RPSBLAST alignment for GI: 254780353 and conserved domain: PLN03128

>gnl|CDD|178674 PLN03128, PLN03128, DNA topoisomerase 2; Provisional. Length = 1135
 Score = 80.1 bits (198), Expect = 2e-15
 Identities = 101/469 (21%), Positives = 190/469 (40%), Gaps = 84/469 (17%)

Query: 40   ERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFK---KSARIVGEVIGK-LHPHGDQSVY 95
             R+IP + DG KP  R+++ A       F    K   K A++ G V     + HG+ S+ 
Sbjct: 672  ARSIPSMVDGLKPSQRKVLFAC------FKRNLKSEIKVAQLSGYVAEHSAYHHGEASLA 725

Query: 96   DSLVRLAQPFV--QRYPLISGQGNFGN--IDGDSAAAYRYTEARMTQVAELILQGVDEDA 151
             +++ +AQ FV      L++  G FG     G  AA+ RY   R++ +   +    D+  
Sbjct: 726  STIIGMAQDFVGSNNINLLTPSGQFGTRLQGGKDAASARYIFTRLSPITRALFPKDDDVL 785

Query: 152  VDFRDTYNEEDS---EPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAALALID 208
            ++    Y  ED    EP  +    P +L NG+ GI  G +T IP++N ++I      L+ 
Sbjct: 786  LN----YLNEDGQSIEPEWYCPIIPMVLVNGSEGIGTGWSTFIPNYNPRDIIANIRRLLR 841

Query: 209  NPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCI 268
              E  +E +  +  G  F  G I   S            G + V     +E++G  +  I
Sbjct: 842  GEE--LEPMHPWYRG--F-KGTITEVSTS--------RSGSYTVTGI--IEQIGDTT--I 884

Query: 269  VVTEIPYQVQKSRLIEKIAELIIAKRI--PLLEDIRDESAE-DVRIVLFPKNRSLDPDLL 325
             +TE+P +       E +  L+   +   P ++D ++   +  V   +     +L  + +
Sbjct: 885  RITELPVRKWTQDYKEFLEALLTGTKKKEPEIKDFKENHTDTTVHFTV-----TLSEEKM 939

Query: 326  MESIFMLSDMETRFPL-------NMNVLSM-GRVPQVMPLDGILKEWLAHR-------RE 370
              +  +   +E +F L       NM++    G++ +    + IL+E+   R       +E
Sbjct: 940  --ARALAEGLEKKFKLSTTISTSNMHLFDKDGKIKKYDSPEDILEEFFHLRLDLYVKRKE 997

Query: 371  VLFRRSSFRMQAIDRRVEILKGLLIAYLNID-----EIIAIIRNEDKPKPVMVSRFSLTE 425
            VL     + ++ +D +   +  ++   + ++     E++A +  +         +F  T 
Sbjct: 998  VLLENLEYELKKLDNKARFILAVVKGEIVVNNRKRAELLAELEEKG------FDKFPKTA 1051

Query: 426  NQVDAILNLRLRSLRKLEEYQIKSEL----DNLLAEK------EKIDSL 464
               +  +          EE    +EL    D LL         EK+D L
Sbjct: 1052 KISETNVVGDRDGEASEEEEASDNELAKSYDYLLGMPISSLTLEKVDEL 1100