RPSBLAST alignment for GI: 254780360 and conserved domain: PRK12869

>gnl|CDD|183803 PRK12869, ubiA, protoheme IX farnesyltransferase; Reviewed. Length = 279
 Score =  172 bits (437), Expect = 1e-43
 Identities = 86/237 (36%), Positives = 134/237 (56%), Gaps = 2/237 (0%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIA-MGAGASGALNMYYD 65
           ++  ++ LLKPRV+ L    A  G  LA  H      +I +     + +G S A N   +
Sbjct: 1   KIKAYLKLLKPRVIWLLDLAAVAGYFLAAKHGVSWLPLIPLLIGGTLASGGSAAFNHGIE 60

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DIDK+M+RT+ RP P+G ++  EA  +G +L+     +  L +  ++A  + +  F Y 
Sbjct: 61  RDIDKVMSRTSKRPTPVGLVNRKEALAVGSALSALGTALGFLLLGPLTALFIALGWFFYA 120

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YTIWLK  T  NIVIGG AG    + G+AS TG + + ++++  +I+LWTP H WSLA
Sbjct: 121 VVYTIWLKPRTWLNIVIGGFAGNAAALAGYASGTGSLDLEAVLLSFLIYLWTPGHIWSLA 180

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVF 242
           L  ++DY++A +PMLP VV ++T+   I I   L  I  +L   L +  +   I+V 
Sbjct: 181 LKYREDYRRAGVPMLPAVVGEKTSVRAISISNAL-MIPYILLLYLYYIGLIGLILVA 236