RPSBLAST alignment of GI: 254780353 and protein with PDBid: 2xkj

>2xkj_E Topoisomerase IV; type IIA topoisomerase; 2.20A {Acinetobacter baumannii} PDB: 2xkk_A* Length = 767
 Score =  468 bits (1205), Expect = e-132
 Identities = 211/519 (40%), Positives = 325/519 (62%), Gaps = 14/519 (2%)

Query: 3   VDNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMS 62
           V++     +L     +  S+    E+ YL YA+  I +RA+P + DG KPV RRI++AMS
Sbjct: 259 VEDKLTMTSLAHHATENRSVAEFTEQAYLNYAMYVIMDRALPHISDGLKPVQRRIVYAMS 318

Query: 63  EMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNID 122
           E+GL      KKSAR VG+V+GK HPHGD + Y+++V +AQPF  RYPLI GQGN+G+ D
Sbjct: 319 ELGLKSSGKPKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLIEGQGNWGSPD 378

Query: 123 G-DSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTS 181
              S AA RYTEA+++  +EL+L  + +   +++D ++    EP+  P++ PN+L NGT+
Sbjct: 379 DPKSFAAMRYTEAKLSAYSELLLSELGQGTSEWQDNFDGSLKEPITLPARVPNILLNGTT 438

Query: 182 GIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVE 241
           GIAVGMAT IP HN++E+ +  +ALI NP+ S EKL EYI  PD PT   I+   E +++
Sbjct: 439 GIAVGMATDIPPHNLREVVKGTIALIRNPQTSDEKLAEYIPAPDLPTKAEIITPPEELLK 498

Query: 242 SYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDI 301
               GRG +R+RA + +E+       IV+TE+PYQV  S++I +IA+ + AK++PL+ D+
Sbjct: 499 IQTTGRGSYRMRAVYTIEK-----NEIVITELPYQVSGSKVITQIADQMQAKKLPLVVDV 553

Query: 302 RDESAE--DVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDG 359
           RDES      R+V+  ++  +D + +M  +F  +D+E+ + +N+N++     PQV  +  
Sbjct: 554 RDESDHENPTRLVIVLRSNRIDAEAVMSHLFATTDLESSYRVNLNMIGEDGRPQVKSIRR 613

Query: 360 ILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVS 419
           IL EW+  R++ + RR  + +  I++R+ IL GLLIAYL+ID +I IIR ED+PKPV++ 
Sbjct: 614 ILLEWIEIRKKTVTRRLQYHLNRIEKRLHILAGLLIAYLDIDTVIRIIREEDQPKPVLME 673

Query: 420 RFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEI 479
            F++ E Q +AIL L+LR L KLEE +I+ E D L A+   I   L + +   N I  E+
Sbjct: 674 HFNIDEIQAEAILELKLRHLAKLEEMEIRHEQDELSAKAAIIREQLENPESLKNLIISEL 733

Query: 480 REVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKE 518
           +E  + F        RR+     + A +   +Q ++  E
Sbjct: 734 KEDAKKFGDE-----RRSPIVARAEAVQIK-EQDLMPAE 766