>gi|254780361|ref|YP_003064774.1| ribosomal protein L32 [Candidatus Liberibacter asiaticus str. psy62]
MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVFVLKTKE