BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780361|ref|YP_003064774.1| ribosomal protein L32 [Candidatus Liberibacter asiaticus str. psy62] (61 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780361|ref|YP_003064774.1| ribosomal protein L32 [Candidatus Liberibacter asiaticus str. psy62] Length = 61 Score = 124 bits (312), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 61/61 (100%), Positives = 61/61 (100%) Query: 1 MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVFVLKTK 60 MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVFVLKTK Sbjct: 1 MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVFVLKTK 60 Query: 61 E 61 E Sbjct: 61 E 61 >537021.9.peg.912_1 Length = 47 Score = 23.5 bits (49), Expect = 0.75, Method: Compositional matrix adjust. Identities = 10/21 (47%), Positives = 13/21 (61%) Query: 30 DKKSGELRRPHHVDMKTGLYR 50 +++S R PHH D T LYR Sbjct: 2 NRESFRTRLPHHKDPNTALYR 22 >gi|254780142|ref|YP_003064555.1| DNA-directed RNA polymerase subunit beta' [Candidatus Liberibacter asiaticus str. psy62] Length = 1398 Score = 21.6 bits (44), Expect = 2.5, Method: Compositional matrix adjust. Identities = 11/46 (23%), Positives = 21/46 (45%), Gaps = 6/46 (13%) Query: 13 RGMRRSADALTPPAYVEDKKSGELRRPHHVDMKT------GLYRGR 52 RG ++ PA + GE+++P ++ +T GL+ R Sbjct: 16 RGFDSVRISIASPAKIASLSYGEIKKPETINYRTFKPERDGLFCAR 61 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.316 0.131 0.376 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,175 Number of Sequences: 1233 Number of extensions: 969 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 61 length of database: 328,796 effective HSP length: 33 effective length of query: 28 effective length of database: 288,107 effective search space: 8066996 effective search space used: 8066996 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.7 bits) S2: 31 (16.5 bits)