RPSBLAST alignment of GI: 254780353 and SCOP domain: d1wp5a_

Alignment
>d1wp5a_ b.68.10.1 (A:) Topoisomerase IV subunit A, ParC, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 323
 Score = 71.5 bits (174), Expect = 2e-13
 Identities = 31/180 (17%), Positives = 59/180 (32%), Gaps = 8/180 (4%)

Query: 514 MIEKEPITVVISNRGWIRSLKSHSV---DLSALHFKEGDSLKIALHAHTTDRILLLSTDG 570
           M+  E + V ++  G+++     S    +      K+ D L   L  +T D +LL +  G
Sbjct: 1   MVASEDVIVTVTKDGYVKRTSLRSYAASNGQDFAMKDTDRLLAMLEMNTKDVLLLFTNKG 60

Query: 571 KAYTLPAGNLLSGRGH--GEAIQLLIDLNHNQDIVTAF---VYDSTCKLLVVSSKGNAFI 625
                P   L   R    G+ I  +I ++ +++I+ A     ++     L V+  G    
Sbjct: 61  NYLYCPVHELPDIRWKDLGQHIANIIPIDRDEEIIKAIPINDFELNGYFLFVTRNGMVKK 120

Query: 626 VEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGK 685
            E     A              +   + V +T     +            D+      G 
Sbjct: 121 TELKHYKAQRYSKPLTGINLKNDDQVVDVHLTDGMNELFLVTHNGYALWFDESEVSIVGV 180

SCOP domain information

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: GyrA/ParC C-terminal domain-like
family: GyrA/ParC C-terminal domain-like
domain: Topoisomerase IV subunit A, ParC, C-terminal domain
species: Bacillus stearothermophilus [TaxId: 1422]