RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780364|ref|YP_003064777.1| ferredoxin-NADP+ reductase protein [Candidatus Liberibacter asiaticus str. psy62] (224 letters) >gnl|CDD|99792 cd06195, FNR1, Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.. Length = 241 Score = 216 bits (553), Expect = 3e-57 Identities = 84/212 (39%), Positives = 118/212 (55%), Gaps = 14/212 (6%) Query: 17 VISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIVN-GRPIFRAYSIASPCRDDKLEFC 75 V+ + +TD LF F +TR FRF++G+F LGL + G+ + RAYSIAS ++ LEF Sbjct: 2 VLKRRDWTDDLFSFRVTRDIPFRFQAGQFTKLGLPNDDGKLVRRAYSIASAPYEENLEFY 61 Query: 76 SIKVDKGFFTTYLQNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIR 135 I V G T L ++PGDTI + KK TG L LD + PG RL+L + GTGIAPF SM+R Sbjct: 62 IILVPDGPLTPRLFKLKPGDTIYVGKKPTGFLTLDEVPPGKRLWLLATGTGIAPFLSMLR 121 Query: 136 DPETYKKFDEVIITHTCGRVAELQYGIDVMHEISQDEI--LKDLIGQKLKFYRTVTQEDY 193 D E +++FD++++ H EL Y QDEI L K ++ V++E Sbjct: 122 DLEIWERFDKIVLVHGVRYAEELAY---------QDEIEALAKQYNGKFRYVPIVSREKE 172 Query: 194 --LYKGRITNHILSGEFYRNMGLSPLNPDTRI 223 GRI + I SGE + GL + + Sbjct: 173 NGALTGRIPDLIESGELEEHAGLPLDPETSHV 204 >gnl|CDD|31221 COG1018, Hmp, Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Energy production and conversion]. Length = 266 Score = 121 bits (305), Expect = 1e-28 Identities = 62/219 (28%), Positives = 104/219 (47%), Gaps = 15/219 (6%) Query: 17 VISVKHYTDRLFRFCITRPKSFR--FRSGEFVMLGLIVNGRPIFRAYSIASPCRDDKLEF 74 V SV+ TD +F F + P R F G+++ +GL G P+ RAYS++S +D L Sbjct: 10 VTSVEPETDDVFSFTLEPPDGLRLDFEPGQYITVGLPNGGEPLLRAYSLSSAPDEDSLYR 69 Query: 75 CSIKV-DKGFFTTYLQ-NIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFAS 132 S+K D G + +L +++ GDT+ + GD +LD +P +L L + G GI PF S Sbjct: 70 ISVKREDGGGGSNWLHDHLKVGDTLEV-SAPAGDFVLD-DLPERKLLLLAGGIGITPFLS 127 Query: 133 MIRDPETYKKFDEVIITHTCGRVAELQYG--IDVMHEISQDEILKDLIGQ-KLKFYRTVT 189 M+R +V++ H A+L + +++ E+ +L + KL+ V+ Sbjct: 128 MLRTLLDRGP-ADVVLVHAARTPADLAFRDELELAAELPNALLLGLYTERGKLQGRIDVS 186 Query: 190 QEDYLY--KGRITNHILSGEFYRNMGLSPLN---PDTRI 223 + GR G F + + L+ PD R+ Sbjct: 187 RLLSAAPDGGREVYLCGPGPFMQAVRLALEALGVPDDRV 225 >gnl|CDD|99778 cd00322, FNR_like, Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and has a variety of physiological functions including nitrogen assimilation, dinitrogen fixation, steroid hydroxylation, fatty acid metabolism, oxygenase activity, and methane assimilation in many organisms. FNR has an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) flavin sub-domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal moeity may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Because flavins such as FAD can exist in oxidized, semiquinone (one- electron reduced), or fully reduced hydroquinone forms, FNR can interact with one and 2 electron carriers. FNR has a strong preference for NADP(H) vs NAD(H).. Length = 223 Score = 85.2 bits (211), Expect = 1e-17 Identities = 53/194 (27%), Positives = 86/194 (44%), Gaps = 15/194 (7%) Query: 18 ISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRAYSIAS-PCRDDKLEFCS 76 ++ + TD + F + P F F+ G++V L L +GR + RAYSIAS P + +LE Sbjct: 1 VATEDVTDDVRLFRLQLPNGFSFKPGQYVDLHLPGDGRGLRRAYSIASSPDEEGELELTV 60 Query: 77 IKVDKGFFTTYLQNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIRD 136 V G F+ +L +++PGD + + GD L + L + G GI PF SM+R Sbjct: 61 KIVPGGPFSAWLHDLKPGDEVEVSGP-GGDFFLPLE-ESGPVVLIAGGIGITPFRSMLRH 118 Query: 137 PETYKKFDEVIITHTCGRVAELQYGIDVMHEISQDEILKDLI--GQKLKFYRTVTQEDYL 194 K E+ + + A+L + DE L++L G + +++E Sbjct: 119 LAADKPGGEITLLYGARTPADLLF---------LDE-LEELAKEGPNFRLVLALSRESEA 168 Query: 195 YKGRITNHILSGEF 208 G E Sbjct: 169 KLGPGGRIDREAEI 182 >gnl|CDD|99784 cd06187, O2ase_reductase_like, The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant. Electron transfer is from NADH via FAD (in the oxygenase reductase) and an [2FE-2S] ferredoxin center (fused to the FAD/NADH domain and/or discrete) to the oxygenase. Dioxygenases add both atoms of oxygen to the substrate, while mono-oxygenases (aka mixed oxygenases) add one atom to the substrate and one atom to water. In dioxygenases, Class I enzymes are 2 component, containing a reductase with Rieske type [2Fe-2S] redox centers and an oxygenase. Class II are 3 component, having discrete flavin and ferredoxin proteins and an oxygenase. Class III have 2 [2Fe-2S] centers, one fused to the flavin domain and the other separate.. Length = 224 Score = 72.2 bits (178), Expect = 1e-13 Identities = 42/193 (21%), Positives = 81/193 (41%), Gaps = 18/193 (9%) Query: 17 VISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPI-FRAYSIASPCRDD-KLEF 74 V+SV+ T + + + F +G++V + + GRP +RAYS A+P +D ++EF Sbjct: 1 VVSVERLTHDIAVVRLQLDQPLPFWAGQYVNVTVP--GRPRTWRAYSPANPPNEDGEIEF 58 Query: 75 CSIKVDKGFFTTYL-QNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASM 133 V G + L ++ GD + L G L L + GTG+AP ++ Sbjct: 59 HVRAVPGGRVSNALHDELKVGDRVRL-SGPYGTFYLRRDHDRPVLCIAG-GTGLAPLRAI 116 Query: 134 IRDPETYKKFDEVIITHTCGRVAELQYGIDVMHEISQDEILKDLIGQKLKFYRTVTQED- 192 + D + V + +L Y ++ + ++ L+ V+ E+ Sbjct: 117 VEDALRRGEPRPVHLFFGARTERDL-YDLEGLLALAARH-------PWLRVVPVVSHEEG 168 Query: 193 --YLYKGRITNHI 203 +G +T+ + Sbjct: 169 AWTGRRGLVTDVV 181 >gnl|CDD|99811 cd06215, FNR_iron_sulfur_binding_1, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal portion of the FAD/NAD binding domain contains most of the NADP(H) binding residues and the N-terminal sub-domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. In this ferredoxin like sub-group, the FAD/NAD sub-domains is typically fused to a C-terminal iron-sulfur binding domain. Iron-sulfur proteins play an important role in electron transfer processes and in various enzymatic reactions. The family includes plant and algal ferredoxins which act as electron carriers in photosynthesis and ferredoxins which participate in redox chains from bacteria to mammals. Ferredoxin reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.. Length = 231 Score = 67.6 bits (166), Expect = 2e-12 Identities = 37/111 (33%), Positives = 60/111 (54%), Gaps = 6/111 (5%) Query: 28 FRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRAYSIAS-PCRDDKLEFCSIK-VDKGFFT 85 FRF F ++ G+F+ L L ++G ++RAY+++S P R D L ++K V G + Sbjct: 16 FRFAAPDGSLFAYKPGQFLTLELEIDGETVYRAYTLSSSPSRPDSLSI-TVKRVPGGLVS 74 Query: 86 TYL-QNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIR 135 +L N++ GD + + G+ L P ++L L S G+GI P SM R Sbjct: 75 NWLHDNLKVGDELWASGPA-GEFTL-IDHPADKLLLLSAGSGITPMMSMAR 123 >gnl|CDD|99810 cd06214, PA_degradation_oxidoreductase_like, NAD(P) binding domain of ferredoxin reductase like phenylacetic acid (PA) degradation oxidoreductase. PA oxidoreductases of E. coli hydroxylate PA-CoA in the second step of PA degradation. Members of this group typically fuse a ferredoxin reductase-like domain with an iron-sulfur binding cluster domain. Ferredoxins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal portion may contain a flavin prosthetic group, as in flavoenzymes, or use flavin as a substrate. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria and participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.. Length = 241 Score = 66.8 bits (164), Expect = 5e-12 Identities = 32/100 (32%), Positives = 54/100 (54%), Gaps = 4/100 (4%) Query: 38 FRFRSGEFVMLGLIVNGRPIFRAYSIASPCRDDKLEFCSIK-VDKGFFTTYL-QNIQPGD 95 FR+R G+F+ L + ++G + R+YSI S DD+L ++K V G F+ + ++ GD Sbjct: 31 FRYRPGQFLTLRVPIDGEEVRRSYSICSSPGDDELRI-TVKRVPGGRFSNWANDELKAGD 89 Query: 96 TILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIR 135 T+ + G L L LF+ G+GI P S+++ Sbjct: 90 TLEVM-PPAGRFTLPPLPGARHYVLFAAGSGITPVLSILK 128 >gnl|CDD|99788 cd06191, FNR_iron_sulfur_binding, Iron-sulfur binding Ferredoxin Reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with a C-terminal iron-sulfur binding cluster domain. FNR was intially identified as a chloroplast reductase activity catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and has a variety of physiological functions including nitrogen assimilation, dinitrogen fixation, steroid hydroxylation, fatty acid metabolism, oxygenase activity, and methnae assimilation in a variety of organisms. FNR has an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) flavin sub-domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal moeity may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Because flavins such as FAD can exist in oxidized, semiquinone (one- electron reduced), or fully reduced hydroquinone forms, FNR can interact with one and 2 electron carriers. FNR has a strong preference for NADP(H) vs NAD(H).. Length = 231 Score = 64.9 bits (158), Expect = 2e-11 Identities = 35/111 (31%), Positives = 53/111 (47%), Gaps = 3/111 (2%) Query: 26 RLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRAYSIASPCRDDKLEFCSIKVDKGFFT 85 F + P + FR G+ V L L +G + R YS+ S D++ +V G + Sbjct: 14 VTIVFAVPGPLQYGFRPGQHVTLKLDFDGEELRRCYSLCSSPAPDEISITVKRVPGGRVS 73 Query: 86 TYL-QNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIR 135 YL ++IQPG T+ + G + PG R L + G+GI P +MIR Sbjct: 74 NYLREHIQPGMTVEV-MGPQGHFVYQPQPPG-RYLLVAAGSGITPLMAMIR 122 >gnl|CDD|99798 cd06201, SiR_like2, Cytochrome p450- like alpha subunits of E. coli sulfite reductase (SiR) multimerize with beta subunits to catalyze the NADPH dependent reduction of sulfite to sulfide. Beta subunits have an Fe4S4 cluster and a siroheme, while the alpha subunits (cysJ gene) are of the cytochrome p450 (CyPor) family having FAD and FMN as prosthetic groups and utilizing NADPH. Cypor (including cyt -450 reductase, nitric oxide synthase, and methionine synthase reductase) are ferredoxin reductase (FNR)-like proteins with an additional N-terminal FMN domain and a connecting sub-domain inserted within the flavin binding portion of the FNR-like domain. The connecting domain orients the N-terminal FMN domain with the C-terminal FNR domain. NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.. Length = 289 Score = 61.6 bits (150), Expect = 2e-10 Identities = 34/106 (32%), Positives = 47/106 (44%), Gaps = 6/106 (5%) Query: 39 RFRSGEFVMLGLIVNGRPIFRAYSIASPCRDDKLEFCSIKVDKGFFTTYLQNIQPGDTIL 98 F +G+ +LG++ G + R YS+AS D LE C K G + YL ++PGDTI Sbjct: 83 SFEAGD--LLGILPPGSDVPRFYSLASSSSDGFLEICVRKHPGGLCSGYLHGLKPGDTIK 140 Query: 99 LHKKSTGDLILDSLIPGNR-LYLFSMGTGIAPFASMIRDPETYKKF 143 + G + L GTGIAP A IR + Sbjct: 141 AFIRPNPSFRPAK---GAAPVILIGAGTGIAPLAGFIRANAARRPM 183 >gnl|CDD|99812 cd06216, FNR_iron_sulfur_binding_2, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.. Length = 243 Score = 59.5 bits (145), Expect = 6e-10 Identities = 35/108 (32%), Positives = 59/108 (54%), Gaps = 7/108 (6%) Query: 34 RP--KSFRFRSGEFVMLGLIVNGRPIFRAYSIAS-PCRDDKLEFCSIK-VDKGFFTTYL- 88 RP R+G+ V LG+ ++G +R+YS++S P ++D ++K G + +L Sbjct: 38 RPNRGWPGHRAGQHVRLGVEIDGVRHWRSYSLSSSPTQEDGTITLTVKAQPDGLVSNWLV 97 Query: 89 QNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIRD 136 ++ PGD + L + GD +L +P RL L + G+GI P SM+R Sbjct: 98 NHLAPGDVVEL-SQPQGDFVLPDPLPP-RLLLIAAGSGITPVMSMLRT 143 >gnl|CDD|99813 cd06217, FNR_iron_sulfur_binding_3, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap between the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.. Length = 235 Score = 56.1 bits (136), Expect = 6e-09 Identities = 34/113 (30%), Positives = 56/113 (49%), Gaps = 5/113 (4%) Query: 26 RLFRFCITRPKSFRFRSGEFVMLGL-IVNGRPIFRAYSIAS-PCRDDKLEFCSIKVDKGF 83 + FR + F +G+ V L L ++G R+YSIAS P + ++E +V G Sbjct: 17 KTFRLAVPDGVPPPFLAGQHVDLRLTAIDGYTAQRSYSIASSPTQRGRVELTVKRVPGGE 76 Query: 84 FTTYL-QNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIR 135 + YL ++ GD + + + G + L G+ + L + G+GI P SMIR Sbjct: 77 VSPYLHDEVKVGDLLEV-RGPIGTFTWNPL-HGDPVVLLAGGSGIVPLMSMIR 127 >gnl|CDD|99807 cd06211, phenol_2-monooxygenase_like, Phenol 2-monooxygenase (phenol hydroxylase) is a flavoprotein monooxygenase, able to use molecular oxygen as a substrate in the microbial degredation of phenol. This protein is encoded by a single gene and uses a tightly bound FAD cofactor in the NAD(P)H dependent conversion of phenol and O2 to catechol and H2O. This group is related to the NAD binding ferredoxin reductases.. Length = 238 Score = 54.6 bits (132), Expect = 2e-08 Identities = 32/125 (25%), Positives = 52/125 (41%), Gaps = 24/125 (19%) Query: 23 YTDRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRAYSIAS-PCRDDKLEFCSIKVDK 81 T + R + P+ F++G++V L G RA+SIAS P ++E V Sbjct: 19 PTIKGVRLKLDEPEEIEFQAGQYV--NLQAPGYEGTRAFSIASSPSDAGEIELHIRLVPG 76 Query: 82 GFFTTYL-QNIQPGDTILL---------HKKSTGDLILDSLIPGNRLYLFSMGTGIAPFA 131 G TTY+ + ++ GD + + +I I G G+G++ Sbjct: 77 GIATTYVHKQLKEGDELEISGPYGDFFVRDSDQRPII---FIAG--------GSGLSSPR 125 Query: 132 SMIRD 136 SMI D Sbjct: 126 SMILD 130 >gnl|CDD|99806 cd06210, MMO_FAD_NAD_binding, Methane monooxygenase (MMO) reductase of methanotrophs catalyzes the NADH-dependent hydroxylation of methane to methanol. This multicomponent enzyme mediates electron transfer via a hydroxylase (MMOH), a coupling protein, and a reductase which is comprised of an N-terminal [2Fe-2S] ferredoxin domain, an FAD binding subdomain, and an NADH binding subdomain. Oxygenases oxidize hydrocarbons using dioxygen as the oxidant. Dioxygenases add both atom of oxygen to the substrate, while mono-oxygenases add one atom to the substrate and one atom to water.. Length = 236 Score = 53.9 bits (130), Expect = 4e-08 Identities = 32/105 (30%), Positives = 50/105 (47%), Gaps = 6/105 (5%) Query: 33 TRPKSFRFRSGEFVMLGLIVNGRPIFRAYSIAS-PCRDDKLEFCSIKVDKGFFTTYLQN- 90 + F G+FV + + G R+YS+A+ P D +LEF + G F+TYL+ Sbjct: 28 GAGIAAEFVPGQFVEIE--IPGTDTRRSYSLANTPNWDGRLEFLIRLLPGGAFSTYLETR 85 Query: 91 IQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIR 135 + G + L + G L R + + GTG+AP SM+R Sbjct: 86 AKVGQRLNL-RGPLGAFGLRENGLRPR-WFVAGGTGLAPLLSMLR 128 >gnl|CDD|99780 cd06183, cyt_b5_reduct_like, Cytochrome b5 reductase catalyzes the reduction of 2 molecules of cytochrome b5 using NADH as an electron donor. Like ferredoxin reductases, these proteins have an N-terminal FAD binding subdomain and a C-terminal NADH binding subdomain, separated by a cleft, which accepts FAD. The NADH-binding moiety interacts with part of the FAD and resembles a Rossmann fold. However, NAD is bound differently than in canonical Rossmann fold proteins. Nitrate reductases, flavoproteins similar to pyridine nucleotide cytochrome reductases, catalyze the reduction of nitrate to nitrite. The enzyme can be divided into three functional fragments that bind the cofactors molybdopterin, heme-iron, and FAD/NADH.. Length = 234 Score = 53.7 bits (130), Expect = 4e-08 Identities = 31/123 (25%), Positives = 52/123 (42%), Gaps = 6/123 (4%) Query: 16 SVISVKHYTDRLFRFCITRPKS-FRFRSGEFVMLGLIVNGRPIFRAYS-IASPCRDDKLE 73 S + H R+FRF + P G+ V L +G + R Y+ I+ + Sbjct: 5 SKEDISH-DTRIFRFELPSPDQVLGLPVGQHVELKAPDDGEQVVRPYTPISPDDDKGYFD 63 Query: 74 FCSIKV-DKGFFTTYLQNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFAS 132 IK+ G + YL +++PGDT+ + + G + + + GTGI P Sbjct: 64 LL-IKIYPGGKMSQYLHSLKPGDTVEI-RGPFGKFEYKPNGKVKHIGMIAGGTGITPMLQ 121 Query: 133 MIR 135 +IR Sbjct: 122 LIR 124 >gnl|CDD|99786 cd06189, flavin_oxioreductase, NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins. Structurally similar to ferredoxin reductases, but with only 15% sequence identity, flavin reductases reduce FAD, FMN, or riboflavin via NAD(P)H. Flavin is used as a substrate, rather than a tightly bound prosthetic group as in flavoenzymes; weaker binding is due to the absence of a binding site for the AMP moeity of FAD.. Length = 224 Score = 52.6 bits (127), Expect = 9e-08 Identities = 35/130 (26%), Positives = 57/130 (43%), Gaps = 25/130 (19%) Query: 16 SVISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRAYSIAS-PCRDDKLEF 74 V S++ D ++R + P F +G+++ L L+ +G R +SIAS P D ++E Sbjct: 2 KVESIEPLNDDVYRVRLKPPAPLDFLAGQYLDL-LLDDGDK--RPFSIASAPHEDGEIEL 58 Query: 75 CSIKVDKGFFTTY-LQNIQPGDTI---------LLHKKSTGDLILDSLIPGNRLYLFSMG 124 V G F+ Y + ++ + L + S LI LI G G Sbjct: 59 HIRAVPGGSFSDYVFEELKENGLVRIEGPLGDFFLREDSDRPLI---LIAG--------G 107 Query: 125 TGIAPFASMI 134 TG AP S++ Sbjct: 108 TGFAPIKSIL 117 >gnl|CDD|144531 pfam00970, FAD_binding_6, Oxidoreductase FAD-binding domain. Length = 99 Score = 51.8 bits (125), Expect = 1e-07 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 2/74 (2%) Query: 26 RLFRFCITRPK-SFRFRSGEFVMLGLIVNGRPIFRAYSIASPCRDDK-LEFCSIKVDKGF 83 R FRF + P G+ + L L ++G+ + RAYS AS D LE G Sbjct: 15 RRFRFALPSPDQVLGLPPGQHIFLRLPIDGKLVVRAYSPASSPDDVGELELLVKVYPGGK 74 Query: 84 FTTYLQNIQPGDTI 97 + YL +++ GDT+ Sbjct: 75 MSQYLDSLKVGDTV 88 >gnl|CDD|30889 COG0543, UbiB, 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases [Coenzyme metabolism / Energy production and conversion]. Length = 252 Score = 50.0 bits (119), Expect = 5e-07 Identities = 37/146 (25%), Positives = 67/146 (45%), Gaps = 8/146 (5%) Query: 5 SSELAADVYCESVISVKHYTDRLFRFCIT-RPKSFRFRSGEFVMLGLIVNGRPIFRAYSI 63 + LA + + V+ + + F + + F+ G+FVML + R R YS+ Sbjct: 1 ENPLALLMSYK-VVEKEEISPDTFLLRLRLPFVALTFKPGQFVMLRVPGGVR---RPYSL 56 Query: 64 AS-PCRDDKLEFCSIKVDKGFFTTYLQNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFS 122 AS P +LE + G T Y+ ++ GD I + + G+ L I G + L + Sbjct: 57 ASAPDDKGELELHIRVYEVGKVTKYIFGLKEGDKIRV-RGPLGNGFLREKI-GKPVLLIA 114 Query: 123 MGTGIAPFASMIRDPETYKKFDEVII 148 GTGIAP ++ ++ + ++V + Sbjct: 115 GGTGIAPLYAIAKELKEKGDANKVTL 140 >gnl|CDD|99805 cd06209, BenDO_FAD_NAD, Benzoate dioxygenase reductase (BenDO) FAD/NAD binding domain. Oxygenases oxidize hydrocarbons using dioxygen as the oxidant. As a Class I bacterial dioxygenases, benzoate dioxygenase like proteins combine an [2Fe-2S] cluster containing N-terminal ferredoxin at the end fused to an FAD/NADP(P) domain. In dioxygenase FAD/NAD(P) binding domain, the reductase transfers 2 electrons from NAD(P)H to the oxygenase which insert into an aromatic substrate, an initial step in microbial aerobic degradation of aromatic rings. Flavin oxidoreductases use flavins as substrates, unlike flavoenzymes which have a flavin prosthetic group.. Length = 228 Score = 49.9 bits (120), Expect = 6e-07 Identities = 36/100 (36%), Positives = 50/100 (50%), Gaps = 8/100 (8%) Query: 38 FRFRSGEFVMLGLIVNGRPIFRAYSIASPCRDDKLEFCSIKVDKGFFTTYLQN-IQPGDT 96 F G++V L V G R+YS +S D +LEF + G ++YL++ QPGD Sbjct: 29 LAFLPGQYVNLQ--VPGTDETRSYSFSSAPGDPRLEFLIRLLPGGAMSSYLRDRAQPGDR 86 Query: 97 ILLHKKSTGDLILDSLIPGNRLYLF-SMGTGIAPFASMIR 135 + L TG L L R L + GTG+APF SM+ Sbjct: 87 LTL----TGPLGSFYLREVKRPLLMLAGGTGLAPFLSMLD 122 >gnl|CDD|99817 cd06221, sulfite_reductase_like, Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases. Clostridium pasteurianum inducible dissimilatory type sulfite reductase is linked to ferredoxin and reduces NH2OH and SeO3 at a lesser rate than it's normal substate SO3(2-). Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+.. Length = 253 Score = 49.1 bits (118), Expect = 9e-07 Identities = 43/141 (30%), Positives = 58/141 (41%), Gaps = 36/141 (25%) Query: 20 VKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIVNGR-PIFRAYSIAS-PCRDDKLEFCSI 77 +K +T R + F F+ G+FVML L G PI SI+S P R LE Sbjct: 11 IKTFT---LRLEDDDEELFTFKPGQFVMLSLPGVGEAPI----SISSDPTRRGPLELTIR 63 Query: 78 KVDKGFFTTYLQNIQPGDTILL----------HKKSTGDLILDSLIPGNRLYLFSMGTGI 127 +V G T L ++PGDT+ L + DL+ L+ G G G+ Sbjct: 64 RV--GRVTEALHELKPGDTVGLRGPFGNGFPVEEMKGKDLL---LVAG--------GLGL 110 Query: 128 APFASMIRD----PETYKKFD 144 AP S+I E Y K Sbjct: 111 APLRSLINYILDNREDYGKVT 131 >gnl|CDD|99808 cd06212, monooxygenase_like, The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons. These flavoprotein monooxygenases use molecular oxygen as a substrate and require reduced FAD. One atom of oxygen is incorportated into the aromatic compond, while the other is used to form a molecule of water. In contrast dioxygenases add both atoms of oxygen to the substrate.. Length = 232 Score = 47.3 bits (113), Expect = 3e-06 Identities = 36/147 (24%), Positives = 60/147 (40%), Gaps = 34/147 (23%) Query: 26 RLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRAYSIA-SPCRDDKLEFCSIKVDKGFF 84 R R + P+ +F +G++V + V G R++S+A +P +LEF K G F Sbjct: 16 RRLRLRLEEPEPIKFFAGQYV--DITVPGTEETRSFSMANTPADPGRLEFIIKKYPGGLF 73 Query: 85 TTYL-QNIQPGD---------TILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMI 134 +++L + GD T L + ++ LI G G+G+AP S++ Sbjct: 74 SSFLDDGLAVGDPVTVTGPYGTCTLRESRDRPIV---LIGG--------GSGMAPLLSLL 122 Query: 135 RDPETYKKFDEVIITHTCGRVAELQYG 161 RD + R YG Sbjct: 123 RD----------MAASGSDRPVRFFYG 139 >gnl|CDD|99779 cd06182, CYPOR_like, NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. CYPOR has a C-terminal ferredoxin reducatase (FNR)- like FAD and NAD binding module, an FMN-binding domain, and an additional conecting domain (inserted within the FAD binding region) that orients the FNR and FMN binding domains. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria and participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2, which then transfers two electrons and a proton to NADP+ to form NADPH.. Length = 267 Score = 46.9 bits (112), Expect = 4e-06 Identities = 32/147 (21%), Positives = 55/147 (37%), Gaps = 26/147 (17%) Query: 2 CDVSSELAADVYCESVISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRAY 61 V+ +L S ++ F ++ +++ G+ LG+I R Y Sbjct: 2 ITVNRKLTPPDSPRSTRHLE--------FDLSGNSVLKYQPGD--HLGVIPPNPLQPRYY 51 Query: 62 SIASPCRDD--KLEFCSIKVD---------KGFFTTYLQNIQPGDTILLHKKSTGDLIL- 109 SIAS D ++ C V KG + +L +Q G + + + L Sbjct: 52 SIASSPDVDPGEVHLCVRVVSYEAPAGRIRKGVCSNFLAGLQLGAKVTVFIRPAPSFRLP 111 Query: 110 -DSLIPGNRLYLFSMGTGIAPFASMIR 135 D P + + GTGIAPF ++ Sbjct: 112 KDPTTP---IIMVGPGTGIAPFRGFLQ 135 >gnl|CDD|99804 cd06208, CYPOR_like_FNR, These ferredoxin reductases are related to the NADPH cytochrome p450 reductases (CYPOR), but lack the FAD-binding region connecting sub-domain. Ferredoxin-NADP+ reductase (FNR) is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins, such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap between the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2, which then transfers two electrons and a proton to NADP+ to form NADPH. CYPOR serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases, sulfite reducatase, and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. CYPOR has a C-terminal FNR-like FAD and NAD binding module, an FMN-binding domain, and an additional connecting domain (inserted within the FAD binding region) that orients the FNR and FMN -binding domains. The C-terminal domain contains most of the NADP(H) binding residues, and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule, which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.. Length = 286 Score = 45.0 bits (107), Expect = 2e-05 Identities = 32/100 (32%), Positives = 45/100 (45%), Gaps = 19/100 (19%) Query: 53 NGRP-IFRAYSIASPCRD------DKLEFC----------SIKVDKGFFTTYLQNIQPGD 95 NG+P R YSIAS R L C + + KG + YL +++PGD Sbjct: 58 NGKPHKLRLYSIASS-RYGDDGDGKTLSLCVKRLVYTDPETDETKKGVCSNYLCDLKPGD 116 Query: 96 TILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIR 135 + + G +L P L + + GTGIAPF S +R Sbjct: 117 DVQI-TGPVGKTMLLPEDPNATLIMIATGTGIAPFRSFLR 155 >gnl|CDD|99791 cd06194, FNR_N-term_Iron_sulfur_binding, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.. Length = 222 Score = 43.8 bits (104), Expect = 4e-05 Identities = 29/115 (25%), Positives = 48/115 (41%), Gaps = 6/115 (5%) Query: 24 TDRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRAYSIAS-PCRDDKLEFCSIKVDKG 82 + + R + + + G++V L G R+YS S P D++LEF + G Sbjct: 8 SPDVLRVRLEPDRPLPYLPGQYV--NLRRAGGLA-RSYSPTSLPDGDNELEFHIRRKPNG 64 Query: 83 FFTTYL-QNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIRD 136 F+ +L + +PG + L + G L L GTG+AP + R Sbjct: 65 AFSGWLGEEARPGHALRL-QGPFGQAFYRPEYGEGPLLLVGAGTGLAPLWGIARA 118 >gnl|CDD|35754 KOG0534, KOG0534, KOG0534, NADH-cytochrome b-5 reductase [Coenzyme transport and metabolism, Energy production and conversion]. Length = 286 Score = 43.0 bits (101), Expect = 7e-05 Identities = 28/119 (23%), Positives = 50/119 (42%), Gaps = 5/119 (4%) Query: 19 SVKHYTDRLFRFCITRPKS-FRFRSGEFVMLGLIVNGRPIFRAYS-IASPCRDDKLEFCS 76 + H T LFRF + G+ V+L + G+ + R Y+ ++ + Sbjct: 61 ELSHDT-SLFRFVLPSADHVLGLPIGQHVVLKAPIGGKLVVRPYTPVSLDDDKGYFDLVV 119 Query: 77 IKVDKGFFTTYLQNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIR 135 KG + +L +++ GDT+ + G+ D L + + GTGI P +IR Sbjct: 120 KVYPKGKMSQHLDSLKIGDTVEF-RGPIGEFKYDPQ-KAKHLGMIAGGTGITPMLQLIR 176 >gnl|CDD|99787 cd06190, T4MO_e_transfer_like, Toluene-4-monoxygenase electron transfer component of Pseudomonas mendocina hydroxylates toluene and forms p-cresol as part of a three component toluene-4-monoxygenase system. Electron transfer is from NADH to an NADH:ferredoxin oxidoreductase (TmoF in P. mendocina) to ferredoxin to an iron-containing oxygenase. TmoF is homologous to other mono- and dioxygenase systems within the ferredoxin reductase family.. Length = 232 Score = 42.2 bits (100), Expect = 1e-04 Identities = 33/125 (26%), Positives = 54/125 (43%), Gaps = 12/125 (9%) Query: 17 VISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLI-VNGRPIFRAYSIASPCRDD-KLEF 74 ++ V+ T + F F G++ +L L V G RAYS+A+ + EF Sbjct: 1 LVDVRELTHDVAEFRFALDGPADFLPGQYALLALPGVEGA---RAYSMANLANASGEWEF 57 Query: 75 CSIKVDKGFFTTYL-QNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSM--GTGIAPFA 131 + G + L N++PGD + L G L L P + + G+G+AP Sbjct: 58 IIKRKPGGAASNALFDNLEPGDELEL----DGPYGLAYLRPDEDRDIVCIAGGSGLAPML 113 Query: 132 SMIRD 136 S++R Sbjct: 114 SILRG 118 >gnl|CDD|99781 cd06184, flavohem_like_fad_nad_binding, FAD_NAD(P)H binding domain of flavohemoglobin. Flavohemoglobins have a globin domain containing a B-type heme fused with a ferredoxin reductase-like FAD/NAD-binding domain. Flavohemoglobins detoxify nitric oxide (NO) via an NO dioxygenase reaction. The hemoglobin domain adopts a globin fold with an embedded heme molecule. Flavohemoglobins also have a C-terminal reductase domain with bindiing sites for FAD and NAD(P)H. This domain catalyzes the conversion of NO + O2 + NAD(P)H to NO3- + NAD(P)+. Instead of the oxygen transport function of hemoglobins, flavohemoglobins seem to act in NO dioxygenation and NO signalling.. Length = 247 Score = 41.8 bits (99), Expect = 2e-04 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 7/100 (7%) Query: 40 FRSGEFVMLGLIV--NGRPIFRAYSIASPCRDDKLEFCSIK-VDKGFFTTYL-QNIQPGD 95 F G+++ + + + G R YS++ D S+K G + YL N++ GD Sbjct: 37 FLPGQYLSVRVKLPGLGYRQIRQYSLSDAPNGDYYRI-SVKREPGGLVSNYLHDNVKVGD 95 Query: 96 TILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIR 135 + + + GD +LD L L S G GI P SM+ Sbjct: 96 VLEVSAPA-GDFVLDEASDRP-LVLISAGVGITPMLSMLE 133 >gnl|CDD|99803 cd06207, CyPoR_like, NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.. Length = 382 Score = 41.9 bits (99), Expect = 2e-04 Identities = 23/98 (23%), Positives = 39/98 (39%), Gaps = 19/98 (19%) Query: 59 RAYSIAS-----PCR--------DDKLEFCSIKVDKGFFTTYLQNIQPGDTI-LLHKKST 104 R YSI+S P K + G ++YL ++ G + + KKS+ Sbjct: 165 RYYSISSSPLKNPNEVHLLVSLVSWKTPSGRSR--YGLCSSYLAGLKVGQRVTVFIKKSS 222 Query: 105 GDLILDSLIPGNRLYLFSMGTGIAPFASMIRDPETYKK 142 L D P + + GTG+APF + +++ Sbjct: 223 FKLPKDPKKP---IIMVGPGTGLAPFRAFLQERAALLA 257 >gnl|CDD|99793 cd06196, FNR_like_1, Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain. The N-terminal region may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Ferredoxin is reduced in the final stage of photosystem I. The flavoprotein Ferredoxin-NADP+ reductase transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) which then transfers a hydride ion to convert NADP+ to NADPH.. Length = 218 Score = 39.9 bits (94), Expect = 5e-04 Identities = 53/196 (27%), Positives = 77/196 (39%), Gaps = 35/196 (17%) Query: 28 FRFCITRPKSFRFRSGEFVMLGLIVNG-RPIFRAYSIASPCRDDKLEFCSIKV--DKGFF 84 R +P+ + F G+ + + G R R ++ S DD LEF IK D Sbjct: 16 KRLRFDKPEGYDFTPGQATEVAIDKPGWRDEKRPFTFTSLPEDDVLEF-VIKSYPDHDGV 74 Query: 85 TTYLQNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIRDPETYKKFD 144 T L +QPGDT+L+ + I PG + G GI PF +++RD K + Sbjct: 75 TEQLGRLQPGDTLLI--EDPWGAIEYKG-PG---VFIAGGAGITPFIAILRDLAAKGKLE 128 Query: 145 EVIITHTCGRVAELQYGIDVMHEISQDEILKDLIGQKL--KFYRTVTQEDY--LYKGRIT 200 +T L + + +D ILKD + + L KF VT E GRI Sbjct: 129 ----GNT------LIFAN----KTEKDIILKDELEKMLGLKFINVVTDEKDPGYAHGRID 174 Query: 201 -------NHILSGEFY 209 + FY Sbjct: 175 KAFLKQHVTDFNQHFY 190 >gnl|CDD|33854 COG4097, COG4097, Predicted ferric reductase [Inorganic ion transport and metabolism]. Length = 438 Score = 39.2 bits (91), Expect = 0.001 Identities = 27/124 (21%), Positives = 46/124 (37%), Gaps = 5/124 (4%) Query: 13 YCESVISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGL-IVNGRPIFRAYSIASPCRDDK 71 Y V + + I + +++G+F L + I R ++IA + Sbjct: 216 YLGKVTAPQRGNVDTLEITIGLQGPWLYQAGQFAFLKIEIEEFRMRPHPFTIACSHEGSE 275 Query: 72 LEFCSIKVDKGFFTTYLQNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFA 131 L F SIK F T N++ G + + G + + + G GI PF Sbjct: 276 LRF-SIKALGDFTKTLKDNLKVGTKLEV-DGPYGKFDFERGLNTQ--VWIAGGIGITPFI 331 Query: 132 SMIR 135 SM+ Sbjct: 332 SMLF 335 >gnl|CDD|36374 KOG1159, KOG1159, KOG1159, NADP-dependent flavoprotein reductase [Energy production and conversion]. Length = 574 Score = 37.2 bits (86), Expect = 0.003 Identities = 28/98 (28%), Positives = 45/98 (45%), Gaps = 11/98 (11%) Query: 59 RAYSIASPCRDDKLEFCSIKVD---------KGFFTTYLQNIQPGDTILLHKKSTGDLIL 109 RA+SIAS LE V+ +G + +L +++PGD I + K G L Sbjct: 369 RAFSIASSPGAHHLELLVAIVEYKTILKEPRRGLCSNWLASLKPGDEIPI-KVRPGTLYF 427 Query: 110 DSLIPGNRLYLFSMGTGIAPFASMIRDPETYKKFDEVI 147 S L + GTG+APF ++I++ + V+ Sbjct: 428 PSD-LNKPLIMVGPGTGVAPFRALIQERIYQGDKENVL 464 >gnl|CDD|99809 cd06213, oxygenase_e_transfer_subunit, The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons. Electron transfer is from NADH via FAD (in the oxygenase reductase) and an [2FE-2S] ferredoxin center (fused to the FAD/NADH domain and/or discrete) to the oxygenase. Dioxygenases add both atoms of oxygen to the substrate while mono-oxygenases add one atom to the substrate and one atom to water. In dioxygenases, Class I enzymes are 2 component, containing a reductase with Rieske type [2Fe-2S] redox centers and an oxygenase. Class II are 3 component, having discrete flavin and ferredoxin proteins and an oxygenase. Class III have 2 [2Fe-2S] centers, one fused to the flavin domain and the other separate.. Length = 227 Score = 37.3 bits (87), Expect = 0.004 Identities = 30/124 (24%), Positives = 61/124 (49%), Gaps = 9/124 (7%) Query: 16 SVISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRAYSIA-SPCRDDKLEF 74 ++++ + T + R + + +++G++ L L G P R+YS A +P D +L F Sbjct: 4 TIVAQERLTHDIVRLTVQLDRPIAYKAGQYAELTL--PGLPAARSYSFANAPQGDGQLSF 61 Query: 75 CSIKVDKGFFTTYLQN-IQPGDTILLHKKSTGDLILDSLIPGNR-LYLFSMGTGIAPFAS 132 KV G F+ +L + G+ + + + GD L PG+ + + G+G+AP + Sbjct: 62 HIRKVPGGAFSGWLFGADRTGERLTV-RGPFGDFWLR---PGDAPILCIAGGSGLAPILA 117 Query: 133 MIRD 136 ++ Sbjct: 118 ILEQ 121 >gnl|CDD|35262 KOG0039, KOG0039, KOG0039, Ferric reductase, NADH/NADPH oxidase and related proteins [Inorganic ion transport and metabolism, Secondary metabolites biosynthesis, transport and catabolism]. Length = 646 Score = 36.5 bits (84), Expect = 0.006 Identities = 36/197 (18%), Positives = 68/197 (34%), Gaps = 30/197 (15%) Query: 16 SVISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRAYSIASPCRDDKLEFC 75 + V + +++P F+++ G+++ + + + ++I S DD L Sbjct: 358 KIAKVVLLPSDVLELIMSKPPGFKYKPGQYIFVNCPSLSKLEWHPFTITSAPEDDFLS-V 416 Query: 76 SIKVDKGFFTTYLQNI-------QPGDTILLHKKSTGDLILDSLIPGNR-------LYLF 121 IK +T L+N D K LI ++ L L Sbjct: 417 HIKALGD-WTEKLRNAFSEVSQPPESDKSYPFPKI---LIDGPYGAPSQDVFKYEVLVLV 472 Query: 122 SMGTGIAPFASMIRD-------PETYKKFDEVIITHTCGRVAELQYGIDVMHEISQDEIL 174 G G+ PFAS+++D T + + +V Y V E E Sbjct: 473 GGGIGVTPFASILKDLLNKISLGRTKAPTSDYSDSLKLKKV----YFYWVTREQRSFEWF 528 Query: 175 KDLIGQKLKFYRTVTQE 191 K L+ + ++ + E Sbjct: 529 KGLLTEVEEYDSSGVIE 545 >gnl|CDD|30718 COG0369, CysJ, Sulfite reductase, alpha subunit (flavoprotein) [Inorganic ion transport and metabolism]. Length = 587 Score = 36.1 bits (83), Expect = 0.008 Identities = 35/162 (21%), Positives = 58/162 (35%), Gaps = 21/162 (12%) Query: 5 SSELAADVYCESVISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIF-RAYSI 63 EL + + ++ Y R + R F + LI P+ R YSI Sbjct: 323 QEELRRLLEQLDIADLQDYAKRRTLIDVLR----DFPPAKLPAEELIDLLPPLKPRLYSI 378 Query: 64 ASPCRD--DKLEFCSIKVDK--------GFFTTYLQNIQP-GDTILLHKKSTGDLIL--D 110 AS D++ V G + YL ++ GDTI + + + L D Sbjct: 379 ASSPGVSPDEVHLTVGVVRYQAEGRERYGVCSGYLADLLEEGDTIPVFVQPNKNFRLPED 438 Query: 111 SLIPGNRLYLFSMGTGIAPFASMIRDPETYKKFDEVIITHTC 152 P + + GTGIAPF + +++ + + C Sbjct: 439 PETP---IIMIGPGTGIAPFRAFVQERAANGAEGKNWLFFGC 477 >gnl|CDD|99802 cd06206, bifunctional_CYPOR, These bifunctional proteins fuse N-terminal cytochrome p450 with a cytochrome p450 reductase (CYPOR). NADPH cytochrome p450 reductase serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.. Length = 384 Score = 36.1 bits (84), Expect = 0.008 Identities = 30/106 (28%), Positives = 47/106 (44%), Gaps = 28/106 (26%) Query: 43 GEFV-MLGLIVNGRPIFRAYSIAS-PCRDDKLEFCSIKVD-------------KGFFTTY 87 F+ ML + RP R YSI+S P D ++ V +G ++Y Sbjct: 150 ATFLAMLPPM---RP--RQYSISSSPLVDPGH--ATLTVSVLDAPALSGQGRYRGVASSY 202 Query: 88 LQNIQPGDTILLH-KKSTGDLIL--DSLIPGNRLYLFSMGTGIAPF 130 L +++PGD+I + + S D P L + + GTG+APF Sbjct: 203 LSSLRPGDSIHVSVRPSHSAFRPPSDPSTP---LIMIAAGTGLAPF 245 >gnl|CDD|36373 KOG1158, KOG1158, KOG1158, NADP/FAD dependent oxidoreductase [Energy production and conversion]. Length = 645 Score = 35.3 bits (81), Expect = 0.014 Identities = 24/99 (24%), Positives = 42/99 (42%), Gaps = 18/99 (18%) Query: 59 RAYSIASPCR--DDKLEFCSIKVD----------KGFFTTYLQNIQPGD---TILLHKKS 103 R YSI+S + +++ V+ G + +L N++PG+ + KS Sbjct: 423 RYYSISSSPKVHPNEVHLTVTVVEYGTPDGGPKRYGVCSNWLSNLKPGEKVPNPVPVGKS 482 Query: 104 TGDLILDSLIPGNRLYLFSMGTGIAPFASMIRDPETYKK 142 L D P + + GTGIAPF +++ K+ Sbjct: 483 MFRLPSDPSTP---IIMIGPGTGIAPFRGFLQERLFLKQ 518 >gnl|CDD|99800 cd06203, methionine_synthase_red, Human methionine synthase reductase (MSR) restores methionine sythase which is responsible for the regeneration of methionine from homocysteine, as well as the coversion of methyltetrahydrofolate to tetrahydrofolate. In MSR, electrons are transferred from NADPH to FAD to FMN to cob(II)alamin. MSR resembles proteins of the cytochrome p450 family including nitric oxide synthase, the alpha subunit of sulfite reductase, but contains an extended hinge region. NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. CYPORs resemble ferredoxin reductase (FNR) but have a connecting subdomain inserted within the flavin binding region, which helps orient the FMN binding doamin with the FNR module. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.. Length = 398 Score = 34.6 bits (80), Expect = 0.021 Identities = 23/82 (28%), Positives = 34/82 (41%), Gaps = 10/82 (12%) Query: 59 RAYSIASPCRDD--KLEFC-SI--KVDKGFFTTYL-----QNIQPGDTILLHKKSTGDLI 108 R YSIAS + KL F S+ KG T++L G + + +S+ Sbjct: 175 RPYSIASSPLEGPGKLRFIFSVVEFPAKGLCTSWLESLCLSASSHGVKVPFYLRSSSRFR 234 Query: 109 LDSLIPGNRLYLFSMGTGIAPF 130 L + + GTG+APF Sbjct: 235 LPPDDLRRPIIMVGPGTGVAPF 256 >gnl|CDD|38588 KOG3378, KOG3378, KOG3378, Hemoglobin-like flavoprotein [Energy production and conversion]. Length = 385 Score = 30.8 bits (69), Expect = 0.27 Identities = 16/80 (20%), Positives = 31/80 (38%), Gaps = 2/80 (2%) Query: 59 RAYSIASPCRDDKLEFCSIKVDKGFFTTYL-QNIQPGDTILLHKKSTGDLILDSLIPGNR 117 + S ++ +V G + ++ N++ GD + + + + S NR Sbjct: 204 YSLSNRVDTCRNQFRISVRRVAGGVVSNFVHDNLKVGDIVGVSPPAGNFVYKRSEENVNR 263 Query: 118 -LYLFSMGTGIAPFASMIRD 136 L F+ G GI P +I Sbjct: 264 PLLCFAGGIGITPLIPIIET 283 >gnl|CDD|99783 cd06186, NOX_Duox_like_FAD_NADP, NADPH oxidase (NOX) catalyzes the generation of reactive oxygen species (ROS) such as superoxide and hydrogen peroxide. ROS were originally identified as bactericidal agents in phagocytes, but are now also implicated in cell signaling and metabolism. NOX has a 6-alpha helix heme-binding transmembrane domain fused to a flavoprotein with the nucleotide binding domain located in the cytoplasm. Duox enzymes link a peroxidase domain to the NOX domain via a single transmembrane and EF-hand Ca2+ binding sites. The flavoprotein module has a ferredoxin like FAD/NADPH binding domain. In classical phagocytic NOX2, electron transfer occurs from NADPH to FAD to the heme of cytb to oxygen leading to superoxide formation.. Length = 210 Score = 29.2 bits (66), Expect = 0.90 Identities = 29/127 (22%), Positives = 52/127 (40%), Gaps = 24/127 (18%) Query: 25 DRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRA-----YSIASPCRD--DKLEFCSI 77 + R I +PK F+++ G+ V L N + ++IAS D D L I Sbjct: 10 SDVIRLTIPKPKPFKWKPGQHVYL----NFPSLLSFWQSHPFTIASSPEDEQDTLSLI-I 64 Query: 78 KVDKGFFTTYLQNIQPGDTILLHKKSTGDLILD--------SLIPGNRLYLFSMGTGIAP 129 + KGF T L+ + K ++++ L+ + + L + G+GI Sbjct: 65 RAKKGFTTRLLRKALKSPGGGVSLK----VLVEGPYGSSSEDLLSYDNVLLVAGGSGITF 120 Query: 130 FASMIRD 136 ++RD Sbjct: 121 VLPILRD 127 >gnl|CDD|99795 cd06198, FNR_like_3, NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain. The N-terminal domain may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Ferredoxin is reduced in the final stage of photosystem I. The flavoprotein Ferredoxin-NADP+ reductase transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) which then transfers a hydride ion to convert NADP+ to NADPH.. Length = 216 Score = 29.1 bits (66), Expect = 1.0 Identities = 25/113 (22%), Positives = 43/113 (38%), Gaps = 27/113 (23%) Query: 36 KSFRFRSGEFVMLGLIVNGRPIFRA--YSIAS-PCRDDKLEFCSIKVDKGFFTTYL-QNI 91 + R+G+F L + ++I+S P D +L F +IK G +T L + + Sbjct: 19 PALGHRAGQFA--FLRFDASGWEEPHPFTISSAPDPDGRLRF-TIK-ALGDYTRRLAERL 74 Query: 92 QPGDTILL--------HKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIRD 136 +PG + + I I G G GI PF +++ Sbjct: 75 KPGTRVTVEGPYGRFTFDDRRARQIW---IAG--------GIGITPFLALLEA 116 >gnl|CDD|99785 cd06188, NADH_quinone_reductase, Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) FAD/NADH binding domain. (Na+-NQR) provides a means of storing redox reaction energy via the transmembrane translocation of Na2+ ions. The C-terminal domain resembles ferredoxin:NADP+ oxidoreductase, and has NADH and FAD binding sites. (Na+-NQR) is distinct from H+-translocating NADH:quinone oxidoreductases and noncoupled NADH:quinone oxidoreductases. The NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal domain of this group typically contains an iron-sulfur cluster binding domain.. Length = 283 Score = 28.8 bits (65), Expect = 1.4 Identities = 16/65 (24%), Positives = 34/65 (52%), Gaps = 11/65 (16%) Query: 44 EFVMLGLI-VNGRPIFRAYSIAS-PCRDDKLEFC---------SIKVDKGFFTTYLQNIQ 92 +F + L+ + P+ RAYS+A+ P + +L+ + + G ++Y+ N++ Sbjct: 71 KFGLWQLVFKHDEPVSRAYSLANYPAEEGELKLNVRIATPPPGNSDIPPGIGSSYIFNLK 130 Query: 93 PGDTI 97 PGD + Sbjct: 131 PGDKV 135 >gnl|CDD|31411 COG1218, CysQ, 3'-Phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase [Inorganic ion transport and metabolism]. Length = 276 Score = 28.4 bits (63), Expect = 1.5 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 7/47 (14%) Query: 29 RFCITRP----KSFRFRSGEF-VMLGLIVNGRPIFRAYSIASPCRDD 70 RF + P K F R+G+F V + LI NG P+ + +P Sbjct: 85 RFWLVDPLDGTKEFIKRNGDFAVNIALIENGVPVLGV--VYAPETGK 129 >gnl|CDD|99816 cd06220, DHOD_e_trans_like2, FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins. Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+. In L. lactis, DHOD B (encoded by pyrDa) is co-expressed with pyrK and both gene products are required for full activity, as well as 3 cofactors: FMN, FAD, and an [2Fe-2S] cluster.. Length = 233 Score = 28.4 bits (64), Expect = 1.7 Identities = 34/131 (25%), Positives = 55/131 (41%), Gaps = 34/131 (25%) Query: 26 RLFRFCITRPKSFRFRSGEFVMLGLI-VNGRPIFRAYSIASPCRDDKLEFCSIKVDK-GF 83 + F F F F+ G+FVM+ + V+ P+ S++ + SI V K G Sbjct: 14 KTFVF----DWDFDFKPGQFVMVWVPGVDEIPM----SLSYIDGPN-----SITVKKVGE 60 Query: 84 FTTYLQNIQPGDTILL------HKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIRDP 137 T+ L +++ GD + + + G +L LI G G GIAP A + Sbjct: 61 ATSALHDLKEGDKLGIRGPYGNGFELVGGKVL--LIGG--------GIGIAPLAPLAER- 109 Query: 138 ETYKKFDEVII 148 KK +V + Sbjct: 110 --LKKAADVTV 118 >gnl|CDD|33061 COG3250, LacZ, Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism]. Length = 808 Score = 28.0 bits (62), Expect = 2.1 Identities = 8/26 (30%), Positives = 13/26 (50%) Query: 33 TRPKSFRFRSGEFVMLGLIVNGRPIF 58 FR+ E L++NG+P+F Sbjct: 276 AEALRIGFRTVEIKDGLLLINGKPVF 301 >gnl|CDD|39879 KOG4681, KOG4681, KOG4681, Uncharacterized conserved protein [Function unknown]. Length = 280 Score = 27.7 bits (61), Expect = 3.1 Identities = 6/30 (20%), Positives = 15/30 (50%) Query: 41 RSGEFVMLGLIVNGRPIFRAYSIASPCRDD 70 F ++GL++ G ++R ++ + P Sbjct: 65 FGLSFGLMGLVLGGAYLYRYFAPSPPNARR 94 >gnl|CDD|99799 cd06202, Nitric_oxide_synthase, The ferredoxin-reductase (FNR) like C-terminal domain of the nitric oxide synthase (NOS) fuses with a heme-containing N-terminal oxidase domain. The reductase portion is similar in structure to NADPH dependent cytochrome-450 reductase (CYPOR), having an inserted connecting sub-domain within the FAD binding portion of FNR. NOS differs from CYPOR in a requirement for the cofactor tetrahydrobiopterin and unlike most CYPOR is dimeric. Nitric oxide synthase produces nitric oxide in the conversion of L-arginine to L-citruline. NOS has been implicated in a variety of processes including cytotoxicity, anti-inflamation, neurotransmission, and vascular smooth muscle relaxation.. Length = 406 Score = 26.9 bits (60), Expect = 4.1 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 5/53 (9%) Query: 82 GFFTTYLQNIQPGDTI--LLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFAS 132 G +T+L + PGDT+ + + L D +P + + GTGIAPF S Sbjct: 214 GVCSTWLNGLTPGDTVPCFVRSAPSFHLPEDPSVP---VIMVGPGTGIAPFRS 263 >gnl|CDD|30136 cd01638, CysQ, CysQ, a 3'-Phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase, is a bacterial member of the inositol monophosphatase family. It has been proposed that CysQ helps control intracellular levels of PAPS, which is an intermediate in cysteine biosynthesis (a principal route of sulfur assimilation).. Length = 242 Score = 26.8 bits (59), Expect = 4.9 Identities = 10/35 (28%), Positives = 18/35 (51%), Gaps = 3/35 (8%) Query: 36 KSFRFRSGEF-VMLGLIVNGRPIFRAYSIASPCRD 69 + F +GEF V + L+ +GRP+ + +P Sbjct: 86 REFIKGNGEFAVNIALVEDGRPVLGV--VYAPALG 118 >gnl|CDD|36371 KOG1156, KOG1156, KOG1156, N-terminal acetyltransferase [Chromatin structure and dynamics]. Length = 700 Score = 26.4 bits (58), Expect = 6.5 Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 14/55 (25%) Query: 170 QDEILKDLIGQKL-----------KFYRTVTQEDYLYKGRITNHILSGEFYRNMG 213 +I +D G+KL KF + K + +ILS E Y G Sbjct: 622 PVDIDEDPFGEKLLKTEDPLEEARKFLPNLQH---KGKEKGETYILSFELYYRKG 673 >gnl|CDD|143941 pfam00175, NAD_binding_1, Oxidoreductase NAD-binding domain. Xanthine dehydrogenases, that also bind FAD/NAD, have essentially no similarity. Length = 106 Score = 26.1 bits (58), Expect = 8.9 Identities = 22/85 (25%), Positives = 36/85 (42%), Gaps = 14/85 (16%) Query: 124 GTGIAPFASMIRDPETYKKFDEVIITHTCGRVAELQYGIDVMHEISQDEILKDLIGQ--K 181 GTGIAP S+++ ++ G L YG ++ E L++L + Sbjct: 5 GTGIAPLYSVLK----------ALLEDEDGTEVYLVYGNRTEDDLLLREELEELAKKYPN 54 Query: 182 LKFYRTVTQED--YLYKGRITNHIL 204 LK +D Y KG +T+ +L Sbjct: 55 LKVVAVSRTDDGWYGRKGYVTDALL 79 >gnl|CDD|30722 COG0373, HemA, Glutamyl-tRNA reductase [Coenzyme metabolism]. Length = 414 Score = 26.0 bits (57), Expect = 9.9 Identities = 12/59 (20%), Positives = 20/59 (33%), Gaps = 8/59 (13%) Query: 134 IRDPETYKKFDEVIITHTCGRV------AELQYGIDVMHEISQDEILKDLIGQKLKFYR 186 + +E +I TC RV I + E+ I + +G+ L R Sbjct: 32 LDQLLHQPSIEEAVILSTCNRVEIYAVVHTGSELIRFLAELHGLSI--EDLGKYLYVLR 88 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.325 0.143 0.428 Gapped Lambda K H 0.267 0.0759 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,798,192 Number of extensions: 147336 Number of successful extensions: 514 Number of sequences better than 10.0: 1 Number of HSP's gapped: 469 Number of HSP's successfully gapped: 57 Length of query: 224 Length of database: 6,263,737 Length adjustment: 90 Effective length of query: 134 Effective length of database: 4,318,927 Effective search space: 578736218 Effective search space used: 578736218 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 55 (24.9 bits)