BLAST/PSIBLAST alignment of GI: 254780361 and GI: 110635754 at iteration 1
>gi|110635754|ref|YP_675962.1| 50S ribosomal protein L32 [Mesorhizobium sp. BNC1] Length = 60
>gi|122965547|sp|Q11CS8|RL32_MESSB RecName: Full=50S ribosomal protein L32 Length = 60
>gi|110286738|gb|ABG64797.1| LSU ribosomal protein L32P [Chelativorans sp. BNC1] Length = 60
 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 50/55 (90%)

Query: 1  MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVF 55
          MAVPKRKTSPSKRGMRRSADAL  P YVEDK SGELRRPHHVD+KTG+YRGRQV 
Sbjct: 1  MAVPKRKTSPSKRGMRRSADALKAPTYVEDKNSGELRRPHHVDLKTGMYRGRQVL 55