RPSBLAST alignment for GI: 254780363 and conserved domain: PRK05713

>gnl|CDD|168200 PRK05713, PRK05713, hypothetical protein; Provisional. Length = 312
 Score = 44.3 bits (105), Expect = 3e-05
 Identities = 32/104 (30%), Positives = 50/104 (48%), Gaps = 6/104 (5%)

Query: 34  RPKSFRFRSGEFVMLGLMVNGRRISRAYSMAS-PCWDDKLEFFSIKVEQGPLTTHLQNIQ 92
           RP   R+R+G+ ++L        ++R YS+AS P  D  LEF       G      + +Q
Sbjct: 115 RP--LRYRAGQHLVLWTAGG---VARPYSLASLPGEDPFLEFHIDCSRPGAFCDAARQLQ 169

Query: 93  PGDTILLHKKSTGTLVLDALIPGNRLYLFSTGTGIAPFVSVIRD 136
            GD + L +   G L  D       L+L + GTG+AP   ++R+
Sbjct: 170 VGDLLRLGELRGGALHYDPDWQERPLWLLAAGTGLAPLWGILRE 213