HHsearch alignment of GI: 254780361 and MMDB domain: 2j01_5_

>2j01_5 (5:) 50S ribosomal protein L32; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus}
Probab=99.95  E-value=5e-29  Score=172.42  Aligned_cols=57  Identities=42%  Similarity=0.670  Sum_probs=56.1

Q ss_pred             CCCCCCCCCHHCCCCHHHHHCCCCCCEEECCCCCCEEEEEEEECCCCCCCCEEEEEE
Q ss_conf             978878876100174122310268837887899782440464257786768796434
Q gi|254780361|r    1 MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVFVL   57 (61)
Q Consensus         1 MAVPKrK~S~sr~~~RRsh~~l~~p~l~~c~~cG~~~~~H~vc~~cG~YkGr~Vi~~   57 (61)
                      |||||+|+|+||+++|||||+|++|+|+.||+||++++||+||++||||+|||||++
T Consensus         4 MAvPKrK~Sksr~~~RRsh~k~~~p~l~~C~~cG~~~~pH~vC~~CG~Ykgr~Vi~v   60 (60)
T 2j01_5            4 HPVPKKKTSKARRDARRSHHALTPPTLVPCPECKAMKPPHTVCPECGYYAGRKVLEV   60 (60)
T ss_dssp             SSCCSSCCCHHHHHHHHGGGCCCCCCCBCCSSSSSCBCTTCBCTTTCCSSSCCSCCC
T ss_pred             CCCCCCCCCCCCCHHHCCCCCCCCCCEEECCCCCCCCCCEEECCCCCCCCCEEEEEC
T ss_conf             788878677200222202402358834689999982066068798981999985769