BLAST/PSIBLAST alignment of GI: 254780374 and GI: 315121843 at iteration 1
>gi|315121843|ref|YP_004062332.1| flagellar basal body L-ring protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 239
>gi|313495245|gb|ADR51844.1| flagellar basal body L-ring protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 239
 Score =  364 bits (934), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 181/239 (75%), Positives = 206/239 (86%), Gaps = 1/239 (0%)

Query: 1   MYRYSFIVLCYSSLLFGCH-SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           MYRYS I+LC   LL GCH    SEITG PQMSP+GSSL+++ R+   GIDFKN  +TKK
Sbjct: 1   MYRYSVIILCNILLLAGCHLGRFSEITGSPQMSPIGSSLNQHRRILLSGIDFKNPRATKK 60

Query: 60  SYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
           SYSLWRDS++ LFKDSRALNVGDILTVDI+IDDQAVFDN+TGRSR+NSLH+KLSGGFS+F
Sbjct: 61  SYSLWRDSNSTLFKDSRALNVGDILTVDIKIDDQAVFDNKTGRSRDNSLHKKLSGGFSIF 120

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
           G+ +P M+ + NYDG   S GKGSISRAEKLN+LIAAIVT ILENGNLIISGSQEV VND
Sbjct: 121 GKNSPGMSADANYDGKSTSVGKGSISRAEKLNILIAAIVTEILENGNLIISGSQEVCVND 180

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           E+RSLNV GIVRPQDVDA+N VSYDKIAEARISYGGKG TTELL+ PIG +LI++ SPL
Sbjct: 181 EMRSLNVAGIVRPQDVDANNIVSYDKIAEARISYGGKGTTTELLKTPIGQRLIDSFSPL 239