RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780361|ref|YP_003064774.1| ribosomal protein L32 [Candidatus Liberibacter asiaticus str. psy62] (61 letters) >2j01_5 50S ribosomal protein L32; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} (5:) Length = 60 Score = 74.7 bits (184), Expect = 4e-15 Identities = 24/54 (44%), Positives = 32/54 (59%) Query: 1 MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQV 54 VPK+KTS ++R RRS ALTPP V + ++ PH V + G Y GR+V Sbjct: 4 HPVPKKKTSKARRDARRSHHALTPPTLVPCPECKAMKPPHTVCPECGYYAGRKV 57 >2zjr_Z 50S ribosomal protein L32; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} (Z:) Length = 60 Score = 74.3 bits (183), Expect = 5e-15 Identities = 26/54 (48%), Positives = 30/54 (55%) Query: 1 MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQV 54 VPK+KTS SKR MRRS ALT P E + + HH+ G Y GRQV Sbjct: 4 HPVPKKKTSKSKRDMRRSHHALTAPNLTECPQCHGKKLSHHICPNCGYYDGRQV 57 >3i1n_0 50S ribosomal protein L32; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_0 3e1b_T 3e1d_T 1vs6_0 3i1p_0 3i1r_0 3i1t_0 3i20_0 3i22_0 2qam_0* 1p85_Z 1p86_Z 2awb_0 2aw4_0 2i2v_0 2j28_0 2i2t_0* 2qao_0* 2qba_0* 2qbc_0* ... (0:23-57) Length = 35 Score = 32.4 bits (74), Expect = 0.022 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 23 TPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVF 55 + DK SGE HH+ G YRGR+V Sbjct: 2 AVTSLSVDKTSGEKHLRHHIT-ADGYYRGRKVI 33 >3bbo_2 Ribosomal protein L32; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} (2:) Length = 57 Score = 28.5 bits (64), Expect = 0.34 Identities = 9/18 (50%), Positives = 15/18 (83%) Query: 1 MAVPKRKTSPSKRGMRRS 18 MAVPK++TS K+ +R++ Sbjct: 1 MAVPKKRTSIYKKRIRKN 18 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.316 0.131 0.376 Gapped Lambda K H 0.267 0.0669 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 457,701 Number of extensions: 15221 Number of successful extensions: 22 Number of sequences better than 10.0: 1 Number of HSP's gapped: 21 Number of HSP's successfully gapped: 5 Length of query: 61 Length of database: 4,956,049 Length adjustment: 30 Effective length of query: 31 Effective length of database: 3,941,899 Effective search space: 122198869 Effective search space used: 122198869 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.2 bits)