Query         gi|254780373|ref|YP_003064786.1| flagellar basal body-associated protein FliL [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 172
No_of_seqs    118 out of 496
Neff          7.8 
Searched_HMMs 33803
Date          Wed Jun  1 12:22:23 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780373.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >3gxq_A Putative regulator of   60.4     6.3 0.00019   18.7   2.5   33  117-150    19-51  (54)
  2 >3bk6_A PH stomatin; archaea,   52.4      15 0.00045   16.6  10.1   72   97-170    28-113 (114)
  3 >1yfz_A Hypoxanthine-guanine p  35.8      15 0.00045   16.6   1.2   12  160-171    31-42  (67)
  4 >2rpb_A Hypothetical membrane   33.8      31 0.00091   15.0   9.3   72   98-171    25-110 (113)
  5 >1win_A Flotillin 2; BAND 7 do  25.5      44  0.0013   14.2  10.0   54  116-171    68-124 (143)
  6 >3lay_A Zinc resistance-associ  21.2      23 0.00069   15.7   0.0   15  119-133    96-110 (175)
  7 >3hd7_B Syntaxin-1A; membrane   21.1      47  0.0014   14.0   1.5   23   15-37     82-104 (109)
  8 >2e84_A High-molecular-weight   18.3      34 0.00099   14.8   0.3   20   12-31      3-22  (91)
  9 >1ygt_A Cytoplasmic dynein lig  15.3      74  0.0022   12.9   5.6   55  114-168    13-69  (111)
 10 >3bwn_A AT1G70560, L-tryptopha  15.0      75  0.0022   12.9   1.5   22   79-100    14-35  (121)

No 1  
>>3gxq_A Putative regulator of transfer genes ARTA; ribbon-helix-helix, plasmid, DNA binding protein/DNA complex; HET: DNA; 2.35A {Staphylococcus aureus subsp} (A:)
Probab=60.41  E-value=6.3  Score=18.74  Aligned_cols=33  Identities=15%  Similarity=0.387  Sum_probs=28.7

Q ss_pred             HHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHH
Q ss_conf             1899999999984189889508899999999999
Q gi|254780373|r  117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIE  150 (172)
Q Consensus       117 ~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~  150 (172)
                      -|.++|.|+.|-.++.++.++ ..|++.|+.-+.
T Consensus        19 dpdmkdeiikyaqekdfdnvs-qagreilkkgle   51 (54)
T 3gxq_A           19 DPDMKDEIIKYAQEKDFDNVS-QAGREILKKGLE   51 (54)
T ss_dssp             CHHHHHHHHHHHHHHSTTCHH-HHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHCCCHHHH-HHHHHHHHHHHH
T ss_conf             874158999988871610588-989999997787


No 2  
>>3bk6_A PH stomatin; archaea, trimer, coiled- coil, flotillin, SPFH, membrane fusion, trafficking, transmembrane, membrane protein; 3.20A {Pyrococcus horikoshii} (A:1-114)
Probab=52.36  E-value=15  Score=16.65  Aligned_cols=72  Identities=6%  Similarity=-0.005  Sum_probs=53.8

Q ss_pred             CEEEEEEEEEEECC--CH---------HHHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHHHHHHC---CCCEE
Q ss_conf             33899999985044--02---------454218999999999841898895088999999999999985423---56312
Q gi|254780373|r   97 KDWLRLDIALICKD--IP---------DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS---QGFVS  162 (172)
Q Consensus        97 ~r~lk~~i~l~~~~--~~---------~e~~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~in~~~---~g~V~  162 (172)
                      +-.+.+++.+.++-  +.         .....+.+++.+-..+++.+.+++-  ..|..+.+++++.++...   +=.|.
T Consensus        28 ~~~v~v~~~v~~ri~d~~~~~~~~~~~~~~l~~~~~~~lr~~~~~~~~~ei~--~~R~~i~~~i~~~l~~~l~~~Gi~i~  105 (114)
T 3bk6_A           28 NVPVRVNAVVYFRVVDPVKAVTQVKNYIMATSQISQTTLRSVIGQAHLDELL--SERDKLNMQLQRIIDEATDPWGIKVT  105 (114)
T ss_dssp             SCEEEEEEEEEEEESCHHHHHHSSSCHHHHHHHHHHHHHHHHHHTSCHHHHH--HCHHHHHHHHHHHHHHHTGGGTEEEE
T ss_pred             CCEEEEEEEEEEEEEECHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH--CCHHHHHHHHHHHHHHHHHHCCCEEE
T ss_conf             9889998999999956354665027788899999999988877630189886--00788878899999887873485899


Q ss_pred             EEEEEEEE
Q ss_conf             57643220
Q gi|254780373|r  163 SVIFRTFI  170 (172)
Q Consensus       163 ~V~Ft~fV  170 (172)
                      +|.+++.-
T Consensus       106 ~v~i~~i~  113 (114)
T 3bk6_A          106 AVEIKDVE  113 (114)
T ss_dssp             EEEEEEEE
T ss_pred             EEEECCCC
T ss_conf             98732569


No 3  
>>1yfz_A Hypoxanthine-guanine phosphoribosyltransferase; protein-nucleotide complex; HET: IMP; 2.20A {Thermoanaerobacter tengcongensis MB4} (A:1-38,A:177-205)
Probab=35.76  E-value=15  Score=16.65  Aligned_cols=12  Identities=8%  Similarity=0.528  Sum_probs=7.4

Q ss_pred             CEEEEEEEEEEC
Q ss_conf             312576432201
Q gi|254780373|r  160 FVSSVIFRTFII  171 (172)
Q Consensus       160 ~V~~V~Ft~fVv  171 (172)
                      .|+++++|+|||
T Consensus        31 ~~~~~~~~EFVV   42 (67)
T 1yfz_A           31 DIEEILITKFVV   42 (67)
T ss_dssp             SEEEEEECSCCB
T ss_pred             HHHHCCCCCCEE
T ss_conf             275444693679


No 4  
>>2rpb_A Hypothetical membrane protein; SPFH domain; NMR {Pyrococcus horikoshii} (A:)
Probab=33.80  E-value=31  Score=14.99  Aligned_cols=72  Identities=10%  Similarity=0.093  Sum_probs=52.2

Q ss_pred             EEEEEEEEEEEC--CCH---------HHHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHHHHHHC---CCCEEE
Q ss_conf             389999998504--402---------454218999999999841898895088999999999999985423---563125
Q gi|254780373|r   98 DWLRLDIALICK--DIP---------DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS---QGFVSS  163 (172)
Q Consensus        98 r~lk~~i~l~~~--~~~---------~e~~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~in~~~---~g~V~~  163 (172)
                      -.+.+++.+.++  ++.         .+...+.+++.+-..++..+.+++-  ..+..+.+++++.++...   +=.|.+
T Consensus        25 ~~v~v~~~v~yrI~d~~~~~~~~~~~~~~l~~~~~~alr~~~~~~~~~el~--~~R~~i~~~i~~~l~~~l~~~Gi~i~~  102 (113)
T 2rpb_A           25 VVVTVDAVVYYQVIDPVKAVYNVSDFLMAIVKLAQTNLRAIIGEMELDETL--SGRDIINARLREELDKITDRWGVKITR  102 (113)
T ss_dssp             CEEEECEEEEEEESCTTTCTTTTTHHHHHHHHHHHHHHHHHHTSCCTTHHH--HCHHHHHHHHHHHHHHHHGGGTEECCC
T ss_pred             CEEEEEEEEEEEECCHHHHHEECCCHHHHHHHHHHHHHHHHHHHCCHHHHH--HHHHHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             999998999999887688721279999999999999999998655399998--259999999999898776026989999


Q ss_pred             EEEEEEEC
Q ss_conf             76432201
Q gi|254780373|r  164 VIFRTFII  171 (172)
Q Consensus       164 V~Ft~fVv  171 (172)
                      |.+++.-.
T Consensus       103 v~I~~i~~  110 (113)
T 2rpb_A          103 VEIQRIDP  110 (113)
T ss_dssp             EEECCCBC
T ss_pred             EEEEEEEC
T ss_conf             99985219


No 5  
>>1win_A Flotillin 2; BAND 7 domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, cell adhesion; NMR {Mus musculus} (A:)
Probab=25.53  E-value=44  Score=14.18  Aligned_cols=54  Identities=19%  Similarity=0.183  Sum_probs=43.4

Q ss_pred             HHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHHHHHH-CC--CCEEEEEEEEEEC
Q ss_conf             21899999999984189889508899999999999998542-35--6312576432201
Q gi|254780373|r  116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQ--GFVSSVIFRTFII  171 (172)
Q Consensus       116 ~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~in~~-~~--g~V~~V~Ft~fVv  171 (172)
                      ..+.+++.+-..++..+.+|+-  ..+..+.+++.++++.. .+  =.|.+|.++++-.
T Consensus        68 l~~~~~~~lr~~~~~~~~~~~~--~~r~~i~~~v~~~l~~~l~~~Gi~i~~v~i~~i~~  124 (143)
T 1win_A           68 VLQTLEGHLRSILGTLTVEQIY--QDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYD  124 (143)
T ss_dssp             HHHHHHHHHHHHHHHSCHHHHH--HTHHHHHHHHHHHHHHHHTTTTEEEEEEECCCEEC
T ss_pred             HHHHHHHHHHHHHCCCCHHHHH--HCHHHHHHHHHHHHHHHHHHHCEEEEEEEEEECCC
T ss_conf             9999999999986216667776--08999999999999999965005888999996388


No 6  
>>3lay_A Zinc resistance-associated protein; salmonella typhimurium LT2, ZRAP, periplasm, structural genomics; 2.70A {Salmonella enterica subsp} (A:)
Probab=21.21  E-value=23  Score=15.66  Aligned_cols=15  Identities=13%  Similarity=0.053  Sum_probs=8.8

Q ss_pred             HHHHHHHHHHHCCCH
Q ss_conf             999999999841898
Q gi|254780373|r  119 TLHQDIMAYIRTVSI  133 (172)
Q Consensus       119 ~Ird~il~~L~~~~~  133 (172)
                      ..+..+...++.-++
T Consensus        96 ~~~~~l~~l~~~~~~  110 (175)
T 3lay_A           96 SKRYEYNALLTASSP  110 (175)
T ss_dssp             HHHHHHHHHHTSSSC
T ss_pred             HHHHHHHHHHCCCCC
T ss_conf             999999999706999


No 7  
>>3hd7_B Syntaxin-1A; membrane protein, coiled-coil, 4-helical bundle, acetylation, cell junction, coiled coil; HET: GGG; 3.40A {Rattus norvegicus} PDB: 3hd9_B 3ipd_B (B:)
Probab=21.05  E-value=47  Score=14.01  Aligned_cols=23  Identities=9%  Similarity=0.114  Sum_probs=8.6

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             32059999999999999999999
Q gi|254780373|r   15 QHKLFVTWFVVYTFIGIFCGWLG   37 (172)
Q Consensus        15 ~~kl~Iii~~vv~ll~~g~g~~~   37 (172)
                      .++++++++++++++++..++++
T Consensus        82 ~r~~~~~~~~~~~~~~l~~~~~i  104 (109)
T 3hd7_B           82 ARRKKIMIIICCVILGIIIASTI  104 (109)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             34199899999999999999999


No 8  
>>2e84_A High-molecular-weight cytochrome C; cytochrome C3 motifs, electron transport; HET: HEM; 2.70A {Desulfovibrio vulgaris str} (A:1-91)
Probab=18.33  E-value=34  Score=14.79  Aligned_cols=20  Identities=5%  Similarity=0.042  Sum_probs=9.3

Q ss_pred             CCCCCHHHHHHHHHHHHHHH
Q ss_conf             67632059999999999999
Q gi|254780373|r   12 RGNQHKLFVTWFVVYTFIGI   31 (172)
Q Consensus        12 kG~~~kl~Iii~~vv~ll~~   31 (172)
                      +|++...|+.|+++++.+++
T Consensus         3 ~~K~~lr~~gil~~~a~v~~   22 (91)
T 2e84_A            3 NAKSLLRWAGALVAVAAVTV   22 (91)
T ss_dssp             --------------------
T ss_pred             CCCHHHHHHHHHHHHHHHHH
T ss_conf             74039999999999999998


No 9  
>>1ygt_A Cytoplasmic dynein light chain; domain swapping, protein transport; 1.70A {Drosophila melanogaster} PDB: 2pg1_E 3fm7_A (A:)
Probab=15.33  E-value=74  Score=12.92  Aligned_cols=55  Identities=7%  Similarity=0.010  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHHHHHHCCCC--EEEEEEEE
Q ss_conf             54218999999999841898895088999999999999985423563--12576432
Q gi|254780373|r  114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF--VSSVIFRT  168 (172)
Q Consensus       114 e~~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~in~~~~g~--V~~V~Ft~  168 (172)
                      +.....|++.+-..|+..+++.-....--..|.++|+++++.+.+..  |-.+++.+
T Consensus        13 ~~v~~ii~~~l~~~L~~~~Y~~~~~~~~~~~I~~~i~~~lk~l~~ryK~vv~~~I~q   69 (111)
T 1ygt_A           13 DDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIVTAMIMQ   69 (111)
T ss_dssp             CHHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHHHHHHHTTCCSEEEEEEEEEEE
T ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEE
T ss_conf             999999999999865788779389999999999999999985289827999999986


No 10 
>>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* (A:1-31,A:302-391)
Probab=15.03  E-value=75  Score=12.87  Aligned_cols=22  Identities=9%  Similarity=0.246  Sum_probs=0.0

Q ss_pred             CCEEECCCCEEEEECCCCCEEE
Q ss_conf             5302103320242058983389
Q gi|254780373|r   79 KLQIFSLQPIITNFDSSPKDWL  100 (172)
Q Consensus        79 ~~~~~~l~~fvvNL~~~~~r~l  100 (172)
                      ....+++-.|+|||.-+.++++
T Consensus        14 ~~~~~~~~~~~~~~~~~~R~~l   35 (121)
T 3bwn_A           14 SNKNIPMSDFVVNLDHGDDAFT   35 (121)
T ss_dssp             ----CCTTTSCEECSSCCSSEE
T ss_pred             HHCCCCCCCCCEECCCCCCCCE
T ss_conf             6078999998178999799921


Done!