HHsearch alignment for GI: 254780365 and conserved domain: COG2068

>COG2068 Uncharacterized MobA-related protein [General function prediction only].
Probab=99.41  E-value=3.3e-12  Score=95.04  Aligned_cols=188  Identities=23%  Similarity=0.291  Sum_probs=121.8

Q ss_pred             CCCCEEEEECCCCCCCCCHHHCCCCCCEEEECCEEHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCHHHHHHHHHC
Q ss_conf             85458999568888334324408883335688362799999999978998899981355444101001174544456541
Q gi|254780365|r    5 KKVRKAVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGKGLIKDYFDIQFELEQSLRKR   84 (299)
Q Consensus         5 ~~i~KavIlAaG~GtRl~P~T~~~pKpllpi~~kpiI~~~i~~l~~~Gi~~i~iv~~~~k~~I~~~f~~~~~~~~~l~~~   84 (299)
T Consensus         4 ~~v-~~VvLAAGrssRmG-----~~KlLap~~g~plv~~~~~~a~~a~~~~vivV~g~~~--~~~~-------~a~~---   65 (199)
T COG2068           4 STV-AAVVLAAGRSSRMG-----QPKLLAPLDGKPLVRASAETALSAGLDRVIVVTGHRV--AEAV-------EALL---   65 (199)
T ss_pred             CCE-EEEEECCCCCCCCC-----CCCEECCCCCCCHHHHHHHHHHHCCCCEEEEEECCCH--HHHH-------HHHH---
T ss_conf             646-78887166666678-----7516541499828999999997268870999927611--3678-------8653---


Q ss_pred             CCCEEECCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             87000011344112485799843334233466542110112233--3311127864445443322112221223432200
Q gi|254780365|r   85 NKKAELTLLAESIPSIGNAVFTWQYERKGLGHAVWCARNIIGDN--PFALLLPDMIMSPLEGENCMANMIKLYEKEGANI  162 (299)
Q Consensus        85 ~~~~~~~~~~~~~~~~~~i~~v~Q~~p~Gtg~Ai~~a~~~i~de--~flv~~gD~i~~~~~~~~~l~~li~~~~~~~~~v  162 (299)
T Consensus        66 ------------~~~~~~~v~npd-~~~Gls~Sl~ag~~a~~~~~~~v~~~lgDmP---~V~~~t~~rl~~~~~~~~-~-  127 (199)
T COG2068          66 ------------AQLGVTVVVNPD-YAQGLSTSLKAGLRAADAEGDGVVLMLGDMP---QVTPATVRRLIAAFRARG-A-  127 (199)
T ss_pred             ------------CCCCEEEEECCC-HHHHHHHHHHHHHHHCCCCCCEEEEEECCCC---CCCHHHHHHHHHHCCCCC-C-
T ss_conf             ------------369808996955-2223769999998735567976999968888---787899999998443467-3-


Q ss_pred             EEEEECCHHHCCCCCCEECCCCCCCCCCEEEEECCCCCCCCCCCCEEECHHHEECHHHHHHHCCCCCCCCCCCCCHHHHH
Q ss_conf             11243285443313310013333335300000025778886734233020200272331100012266676750037899
Q gi|254780365|r  163 LAVSECDPQLSCKYGMVQVGKAIDHQVFHISDMIEKPDSSTFISNFFINGRYILHPDIFSILNDWKENEGKGEIQLTDSM  242 (299)
Q Consensus       163 i~~~~v~~~~~~~yGvi~~~~~~~~~~~~I~~~vEKP~~~~~~Snl~~~GiYi~~~~i~~~L~~~~~~~~~gE~~ltD~i  242 (299)
T Consensus       128 -~v~p-------~~~-------------------g~rG~Pv-----------~~~~~~~~~l~~l~GD--~G-------~  160 (199)
T COG2068         128 -AVRP-------VYG-------------------GARGHPV-----------LLSKDLFPALARLSGD--VG-------A  160 (199)
T ss_pred             -EEEE-------ECC-------------------CCCCCCE-----------EECHHHHHHHHHCCCC--HH-------H
T ss_conf             -4422-------206-------------------8767964-----------5656678998616886--22-------8


Q ss_pred             HHHHHCCC--EEEEEE-EEEEEECCCHHHHHHHHHH
Q ss_conf             99983198--489998-1378643998899999999
Q gi|254780365|r  243 RKLSERHD--FLAYHF-KGHTYDCGSKKGFVLANIA  275 (299)
Q Consensus       243 ~~l~~~~~--v~a~~~-~g~w~DiG~~~~yl~A~~~  275 (299)
T Consensus       161 r~ll~~~~~~~~~V~~~~g~llDVDTped~~~a~~~  196 (199)
T COG2068         161 RQLLEEGGLPLVEVEVDAGVLLDVDTPEDLARAQDL  196 (199)
T ss_pred             HHHHHHCCCCEEEECCCCCEEECCCCHHHHHHHHHH
T ss_conf             999975386347652688517547998999999876