RPSBLAST alignment of GI: 254780353 and protein with PDBid: 3l6v

>3l6v_A GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, GYRA C-terminal domain, DNA wrapping, beta-strand-bearing proline, ATP-binding; HET: DNA; 2.19A {Xanthomonas campestris PV} Length = 370
 Score = 84.1 bits (207), Expect = 9e-17
 Identities = 45/227 (19%), Positives = 77/227 (33%), Gaps = 17/227 (7%)

Query: 514 MIEKEPITVVISNRGWI--------RSLKSHSVDLSALHFKEGDSLKIALHAHTTDRILL 565
           +I  E + V +S+ G+         R+ +      SA   KE D +      +T D +L 
Sbjct: 3   LIAPEDVVVTLSHAGYAKRQPVSAYRAQRRGGRGRSAASTKEEDFIDQLWLVNTHDTLLT 62

Query: 566 LSTDGKAYTLPAGNL--LSGRGHGEAIQLLIDLNHNQDIVTAFV---YDSTCKLLVVSSK 620
            ++ GK + LP   L        G  I   I L   + +        Y     + + +  
Sbjct: 63  FTSSGKVFWLPVHQLPEAGSNARGRPIINWIPLESGERVQAVLPVREYADNRYVFMATRN 122

Query: 621 GNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGD-HVAVVGENRKLLIFSIDQIP 679
           G       SE      +GK  + +   + +  V    GD  V +   N K + F    + 
Sbjct: 123 GTVKKTPLSEFAFRLARGKIAINLDEGDALVGVALTDGDRDVLLFASNGKTVRFGESTVR 182

Query: 680 EMSR-GKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSEND 725
            M R   GVR      G   +V+   + E    ++      +  E  
Sbjct: 183 SMGRTATGVRGIRLAKG--EEVVSLIVSERAGGVEDEVEDESAEEVV 227