PSIBLAST alignment of GI: 254780355 and protein with PDB id: 1csc

gi|157830700|pdb|1CSC|A Chain A, Structure Of Ternary Complexes Of Citrate Synthase With D- And L-Malate: Mechanistic Implications Length = 433
>gi|157834769|pdb|2CSC|A Chain A, Structure Of Ternary Complexes Of Citrate Synthase With D- And L-Malate: Mechanistic Implications Length = 433
 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 101/388 (26%), Positives = 168/388 (43%), Gaps = 45/388 (11%)

Query: 57  TFIDGNNGILLYRGYPIEQ----LSEKSDFLE-----VCYLLLHGELANVSQQKDFNDKI 107
           + +D + GI  +RG+ I +    L +     E     + +LL+ G++   +Q    + + 
Sbjct: 56  SVLDPDEGI-RFRGFSIPECQKLLPKGGXGGEPLPEGLFWLLVTGQIPTGAQVSWLSKEW 114

Query: 108 SRHALLNENMSRFFMGFPSSAHPMAMLVSAVGALS-------SFYYSPSGVQDLEQCVNV 160
           ++ A L  ++      FP++ HPM+ L +A+ AL+       ++       +  E     
Sbjct: 115 AKRAALPSHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGILRTKYWEMVYES 174

Query: 161 SLRMIAKISTIAAMIYK--YSIGQPFVYPRSDLDYASNFLHMCFSVPCAEYQVNPLLARA 218
           ++ +IAK+  +AA IY+  Y  G       S LD++ NF +M                  
Sbjct: 175 AMDLIAKLPCVAAKIYRNLYRAGSSIGAIDSKLDWSHNFTNMLGYTDAQ-------FTEL 227

Query: 219 MNRIFILHADH-EQNASTSTVRLAGSSGADPFACIAAGVACLGGRAHGGANEEALNMLME 277
           M     +H+DH   N S  T  L GS+ +DP+   AA +  L G  HG AN+E L  L +
Sbjct: 228 MRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLGWLAQ 287

Query: 278 -------IGSLERIPHYIMRAKDKNDPFRIMGFGHRVYRNHDPRCRIMRETMYEVLEVTG 330
                   G+   +  YI    +      + G+GH V R  DPR    RE   + L    
Sbjct: 288 LQKAXXXAGADASLRDYIWNTLN--SGRVVPGYGHAVLRKTDPRYTCQREFALKHL---- 341

Query: 331 RFNDPIAQVAIELERIALED--EYFIERKLYPNVDFYSGITLRALGF-PTNLFTVLFAVA 387
              DP+ ++  +L +I      E       +PNVD +SG+ L+  G    N +TVLF V+
Sbjct: 342 -PGDPMFKLVAQLYKIVPNVLLEQGAAANPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVS 400

Query: 388 RTAGWVSQWTEMIVDPSRRIGRPRQLYT 415
           R  G ++Q           + RP+ + T
Sbjct: 401 RALGVLAQLIWSRA-LGFPLERPKSMST 427