RPSBLAST alignment for GI: 254780365 and conserved domain: cd02507

>gnl|CDD|133001 cd02507, eIF-2B_gamma_N_like, The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity. N-terminal domain of eEIF-2B epsilon and gamma, subunits of eukaryotic translation initiators, is a subfamily of glycosyltranferase 2 and is predicted to have glycosyltranferase activity. eIF-2B is a guanine nucleotide-exchange factor which mediates the exchange of GDP (bound to initiation factor eIF2) for GTP, generating active eIF2.GTP complex. EIF2B is a complex multimeric protein consisting of five subunits named alpha, beta, gamma, delta and epsilon. Subunit epsilon shares sequence similarity with gamma subunit, and with a family of bifunctional nucleotide-binding enzymes such as ADP-glucose pyrophosphorylase, suggesting that epsilon subunit may play roles in nucleotide binding activity. In yeast, eIF2B gamma enhances the activity of eIF2B-epsilon leading to the idea that these subunits form the catalytic subcomplex. Length = 216
 Score = 44.6 bits (106), Expect = 3e-05
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 15 AGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTD-FVFVT 60
           G G RF P++  IPK +L + + P+I Y +E   +AG+ + FV   
Sbjct: 8  DGFGSRFLPLTSDIPKALLPVANVPLIDYTLEWLEKAGVEEVFVVCC 54