HHsearch alignment for GI: 254780365 and conserved domain: PRK00317

>PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein A; Reviewed.
Probab=99.48  E-value=4.3e-13  Score=100.48  Aligned_cols=187  Identities=14%  Similarity=0.159  Sum_probs=107.6

Q ss_pred             CCCCCEEEEECCCCCCCCCHHHCCCCCCEEEECCEEHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCHHHHHHHHH
Q ss_conf             88545899956888833432440888333568836279999999997899889998135544410100117454445654
Q gi|254780365|r    4 LKKVRKAVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGKGLIKDYFDIQFELEQSLRK   83 (299)
Q Consensus         4 m~~i~KavIlAaG~GtRl~P~T~~~pKpllpi~~kpiI~~~i~~l~~~Gi~~i~iv~~~~k~~I~~~f~~~~~~~~~l~~   83 (299)
T Consensus         1 m~~i-~gvILAGG~SsRm----gG~dK~ll~~~G~~li~~~~~~l~~-~~~~v~i~~~~~~~~~~~~-------------   61 (193)
T PRK00317          1 MPPI-TGVILAGGRARRM----GGVDKGLQELNGKPLIQHVIDRLAP-QVDEIVINANRNLARYAAF-------------   61 (193)
T ss_pred             CCCC-EEEEECCCCCCCC----CCCCCCCCEECCEEHHHHHHHHHHH-HCCEEEEECCCCHHHHHHC-------------
T ss_conf             9985-6999887676789----9999750658997499999998775-4576899768788888644-------------


Q ss_pred             CCCCEEECCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEE
Q ss_conf             18700001134411248579984333423346654211011223333111278644454433221122212234322001
Q gi|254780365|r   84 RNKKAELTLLAESIPSIGNAVFTWQYERKGLGHAVWCARNIIGDNPFALLLPDMIMSPLEGENCMANMIKLYEKEGANIL  163 (299)
Q Consensus        84 ~~~~~~~~~~~~~~~~~~~i~~v~Q~~p~Gtg~Ai~~a~~~i~de~flv~~gD~i~~~~~~~~~l~~li~~~~~~~~~vi  163 (299)
T Consensus        62 ----------------~~~vi~D~~~~~~GPL~Gi~saL~~~~~~~vlv~~~DmP~i~---~~~i~~L~~~~~~~~~~iv  122 (193)
T PRK00317         62 ----------------GLPVIPDELADFPGPLAGILAGLQQAETEWVLFVPCDTPFLP---RDLVARLAQALIEEDADIA  122 (193)
T ss_pred             ----------------CCEEEECCCCCCCCCHHHHHHHHHHCCCCEEEEEECCCCCCC---HHHHHHHHHHHHHCCCCEE
T ss_conf             ----------------996996378776675899999986268775999626778898---9999999999874799838


Q ss_pred             EEEECCHHHCCCCCCEECCCCCCCCCCEEEEECCCCCCCCCCCCEEECHHHEECHHHHHHHCCCCCCCCCCCCCHHHHHH
Q ss_conf             12432854433133100133333353000000257788867342330202002723311000122666767500378999
Q gi|254780365|r  164 AVSECDPQLSCKYGMVQVGKAIDHQVFHISDMIEKPDSSTFISNFFINGRYILHPDIFSILNDWKENEGKGEIQLTDSMR  243 (299)
Q Consensus       164 ~~~~v~~~~~~~yGvi~~~~~~~~~~~~I~~~vEKP~~~~~~Snl~~~GiYi~~~~i~~~L~~~~~~~~~gE~~ltD~i~  243 (299)
T Consensus       123 ~~~-~-------------~--------------~~~~-P-----L--~al--y~~~~l~~l~~~l~---~g~~~----l~  157 (193)
T PRK00317        123 VAH-D-------------G--------------ERDH-P-----T--FAL--YSVALLPDLEAALA---AGERK----VM  157 (193)
T ss_pred             EEE-E-------------C--------------CCCC-C-----C--CCC--CCHHHHHHHHHHHH---CCCCC----HH
T ss_conf             986-4-------------8--------------9546-5-----3--110--47889999999999---09965----99


Q ss_pred             HHHHCCCEEEEEEEE---EEEECCCHHHHHHHH
Q ss_conf             998319848999813---786439988999999
Q gi|254780365|r  244 KLSERHDFLAYHFKG---HTYDCGSKKGFVLAN  273 (299)
Q Consensus       244 ~l~~~~~v~a~~~~g---~w~DiG~~~~yl~A~  273 (299)
T Consensus       158 ~~l~~~~~~~v~~~~~~~~f~NiNTpeDl~~~~  190 (193)
T PRK00317        158 AFYARHGTVAVDFSDPKDAFFNINTPEDLAQLE  190 (193)
T ss_pred             HHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHH
T ss_conf             999878958998079866236899999999999