PSIBLAST alignment of GI: 254780365 and protein with PDB id: 2v0h

gi|165761161|pdb|2V0H|A Chain A, Characterization Of Substrate Binding And Catalysis Of The Potential Antibacterial Target N-Acetylglucosamine-1- Phosphate Uridyltransferase (Glmu) Length = 456
>gi|165761163|pdb|2V0I|A Chain A, Characterization Of Substrate Binding And Catalysis Of The Potential Antibacterial Target N-Acetylglucosamine-1- Phosphate Uridyltransferase (Glmu) Length = 456
 Score = 79.5 bits (194), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 5  KKVRKAVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGK 64
          KK   AV   AG G R +     +PK +  I  +P++++VI+ A + G  +   + G G 
Sbjct: 3  KKALSAVILAAGKGTRMY---SDLPKVLHTIAGKPMVKHVIDTAHQLGSENIHLIYGHGG 59

Query: 65 GLIKDY 70
           L++ +
Sbjct: 60 DLMRTH 65