RPSBLAST alignment for GI: 254780361 and conserved domain: PRK12286

>gnl|CDD|183404 PRK12286, rpmF, 50S ribosomal protein L32; Reviewed. Length = 57
 Score = 68.7 bits (169), Expect = 3e-13
 Identities = 26/54 (48%), Positives = 32/54 (59%)

Query: 1  MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQV 54
          MAVPKRKTS S++  RR+   L  P  VE    GE + PH V    G Y+GR+V
Sbjct: 1  MAVPKRKTSKSRKRKRRAHFKLKAPGLVECPNCGEPKLPHRVCPSCGYYKGREV 54