RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780356|ref|YP_003064769.1| hypothetical protein CLIBASIA_01205 [Candidatus Liberibacter asiaticus str. psy62] (120 letters) >gnl|CDD|163411 TIGR03699, mena_SCO4550, menaquinone biosynthesis protein, SCO4550 family. members of this protein family are involved in menaquinone biosynthesis by an alternate pathway via futalosine. Length = 340 Score = 29.9 bits (68), Expect = 0.15 Identities = 9/23 (39%), Positives = 16/23 (69%) Query: 13 IIQHVKYLIQLEQEYGGFFLFIP 35 I+H++ + +L+ + GGF FIP Sbjct: 212 RIEHLERIRELQDKTGGFTAFIP 234 >gnl|CDD|163509 TIGR03797, NHPM_micro_ABC2, NHPM bacteriocin system ABC transporter, ATP-binding protein. Members of this protein family are ABC transporter ATP-binding subunits, part of a three-gene putative bacteriocin transport operon. The other subunits include another ATP-binding subunit (TIGR03796), which has an N-terminal propeptide cleavage domain, and an HlyD homolog (TIGR03794). In a number of genomes, a conserved propeptide sequence with a classic Gly-Gly motif. Length = 686 Score = 27.2 bits (61), Expect = 0.93 Identities = 8/35 (22%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Query: 46 FVYSPEIPIWGIVLSILIIAIIS----LRIRYSHP 76 F YS ++ + + L+++ IA+ L++R Sbjct: 271 FYYSWKLALVAVALALVAIAVTLVLGLLQVRKERR 305 >gnl|CDD|163412 TIGR03700, mena_SCO4494, putative menaquinone biosynthesis protein, SCO4494 family. Members of this protein family appear to be involved in menaquinone biosynthesis by an alternate pathway via futalosine, based on close phylogenetic correlation with known markers of the futalosine pathway, gene clustering in many organisms, and paralogy with the SCO4550 protein. Length = 351 Score = 27.0 bits (60), Expect = 1.1 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 2/27 (7%) Query: 14 IQHVKYLIQLEQEYGGFFLFIPVFLAF 40 + H+ L +L+ E GGF FIP LAF Sbjct: 220 VDHMLRLRELQDETGGFQAFIP--LAF 244 >gnl|CDD|150474 pfam09810, Morph_protein1, Defects in morphology protein 1, mitochondrial precursor. Members of this family of proteins are thought to be involved in cellular morphology, though little else is known about them. Length = 329 Score = 26.6 bits (59), Expect = 1.8 Identities = 13/68 (19%), Positives = 27/68 (39%), Gaps = 3/68 (4%) Query: 51 EIPIWGIVLSILIIAII-SLRIRYSHPHI--LLIVKTLTYFLTRMILAAIEITRNPTTIL 107 E+P+WG+V L+ II L P + + ++ +I++ + R+ + Sbjct: 96 ELPVWGVVKGELLNGIIDELSYENPDPSLEETAASNYSSNAISELIISDTKTRRSKSLPS 155 Query: 108 SQSITTNL 115 L Sbjct: 156 EAQKRPTL 163 >gnl|CDD|148714 pfam07267, Nucleo_P87, Nucleopolyhedrovirus capsid protein P87. This family consists of several Nucleopolyhedrovirus capsid protein P87 sequences. P87 is expressed late in infection and concentrated in infected cell nuclei. Length = 606 Score = 26.4 bits (58), Expect = 1.9 Identities = 14/35 (40%), Positives = 16/35 (45%) Query: 79 LLIVKTLTYFLTRMILAAIEITRNPTTILSQSITT 113 LLI K LTR I A I P L+Q + T Sbjct: 7 LLIAKLAGQILTRDIAAVDVIMHTPERSLNQKLDT 41 >gnl|CDD|182960 PRK11098, PRK11098, microcin B17 transporter; Reviewed. Length = 409 Score = 26.1 bits (58), Expect = 2.6 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Query: 30 FFLFIPVFLAFGAIFWFVYSPE-IPIWGIVLSILIIAII 67 F+ + V + A FWF+YSP W I+ S LII + Sbjct: 63 FYAYYLVCVGLFAGFWFIYSPHPWQRWSILGSALIIFVT 101 >gnl|CDD|181427 PRK08445, PRK08445, hypothetical protein; Provisional. Length = 348 Score = 25.8 bits (57), Expect = 2.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Query: 13 IIQHVKYLIQLEQEYGGFFLFI 34 II+H + + L+ E GGF FI Sbjct: 213 IIEHWERIRDLQDETGGFRAFI 234 >gnl|CDD|181426 PRK08444, PRK08444, hypothetical protein; Provisional. Length = 353 Score = 25.4 bits (56), Expect = 3.6 Identities = 10/22 (45%), Positives = 13/22 (59%) Query: 14 IQHVKYLIQLEQEYGGFFLFIP 35 I H+ L L+ + GGF FIP Sbjct: 221 IDHMLRLRDLQDKTGGFNAFIP 242 >gnl|CDD|180943 PRK07360, PRK07360, FO synthase subunit 2; Reviewed. Length = 371 Score = 25.2 bits (56), Expect = 4.0 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Query: 13 IIQHVKYLIQLEQEYGGFFLFIPVFLAF 40 I H+ L +++QE GG F+P L F Sbjct: 232 RIDHLLILREIQQETGGITEFVP--LPF 257 >gnl|CDD|178158 PLN02543, PLN02543, pfkB-type carbohydrate kinase family protein. Length = 496 Score = 25.3 bits (55), Expect = 4.0 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Query: 48 YSPE--IPIWGIVLSILIIAIISLRIRYSHP 76 Y+PE P+W L +L++ +LRI Y P Sbjct: 374 YTPEEIAPLWHDGLKLLLVTDGTLRIHYYTP 404 >gnl|CDD|183106 PRK11375, PRK11375, allantoin permease; Provisional. Length = 484 Score = 24.7 bits (54), Expect = 5.8 Identities = 9/34 (26%), Positives = 15/34 (44%) Query: 34 IPVFLAFGAIFWFVYSPEIPIWGIVLSILIIAII 67 +P ++ G F S + I+LS IA + Sbjct: 43 VPNYVMVGGFFILGLSTFSIMLAIILSAFFIAAV 76 >gnl|CDD|177611 PHA03374, PHA03374, hypothetical protein; Provisional. Length = 730 Score = 24.6 bits (54), Expect = 7.2 Identities = 7/37 (18%), Positives = 13/37 (35%) Query: 42 AIFWFVYSPEIPIWGIVLSILIIAIISLRIRYSHPHI 78 A FW Y P + + + + + +S P Sbjct: 302 ASFWLQYPPSGAMLRVAMCMAVAPHVSHECTELSPGW 338 >gnl|CDD|182566 PRK10580, proY, putative proline-specific permease; Provisional. Length = 457 Score = 24.4 bits (53), Expect = 7.2 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Query: 39 AFGAIFWFVYSPEIPIWGIVLSI-LIIAIISL 69 AFG I+ V+ P +P W VLS+ LII ++L Sbjct: 109 AFG-IYMGVWFPTVPHWIWVLSVVLIICAVNL 139 >gnl|CDD|178837 PRK00068, PRK00068, hypothetical protein; Validated. Length = 970 Score = 24.2 bits (53), Expect = 7.9 Identities = 8/14 (57%), Positives = 9/14 (64%) Query: 32 LFIPVFLAFGAIFW 45 LFIPV L G I + Sbjct: 63 LFIPVGLLVGGIVF 76 >gnl|CDD|152512 pfam12077, DUF3556, Transmembrane protein of unknown function (DUF3556). This family of transmembrane proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 576 to 592 amino acids in length. Length = 574 Score = 24.2 bits (53), Expect = 8.1 Identities = 9/34 (26%), Positives = 17/34 (50%) Query: 36 VFLAFGAIFWFVYSPEIPIWGIVLSILIIAIISL 69 VF FG +F FV + + + L+ +I++ Sbjct: 341 VFFIFGVLFLFVGHAGVGLADLSSPWLLAVLIAV 374 >gnl|CDD|162084 TIGR00879, SP, MFS transporter, sugar porter (SP) family. This model represent the sugar porter subfamily of the major facilitator superfamily (pfam00083). Length = 481 Score = 24.2 bits (53), Expect = 8.2 Identities = 15/46 (32%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Query: 7 SNPLCNIIQHVKYLIQLEQ-EYGGFFLFIPVFLAFGAIFWFVYSPE 51 +N L N I + LE GG F+F G IF + + PE Sbjct: 427 ANWLANFIVGFLFPTMLESIGVGGVFIFFGGLNVLGLIFVYFFLPE 472 >gnl|CDD|149061 pfam07787, DUF1625, Protein of unknown function (DUF1625). Sequences making up this family are derived from hypothetical proteins expressed by both prokaryotic and eukaryotic species. The region in question is approximately 250 residues long. Length = 247 Score = 24.3 bits (53), Expect = 8.6 Identities = 12/46 (26%), Positives = 18/46 (39%), Gaps = 7/46 (15%) Query: 12 NIIQHVKYLIQLEQEY--GGFFLF-----IPVFLAFGAIFWFVYSP 50 + + + +I L GGFF+ I + L A W Y P Sbjct: 202 SPLVVLVDVIPLLGPLVGGGFFIVSLIISISLSLLTIAFAWLFYRP 247 >gnl|CDD|129517 TIGR00423, TIGR00423, radical SAM domain protein, CofH subfamily. This protein family includes the CofH protein of coenzyme F(420) biosynthesis from Methanocaldococcus jannaschii, but appears to hit genomes more broadly than just the subset that make coenzyme F(420), so that narrower group is being built as a separate family. Length = 309 Score = 24.3 bits (53), Expect = 9.2 Identities = 7/23 (30%), Positives = 16/23 (69%) Query: 13 IIQHVKYLIQLEQEYGGFFLFIP 35 ++H+ + +++++ GGF FIP Sbjct: 176 RVEHLLRIRKIQEKTGGFTEFIP 198 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.333 0.147 0.446 Gapped Lambda K H 0.267 0.0751 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,991,584 Number of extensions: 124287 Number of successful extensions: 620 Number of sequences better than 10.0: 1 Number of HSP's gapped: 613 Number of HSP's successfully gapped: 128 Length of query: 120 Length of database: 5,994,473 Length adjustment: 81 Effective length of query: 39 Effective length of database: 4,244,225 Effective search space: 165524775 Effective search space used: 165524775 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.0 bits) S2: 51 (23.4 bits)