RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780357|ref|YP_003064770.1| hypothetical protein CLIBASIA_01210 [Candidatus Liberibacter asiaticus str. psy62] (394 letters) >gnl|CDD|146422 pfam03772, Competence, Competence protein. Members of this family are integral membrane proteins with 6 predicted transmembrane helices. Some members of this family have been shown to be essential for bacterial competence in uptake of extracellular DNA. These proteins may transport DNA across the cell membrane. These proteins contain a highly conserved motif in the amino terminal transmembrane region that has two histidines that may form a metal binding site. Length = 270 Score = 55.7 bits (135), Expect = 2e-08 Identities = 23/94 (24%), Positives = 47/94 (50%), Gaps = 2/94 (2%) Query: 103 HFHCIPVYGLIANILAIPILSFVVIPAGLIAILLMILSLDNIPFG-VMAWGLDIIIHIAH 161 HF + L+AN+LA+P++SFVV+P L+A+LL + + W L++++ + Sbjct: 174 HFGQFSLVSLLANLLAVPLVSFVVLPLALLALLLSLFPPLAALLLWLADWLLELLLALLE 233 Query: 162 RIS-VAHNEFCIGRIPETSFVTIVVEFLLMVFCK 194 ++ + +GR + + LL++ Sbjct: 234 WLASLPGASLWVGRPSLWLLLLYYLLLLLLLLLL 267 >gnl|CDD|31236 COG1033, COG1033, Predicted exporters of the RND superfamily [General function prediction only]. Length = 727 Score = 34.8 bits (80), Expect = 0.045 Identities = 31/132 (23%), Positives = 49/132 (37%), Gaps = 13/132 (9%) Query: 112 LIANILAIPILSFVVIPAGLIAILLMILSLDNIPFG--VMAWGLDIIIHIAHRISVAHNE 169 L A I IPI V GL+ +L + L+ G ++ G+D IHI R + Sbjct: 593 LKAIIPLIPIAIVVGWNFGLMGLLGIPLTPATATLGAIILGIGVDYSIHITERYREERKK 652 Query: 170 FC-----------IGRIPETSFVTIVVEFLLMVFCKTNIRHIGSIMIGITIIILFTFPYS 218 G+ S +T + FL ++F I ++ I I++ Sbjct: 653 GGPKEAIETTVERTGKAILASALTTAIGFLALIFSPFPIISNFGLLTVIGILLSLLASLV 712 Query: 219 FSPDLLISEKGN 230 P LL+ G Sbjct: 713 LLPALLVLLDGR 724 >gnl|CDD|48241 cd03345, eu_TyrOH, Eukaryotic tyrosine hydroxylase (TyrOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes prokaryotic and eukaryotic phenylalanine-4-hydroxylase (PheOH) and eukaryotic tryptophan hydroxylase (TrpOH). TyrOH catalyzes the conversion of tyrosine to L-dihydroxyphenylalanine (L-DOPA), the rate-limiting step in the biosynthesis of the catecholamines dopamine, noradrenaline, and adrenaline.. Length = 298 Score = 28.4 bits (63), Expect = 3.4 Identities = 14/53 (26%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Query: 20 IARLSPPSGPAFPGLFDFNFSSYYKGISAIGYFYS----IPKMIYSSESHNTW 68 + + P PG D + K I+ I + Y IP++ Y++E TW Sbjct: 16 VTKYEPDLDLDHPGFSDKVYRERRKLIAEIAFQYKHGDPIPRVEYTAEEIATW 68 >gnl|CDD|132746 cd06948, NR_LBD_COUP-TF, Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family. The ligand binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs): COUP-TFs are orphan members of the steroid/thyroid hormone receptor superfamily. They are expressed in many tissues and are involved in the regulation of several important biological processes, such as neurogenesis, organogenesis, cell fate determination, and metabolic homeostasis. In mammals two isoforms named COUP-TFI and COUP-TFII have been identified. Both genes show an exceptional homology and overlapping expression patterns, suggesting that they may serve redundant functions. Although COUP-TF was originally characterized as a transcriptional activator of the chicken ovalbumin gene, COUP-TFs are generally considered to be repressors of transcription for other nuclear hormone receptors, such as retinoic acid receptor (RAR), thyroid hormone receptor (TR), vitamin D receptor (VDR), peroxisome proliferator activated receptor (PPAR), and hepatocyte nuclear factor 4 (HNF4). Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, COUP-TFs have a central well cons erved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD). Length = 236 Score = 28.6 bits (64), Expect = 3.5 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 3/26 (11%) Query: 272 EDLQEKNQSSLKEILRSM---QPRKF 294 E LQEK+Q +L+E +R+ QP +F Sbjct: 158 ESLQEKSQCALEEYVRTQYPNQPTRF 183 >gnl|CDD|38206 KOG2996, KOG2996, KOG2996, Rho guanine nucleotide exchange factor VAV3 [Signal transduction mechanisms]. Length = 865 Score = 28.1 bits (62), Expect = 4.5 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Query: 282 LKEILRSMQPRKFLCIK--KSFCVGCH 306 LKEI Q +FLC+K ++F + C Sbjct: 57 LKEINLRPQMSQFLCLKNIRTFLMFCC 83 >gnl|CDD|32610 COG2717, COG2717, Predicted membrane protein [Function unknown]. Length = 209 Score = 27.9 bits (62), Expect = 5.2 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 6/65 (9%) Query: 77 KQSFLNEIRANIGTYGSASASIFLIKHFHCIPVYGLIANI--LAIPILSFVVIPAGLIAI 134 KQ L IR +G + A + + HF V L ++ L + +L I G+IA Sbjct: 69 KQPKLIRIRRALGLW----AFFYALLHFTAYLVLDLGLDLALLGLDLLKRPYITIGMIAF 124 Query: 135 LLMIL 139 LL+I Sbjct: 125 LLLIP 129 >gnl|CDD|133465 cd06855, GT_GPT_euk, UDP-GlcNAc:dolichol-P GlcNAc-1-P transferase (GPT) catalyzes the transfer of GlcNAc-1-P from UDP-GlcNAc to dolichol-P to form GlcNAc-P-P-dolichol. The reaction is the first step in the assembly of dolichol-linked oligosaccharide intermediates and is essential for eukaryotic N-glycosylation. GPT activity has been identified in all eukaryotic cells examined to date. A series of six conserved motifs designated A through F, ranging in length from 5 to 13 amino acid residues, has been identified in this family. They have been determined to be important for stable expression, substrate binding, or catalytic activities. Length = 283 Score = 27.6 bits (62), Expect = 6.5 Identities = 26/166 (15%), Positives = 55/166 (33%), Gaps = 39/166 (23%) Query: 92 GSASASIFLIKHFHCIPVYGLIANILAIPILSFVVIPAGLIAILLMIL------------ 139 G +FLI + ++ + P V + L++I M Sbjct: 31 GLVPGIVFLI----VLFLFIPFPFLKDFPHDKLVEYLSALLSICCMTFLGFADDVLDLRW 86 Query: 140 -------SLDNIPFGVMAWGLDIIIHIAHRISVAHNEFCIGRIPETSFVTIVVEFLLMVF 192 + ++P ++ +G I + +G + + + V LL VF Sbjct: 87 RHKLILPTFASLPLLMVYYGNTGITLP-----IVPLRPLLGTLIDLGILYYVYMILLAVF 141 Query: 193 CKTNIRHI----------GSIMIGITIIILFTFPYSFSPDLLISEK 228 C TN +I S++I ++I++ + S + + Sbjct: 142 C-TNSINIYAGINGLEVGQSLVIALSILLYNLLELNGSSGSMTLDA 186 >gnl|CDD|99971 cd03798, GT1_wlbH_like, This family is most closely related to the GT1 family of glycosyltransferases. wlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.. Length = 377 Score = 27.3 bits (61), Expect = 6.8 Identities = 11/35 (31%), Positives = 13/35 (37%), Gaps = 2/35 (5%) Query: 121 ILSFVVIPAGLIAILLMILSLDNIPFGVMAWGLDI 155 I + P G A LL IP V G D+ Sbjct: 97 IHAHFAYPDGFAAALLK--RKLGIPLVVTLHGSDV 129 >gnl|CDD|34310 COG4694, COG4694, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 758 Score = 27.3 bits (60), Expect = 7.8 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Query: 270 QKEDLQEKNQSSLKEILRSMQPRKFL-CIKKSFCVGCHRSDVIVGVLKRKDMIRL 323 +L +KN+ KE L + + +KF I K F + IVG+ K K+ I + Sbjct: 159 CWRNLYKKNEERFKEYLENFKRKKFKRKILKEFENAKINASEIVGLEKVKEKIEI 213 >gnl|CDD|146838 pfam04401, DUF540, Protein of unknown function (DUF540). Uncharacterized bacterial integral membrane protein, possibly involved in cysteine biosynthesis. Speculated to be involved in sulphate transport. Length = 183 Score = 26.8 bits (60), Expect = 9.7 Identities = 8/27 (29%), Positives = 17/27 (62%) Query: 111 GLIANILAIPILSFVVIPAGLIAILLM 137 L+A +L+IP+++ +V P + L+ Sbjct: 156 LLVALLLSIPLVNLLVPPLAVAGATLL 182 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.325 0.141 0.425 Gapped Lambda K H 0.267 0.0748 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,974,780 Number of extensions: 276368 Number of successful extensions: 1028 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1022 Number of HSP's successfully gapped: 49 Length of query: 394 Length of database: 6,263,737 Length adjustment: 96 Effective length of query: 298 Effective length of database: 4,189,273 Effective search space: 1248403354 Effective search space used: 1248403354 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 58 (26.1 bits)