HHsearch alignment for GI: 254780361 and conserved domain: PRK01110

>PRK01110 rpmF 50S ribosomal protein L32; Validated.
Probab=99.92  E-value=3.2e-26  Score=158.07  Aligned_cols=56  Identities=59%  Similarity=0.843  Sum_probs=54.4

Q ss_pred             CCCCCCCCCHHCCCCHHHHHCCCCCCEEECCCCCCEEEEEEEECCCCCCCCEEEEEE
Q ss_conf             978878876100174122310268837887899782440464257786768796434
Q gi|254780361|r    1 MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVFVL   57 (61)
Q Consensus         1 MAVPKrK~S~sr~~~RRsh~~l~~p~l~~c~~cG~~~~~H~vc~~cG~YkGr~Vi~~   57 (61)
T Consensus         1 MAVPKrK~Sksr~~~RRsh~kl~~p~~~~c~~~g~~~lpH~v~~~-G~YkGr~Vi~k   56 (56)
T PRK01110          1 MAVPKRKTSKSKRRMRRSHWKLTAPTLSVDKTTGEYHLPHHVSLK-GYYKGRKVIPK   56 (56)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCEECCC-CCCCCEEEECC
T ss_conf             987656577000656422101368854489899986567778899-84989881219