BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780356|ref|YP_003064769.1| hypothetical protein CLIBASIA_01205 [Candidatus Liberibacter asiaticus str. psy62] (120 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780356|ref|YP_003064769.1| hypothetical protein CLIBASIA_01205 [Candidatus Liberibacter asiaticus str. psy62] Length = 120 Score = 238 bits (606), Expect = 3e-65, Method: Compositional matrix adjust. Identities = 120/120 (100%), Positives = 120/120 (100%) Query: 1 MLQKKISNPLCNIIQHVKYLIQLEQEYGGFFLFIPVFLAFGAIFWFVYSPEIPIWGIVLS 60 MLQKKISNPLCNIIQHVKYLIQLEQEYGGFFLFIPVFLAFGAIFWFVYSPEIPIWGIVLS Sbjct: 1 MLQKKISNPLCNIIQHVKYLIQLEQEYGGFFLFIPVFLAFGAIFWFVYSPEIPIWGIVLS 60 Query: 61 ILIIAIISLRIRYSHPHILLIVKTLTYFLTRMILAAIEITRNPTTILSQSITTNLRGIVK 120 ILIIAIISLRIRYSHPHILLIVKTLTYFLTRMILAAIEITRNPTTILSQSITTNLRGIVK Sbjct: 61 ILIIAIISLRIRYSHPHILLIVKTLTYFLTRMILAAIEITRNPTTILSQSITTNLRGIVK 120 >gi|254780419|ref|YP_003064832.1| aspartyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 622 Score = 23.9 bits (50), Expect = 0.94, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 13/23 (56%) Query: 96 AIEITRNPTTILSQSITTNLRGI 118 + I NP IL S+TT LR + Sbjct: 588 GLRIVENPKKILKISVTTILRNV 610 >gi|254780988|ref|YP_003065401.1| hypothetical protein CLIBASIA_04445 [Candidatus Liberibacter asiaticus str. psy62] Length = 151 Score = 23.5 bits (49), Expect = 1.2, Method: Compositional matrix adjust. Identities = 11/44 (25%), Positives = 19/44 (43%) Query: 14 IQHVKYLIQLEQEYGGFFLFIPVFLAFGAIFWFVYSPEIPIWGI 57 +Q+ Q E+E F + F +FW + P + WG+ Sbjct: 68 LQNQANEDQFERESKAMIFFNALIRPFTTLFWIILYPLLIWWGV 111 >gi|254780357|ref|YP_003064770.1| hypothetical protein CLIBASIA_01210 [Candidatus Liberibacter asiaticus str. psy62] Length = 394 Score = 21.6 bits (44), Expect = 5.1, Method: Compositional matrix adjust. Identities = 11/31 (35%), Positives = 19/31 (61%) Query: 39 AFGAIFWFVYSPEIPIWGIVLSILIIAIISL 69 A +IF + IP++G++ +IL I I+S Sbjct: 94 ASASIFLIKHFHCIPVYGLIANILAIPILSF 124 >gi|254780860|ref|YP_003065273.1| NADH dehydrogenase subunit H [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Score = 21.2 bits (43), Expect = 5.2, Method: Compositional matrix adjust. Identities = 13/46 (28%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Query: 79 LLIVKTLTYFLTRMILAAIEITRNPTTI----LSQSITTNLRGIVK 120 LLI + R + AA+++ R P + L QS L+ + K Sbjct: 26 LLIFIAYVLLMDRKVWAAVQLRRGPNVVGPWGLLQSFADFLKFVFK 71 >gi|254780701|ref|YP_003065114.1| putative two-component sensor histidine kinase transcriptional regulatory protein [Candidatus Liberibacter asiaticus str. psy62] Length = 495 Score = 21.2 bits (43), Expect = 5.4, Method: Compositional matrix adjust. Identities = 8/25 (32%), Positives = 14/25 (56%) Query: 45 WFVYSPEIPIWGIVLSILIIAIISL 69 WF +P P+W ++ + A +SL Sbjct: 65 WFTQNPIFPMWSLITLAVYAANLSL 89 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.333 0.147 0.446 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,673 Number of Sequences: 1233 Number of extensions: 2637 Number of successful extensions: 14 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 10 length of query: 120 length of database: 328,796 effective HSP length: 64 effective length of query: 56 effective length of database: 249,884 effective search space: 13993504 effective search space used: 13993504 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.0 bits) S2: 33 (17.3 bits)