BLAST/BLAST alignment of GI: 254780353 and GI: 254780182
>gi|254780182|ref|YP_003064595.1| DNA gyrase subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 910
 Score =  375 bits (963), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 244/697 (35%), Positives = 374/697 (53%), Gaps = 65/697 (9%)

Query: 4   DNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSE 63
           ++I +S+   E+ + +VS+   ++  YL YA++ I  RAIPDLRDG KPVHRRI+  M +
Sbjct: 3   EHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQ 62

Query: 64  MGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG 123
           MG+++   + K ARI GEV+GK HPHG+ ++YD+L R+AQ +  R  LI GQGNFG++DG
Sbjct: 63  MGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDG 122

Query: 124 DSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGI 183
           D  AA RYTE R+ + A  +L  + +D VDFR  Y+    EPVV  +++PN+L NG  GI
Sbjct: 123 DPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGI 182

Query: 184 AVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESY 243
           AVGMAT+IP+HN+ E+ +  +A+IDNP+I ++ L+E I GPDFPTG +I+  R  I  +Y
Sbjct: 183 AVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVIL-GRTGIKNAY 241

Query: 244 RLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRD 303
             GRG   +R    +E+       IVVTEIPYQV K+ ++EKIAEL+  KRI  + D+RD
Sbjct: 242 ATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRD 301

Query: 304 ESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKE 363
           ES      V+    R    D+++  ++  + +++ F +NM  L+ G  P+   L GILK 
Sbjct: 302 ESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALN-GYKPERFTLIGILKA 360

Query: 364 WLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPV---MVSR 420
           ++A R EV+ RR+ + +     R  +L GL IA  N+DE++ IIR    P+     ++ R
Sbjct: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420

Query: 421 --------------------------FSLTENQVDAILNLRLRSLRKLEEYQIKSELDNL 454
                                       L+E Q  AIL LRL  L  L    I++EL++L
Sbjct: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480

Query: 455 LAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCE--VSRADKATLQQ 512
             E ++   +L+S  +    I  E+  VK+          RRT   E  +   D     +
Sbjct: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTP-----RRTRIVEGLLDMED-----E 530

Query: 513 AMIEKEPITVVISNRGWI--------RSLKSHSVDLSALHFKEGDSLKIALHAHTTDRIL 564
             I +E + V +S+ G++        R+ +      S +  ++ D +       T   +L
Sbjct: 531 DCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVL 590

Query: 565 LLSTDG-----KAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY----DSTCKLL 615
             S+ G     K + LP G   S +  G+A+  ++ LN  + I T   +     S   L 
Sbjct: 591 FFSSLGFVYKEKVWRLPIG---SPQARGKALINILSLNQGERITTIMPFPEDESSWNNLY 647

Query: 616 VV--SSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM 650
           VV  +  GN    + S+ I   R GK  +K+ S +++
Sbjct: 648 VVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEI 684