HHsearch alignment for GI: 254780361 and conserved domain: pfam01783

>pfam01783 Ribosomal_L32p Ribosomal L32p protein family.
Probab=99.89  E-value=4.1e-24  Score=147.03  Aligned_cols=56  Identities=48%  Similarity=0.664  Sum_probs=54.6

Q ss_pred             CCCCCCCCHHCCCCHHHHHCCCCCCEEECCCCCCEEEEEEEECCCCCCCCEEEEEE
Q ss_conf             78878876100174122310268837887899782440464257786768796434
Q gi|254780361|r    2 AVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVFVL   57 (61)
Q Consensus         2 AVPKrK~S~sr~~~RRsh~~l~~p~l~~c~~cG~~~~~H~vc~~cG~YkGr~Vi~~   57 (61)
T Consensus         1 AVPKrr~Sksr~~~Rrs~~~~~~~~l~~c~~cg~~~l~H~vc~~cg~Y~gr~v~~~   56 (56)
T pfam01783         1 AVPKRKTSKSRKRKRRAHWKLKAPNLVECPNCGELKLPHRVCPSCGYYKGRQVIEK   56 (56)
T ss_pred             CCCCCCCCCHHCCCCCCCCCCCCCCEEECCCCCCCCCCCEECCCCCEECCEEEECC
T ss_conf             98766676010622223402358754588899985358778898980999983319