BLAST/PSIBLAST alignment of GI: 254780361 and GI: 163852879 at iteration 1
>gi|163852879|ref|YP_001640922.1| ribosomal protein L32 [Methylobacterium extorquens PA1] Length = 62
>gi|170751495|ref|YP_001757755.1| ribosomal protein L32 [Methylobacterium radiotolerans JCM 2831] Length = 62
>gi|188582903|ref|YP_001926348.1| 50S ribosomal protein L32 [Methylobacterium populi BJ001] Length = 62
>gi|218531705|ref|YP_002422521.1| 50S ribosomal protein L32 [Methylobacterium chloromethanicum CM4] Length = 62
>gi|240140207|ref|YP_002964684.1| 50S ribosomal subunit protein L32 [Methylobacterium extorquens AM1] Length = 62
>gi|254562644|ref|YP_003069739.1| 50S ribosomal subunit protein L32 [Methylobacterium extorquens DM4] Length = 62
>gi|20139689|sp|Q9APJ2|RL32_METEA RecName: Full=50S ribosomal protein L32 Length = 62
>gi|226708295|sp|A9W7T2|RL32_METEP RecName: Full=50S ribosomal protein L32 Length = 62
>gi|226708297|sp|B1Z7L0|RL32_METPB RecName: Full=50S ribosomal protein L32 Length = 62
>gi|226708298|sp|B1LV66|RL32_METRJ RecName: Full=50S ribosomal protein L32 Length = 62
>gi|254801809|sp|B7KX68|RL32_METC4 RecName: Full=50S ribosomal protein L32 Length = 62
>gi|13021729|gb|AAK11534.1|AF287907_1 putative ribosomal protein L32 [Methylobacterium extorquens AM1] Length = 62
>gi|163664484|gb|ABY31851.1| ribosomal protein L32 [Methylobacterium extorquens PA1] Length = 62
>gi|170658017|gb|ACB27072.1| ribosomal protein L32 [Methylobacterium radiotolerans JCM 2831] Length = 62
>gi|179346401|gb|ACB81813.1| ribosomal protein L32 [Methylobacterium populi BJ001] Length = 62
>gi|218524008|gb|ACK84593.1| ribosomal protein L32 [Methylobacterium chloromethanicum CM4] Length = 62
>gi|240010181|gb|ACS41407.1| 50S ribosomal subunit protein L32 [Methylobacterium extorquens AM1] Length = 62
>gi|254269922|emb|CAX25900.1| 50S ribosomal subunit protein L32 [Methylobacterium extorquens DM4] Length = 62
 Score =  103 bits (257), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 48/61 (78%), Positives = 54/61 (88%)

Query: 1  MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVFVLKTK 60
          MAVPKRKTSPS+RGMRRSADAL  P YVEDK SGELRRPHH+D+KTG+YRGRQV  +K+ 
Sbjct: 1  MAVPKRKTSPSRRGMRRSADALKAPTYVEDKDSGELRRPHHIDLKTGMYRGRQVLKVKSA 60

Query: 61 E 61
          E
Sbjct: 61 E 61