754|pdb|1ZI0|B Chain B, A Superhelical Spiral In Escherichia Coli Dna Gyrase A C- Terminal Domain Imparts Unidirectional Supercoiling Bias Length = 307
 Score = 60.2 bits (144), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 52/138 (37%), Gaps = 11/138 (7%)

Query: 614 LLVVSSKGNAFIVEESEIIANTR--KGKTFLKVSSEE-KMKLVVKVTGDHVAVVGENRKL 670
           ++ +S +G       SE  A  R  KGK+  ++  E+   +L+V  T DH+       ++
Sbjct: 6   VVTLSHQGYVKYQPLSEYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDHILCFSSRGRV 65

Query: 671 LIFSIDQIPEMSRG-KG---VRLQSYKDGGISDVI--CFKICEGLTWIDSAGRSYNRSEN 724
               + Q+PE +RG +G   V L   +       I    +  EG+    +      +   
Sbjct: 66  YSMKVYQLPEATRGARGRPIVNLLPLEQDERITAILPVTEFEEGVKVFMATANGTVKKTV 125

Query: 725 DLLGWLGKRGGVGSLVPK 742
                  +    G +  K
Sbjct: 126 LTEFNRLR--TAGKVAIK 141