RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780373|ref|YP_003064786.1| flagellar basal body-associated protein FliL [Candidatus Liberibacter asiaticus str. psy62] (172 letters) >1ls4_A Apolp-III, apolipophorin-III; helix-bundle, exchangeable apolipoprotein, lipid transport; NMR {Locusta migratoria} (A:) Length = 180 Score = 28.8 bits (63), Expect = 0.41 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 8/58 (13%) Query: 48 QKEEKYQKFI---LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-----DSSPK 97 Q+ EK+Q + LN F N S+H T + Q+ SLQ +TN D + K Sbjct: 80 QEAEKHQGSVAEQLNAFARNLNNSIHDAATSLNLQDQLNSLQSALTNVGHQWQDIATK 137 >1aep_A Apolipophorin III; lipoprotein; 2.70A {Locusta migratoria} (A:) Length = 161 Score = 28.8 bits (63), Expect = 0.45 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 8/58 (13%) Query: 48 QKEEKYQKFI---LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-----DSSPK 97 Q+ EK+Q + LN F N S+H T + Q+ SLQ +TN D + K Sbjct: 61 QEAEKHQGSVAEQLNAFARNLNNSIHDAATSLNLQDQLNSLQSALTNVGHQWQDIATK 118 >2g0d_A Nisin biosynthesis protein NISC; alpha toroid, alpha barrel, biosynthetic protein; 2.21A {Lactococcus lactis subsp} (A:1-131,A:322-409) Length = 219 Score = 27.2 bits (60), Expect = 1.4 Identities = 16/67 (23%), Positives = 25/67 (37%), Gaps = 6/67 (8%) Query: 3 YDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI--LNN 60 Y YI KL ++ G GI + L + +EKY+ + LN Sbjct: 56 YQKKIDNYIEYIVSKLSTYGL---LTGSLYSG-AAGIALSILHLREDDEKYKNLLDSLNR 111 Query: 61 FYDNSVR 67 + + VR Sbjct: 112 YIEYFVR 118 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.328 0.143 0.433 Gapped Lambda K H 0.267 0.0596 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,314,156 Number of extensions: 54499 Number of successful extensions: 151 Number of sequences better than 10.0: 1 Number of HSP's gapped: 151 Number of HSP's successfully gapped: 14 Length of query: 172 Length of database: 4,956,049 Length adjustment: 82 Effective length of query: 90 Effective length of database: 2,184,039 Effective search space: 196563510 Effective search space used: 196563510 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (23.7 bits)