BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780353|ref|YP_003064766.1| DNA topoisomerase IV subunit A
[Candidatus Liberibacter asiaticus str. psy62]
         (753 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780353|ref|YP_003064766.1| DNA topoisomerase IV subunit A [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 753

 Score = 1537 bits (3980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 753/753 (100%), Positives = 753/753 (100%)

Query: 1   MGVDNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHA 60
           MGVDNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHA
Sbjct: 1   MGVDNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHA 60

Query: 61  MSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGN 120
           MSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGN
Sbjct: 61  MSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGN 120

Query: 121 IDGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGT 180
           IDGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGT
Sbjct: 121 IDGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGT 180

Query: 181 SGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIV 240
           SGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIV
Sbjct: 181 SGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIV 240

Query: 241 ESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLED 300
           ESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLED
Sbjct: 241 ESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLED 300

Query: 301 IRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGI 360
           IRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGI
Sbjct: 301 IRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGI 360

Query: 361 LKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSR 420
           LKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSR
Sbjct: 361 LKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSR 420

Query: 421 FSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIR 480
           FSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIR
Sbjct: 421 FSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIR 480

Query: 481 EVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDL 540
           EVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDL
Sbjct: 481 EVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDL 540

Query: 541 SALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQ 600
           SALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQ
Sbjct: 541 SALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQ 600

Query: 601 DIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH 660
           DIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH
Sbjct: 601 DIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH 660

Query: 661 VAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYN 720
           VAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYN
Sbjct: 661 VAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYN 720

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPRSGKFLSS 753
           RSENDLLGWLGKRGGVGSLVPKGFPRSGKFLSS
Sbjct: 721 RSENDLLGWLGKRGGVGSLVPKGFPRSGKFLSS 753


>gi|254780182|ref|YP_003064595.1| DNA gyrase subunit A [Candidatus Liberibacter asiaticus str. psy62]
          Length = 910

 Score =  375 bits (963), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 244/697 (35%), Positives = 374/697 (53%), Gaps = 65/697 (9%)

Query: 4   DNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSE 63
           ++I +S+   E+ + +VS+   ++  YL YA++ I  RAIPDLRDG KPVHRRI+  M +
Sbjct: 3   EHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQ 62

Query: 64  MGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG 123
           MG+++   + K ARI GEV+GK HPHG+ ++YD+L R+AQ +  R  LI GQGNFG++DG
Sbjct: 63  MGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDG 122

Query: 124 DSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGI 183
           D  AA RYTE R+ + A  +L  + +D VDFR  Y+    EPVV  +++PN+L NG  GI
Sbjct: 123 DPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGI 182

Query: 184 AVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESY 243
           AVGMAT+IP+HN+ E+ +  +A+IDNP+I ++ L+E I GPDFPTG +I+  R  I  +Y
Sbjct: 183 AVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVIL-GRTGIKNAY 241

Query: 244 RLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRD 303
             GRG   +R    +E+       IVVTEIPYQV K+ ++EKIAEL+  KRI  + D+RD
Sbjct: 242 ATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRD 301

Query: 304 ESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKE 363
           ES      V+    R    D+++  ++  + +++ F +NM  L+ G  P+   L GILK 
Sbjct: 302 ESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALN-GYKPERFTLIGILKA 360

Query: 364 WLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPV---MVSR 420
           ++A R EV+ RR+ + +     R  +L GL IA  N+DE++ IIR    P+     ++ R
Sbjct: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420

Query: 421 --------------------------FSLTENQVDAILNLRLRSLRKLEEYQIKSELDNL 454
                                       L+E Q  AIL LRL  L  L    I++EL++L
Sbjct: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480

Query: 455 LAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCE--VSRADKATLQQ 512
             E ++   +L+S  +    I  E+  VK+          RRT   E  +   D     +
Sbjct: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTP-----RRTRIVEGLLDMED-----E 530

Query: 513 AMIEKEPITVVISNRGWI--------RSLKSHSVDLSALHFKEGDSLKIALHAHTTDRIL 564
             I +E + V +S+ G++        R+ +      S +  ++ D +       T   +L
Sbjct: 531 DCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVL 590

Query: 565 LLSTDG-----KAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY----DSTCKLL 615
             S+ G     K + LP G   S +  G+A+  ++ LN  + I T   +     S   L 
Sbjct: 591 FFSSLGFVYKEKVWRLPIG---SPQARGKALINILSLNQGERITTIMPFPEDESSWNNLY 647

Query: 616 VV--SSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM 650
           VV  +  GN    + S+ I   R GK  +K+ S +++
Sbjct: 648 VVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEI 684


>gi|254780277|ref|YP_003064690.1| DNA polymerase I [Candidatus Liberibacter asiaticus str. psy62]
          Length = 976

 Score = 26.2 bits (56), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 76/168 (45%), Gaps = 32/168 (19%)

Query: 345 VLSMGRVPQVMPLDGILKEWLAH-RREVLFRR-----------SSFRMQAIDRRVEILKG 392
           VL  GR      +  I ++WL++ R+E+L  R           S  +  AI+    IL+ 
Sbjct: 495 VLDSGRSSH--DIASIAQKWLSYTRKEILKSRKSSIPIDKISDSQVQEHAIENSNVILQL 552

Query: 393 --LLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRL-----RSLRKLEE- 444
             LL   L +++++ +    DKP   +VS+  +T  Q+D  L  ++     ++L  LEE 
Sbjct: 553 WLLLRPKLIVEKLLHVYERLDKPMIDVVSQMEITGIQIDQDLLKQVSAEISKNLLSLEEN 612

Query: 445 -YQIKSELDNLLAEKEKIDSLLN-----SGKQ----QWNQIACEIREV 482
            Y +  E  NL + K+  D L       SG +    QW   A ++ ++
Sbjct: 613 IYDLSGEKFNLSSPKQLGDILFTKLKFPSGAKTKTGQWKTTAQDLEQI 660


>gi|254780185|ref|YP_003064598.1| glutamine synthetase protein [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 458

 Score = 25.4 bits (54), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 11/37 (29%), Positives = 22/37 (59%)

Query: 407 IRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLE 443
           + N DK +  +       ++Q+DA +NL+++ + KLE
Sbjct: 408 LENLDKDREFLKVGNVFDDDQIDAFINLKMKEVLKLE 444


>gi|254780837|ref|YP_003065250.1| putative restriction endonuclease S subunit [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 426

 Score = 25.0 bits (53), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/75 (21%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 427 QVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIF 486
           ++D ++  R+R +  L+E + ++ +  ++ +    D  +     +W  +  +  EVK  F
Sbjct: 180 RIDTLITERIRFIELLKEKK-QALVSYIVTKGLNPDVKMKDSGIEWVGLVPDHWEVKPFF 238

Query: 487 SKSTDLGRRRTTFCE 501
           +  T+L R+ T   E
Sbjct: 239 ALVTELNRKNTKLIE 253


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.319    0.137    0.389 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 473,933
Number of Sequences: 1233
Number of extensions: 20336
Number of successful extensions: 67
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 59
Number of HSP's gapped (non-prelim): 11
length of query: 753
length of database: 328,796
effective HSP length: 81
effective length of query: 672
effective length of database: 228,923
effective search space: 153836256
effective search space used: 153836256
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 42 (20.8 bits)