BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780374|ref|YP_003064787.1| flagellar basal body L-ring
protein [Candidatus Liberibacter asiaticus str. psy62]
         (238 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|299131787|ref|ZP_07024982.1| flagellar L-ring protein [Afipia sp. 1NLS2]
 gi|298591924|gb|EFI52124.1| flagellar L-ring protein [Afipia sp. 1NLS2]
          Length = 249

 Score =  245 bits (624), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 86/234 (36%), Positives = 132/234 (56%), Gaps = 3/234 (1%)

Query: 7   IVLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
            +     L  GC S   ++ +   P++S + +   +    P          ++    SLW
Sbjct: 15  ALAMIGCLAGGCSSLERLANVGEQPKLSSIDNPTTKAGYKPVSMPMPTPQPASYNPNSLW 74

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP 124
           R+   A FKD RA  VGDILT+ + I D+A   N+T RSR+ +    ++  F +      
Sbjct: 75  RNGSRAFFKDQRAHQVGDILTITVNITDKANIANETQRSRSGTEDSNITSFFGVKKVPGT 134

Query: 125 QMNGN-LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
             +GN L  D   ++ GKGSI+R E L   +AA+VT +L NGNL++ G QE+RVN EIR 
Sbjct: 135 NTSGNMLTTDSTSSTDGKGSITRQEALQTNVAAVVTQLLPNGNLVVEGKQEIRVNYEIRE 194

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           L V GIVRP+D+ + N++   KIA+ARI+YGG+G+ T++ +   G Q+++ L P
Sbjct: 195 LVVAGIVRPEDIQSDNTIDSSKIAQARIAYGGRGQITDVQQARYGQQVMDILLP 248


>gi|220924576|ref|YP_002499878.1| flagellar basal body L-ring protein [Methylobacterium nodulans ORS
           2060]
 gi|219949183|gb|ACL59575.1| flagellar L-ring protein [Methylobacterium nodulans ORS 2060]
          Length = 246

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 83/245 (33%), Positives = 133/245 (54%), Gaps = 8/245 (3%)

Query: 1   MYRYSFIVL--CYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDS 56
           M R   + L    +  L  C++   ++ I   P +S +     +    P      +    
Sbjct: 1   MSRPVRLALPTLLALGLSACNTVDRLANIGAQPALSAIEDPTAQAGYKPVRLPMPEVQPV 60

Query: 57  TKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
           +    SLWR    A FKD RA  VGD++TV + + D+A  +N+T RSR+NS    +   F
Sbjct: 61  SYAPNSLWRTGSRAFFKDQRAAKVGDLVTVKVNVTDKANLNNETKRSRSNSESFGIPNAF 120

Query: 117 SLFGQ----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
            L  +         +  L  D   ++ G GSI RAE +   +AAIVT +L NGNL++ G 
Sbjct: 121 GLETKTKLLGGADPDKLLTADSTTSNDGAGSIQRAETVTTNVAAIVTQVLPNGNLVVEGK 180

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           QE+R+N E+R L V G++RP+D+++ N++   KIA+ARI+YGG+G+ T++ +P  G Q +
Sbjct: 181 QEIRINFEVRELIVAGVIRPEDIESDNTIDSAKIAQARIAYGGRGQITDVQQPRYGQQFL 240

Query: 233 ENLSP 237
           + + P
Sbjct: 241 DIMLP 245


>gi|146341906|ref|YP_001206954.1| flagellar basal body L-ring protein [Bradyrhizobium sp. ORS278]
 gi|146194712|emb|CAL78737.1| Flagellar L-ring protein (Basal body L-ring protein)
           [Bradyrhizobium sp. ORS278]
          Length = 259

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 94/245 (38%), Positives = 140/245 (57%), Gaps = 8/245 (3%)

Query: 1   MYRYSFIVLCYSSL--LFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDS 56
           + R + I + ++ L    GC S   +S+I   P+++ + +   +    P      K    
Sbjct: 14  LRRVALISVSFAVLSVAGGCSSIDRLSQIGERPKLTEIDNPTTQPGYKPVQMPMPKPETV 73

Query: 57  TKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
           +    SLWR+   A FKD RA  +GD+LTV + I D+A F N+T RSR N     ++   
Sbjct: 74  SYAPNSLWRNGSRAFFKDQRAHQIGDLLTVTVSISDKANFANETQRSRTNKEDSGITDFI 133

Query: 117 S---LFGQQTPQMNGN-LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
               L  Q    + G  L  DG  +S GKG+I R+E L   +AA+VT +L NGNL++ G 
Sbjct: 134 GSKTLGAQAQKVLPGRILTADGTSSSDGKGTIQRSESLTTSVAAVVTQVLPNGNLVVEGK 193

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           QE+RVN EIR L V GIVRP+D+ + N++   KIA+ARISYGG+G+ T++ +P  G Q++
Sbjct: 194 QEIRVNYEIRELIVAGIVRPEDIQSDNTIDSTKIAQARISYGGRGQITDVQQPRYGQQVM 253

Query: 233 ENLSP 237
           + L P
Sbjct: 254 DILLP 258


>gi|209884524|ref|YP_002288381.1| flagellar L-ring protein FlgH [Oligotropha carboxidovorans OM5]
 gi|226701926|sp|B6JBH5|FLGH_OLICO RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|209872720|gb|ACI92516.1| flagellar L-ring protein FlgH [Oligotropha carboxidovorans OM5]
          Length = 249

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 88/238 (36%), Positives = 133/238 (55%), Gaps = 3/238 (1%)

Query: 3   RYSFIVLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           R +  ++    L  GC S   +S+I   P+++ + +   +    P          ++   
Sbjct: 11  RTAAALVAVGCLASGCSSIERLSQIGEQPKLTAIDNPTTKAGYKPVSMPMPTPQPASYNP 70

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SLWR+   A FKD RA  VGDILTV + I D+A   N+T RSR N+    ++  F +  
Sbjct: 71  NSLWRNGSRAFFKDQRAHQVGDILTVIVNITDKANIANETQRSRANTEDSSITNFFGIKK 130

Query: 121 -QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
              T      L      +S GKGS+ R E L   +AA+VT +L NGNL++ G QE+RVN 
Sbjct: 131 VPGTNGAGNMLTTGSVASSDGKGSVVRQEALQTNVAAVVTQLLPNGNLVVEGKQEIRVNF 190

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           E+R L V GIVRP+D+ + N++   KIA+ARI+YGG+G+ T++ +P  G Q+++ L P
Sbjct: 191 EMRELVVAGIVRPEDIQSDNTIDSSKIAQARIAYGGRGQITDVQQPRYGQQVMDILLP 248


>gi|148256794|ref|YP_001241379.1| flagellar basal body L-ring protein [Bradyrhizobium sp. BTAi1]
 gi|146408967|gb|ABQ37473.1| Flagellar L-ring protein (Basal body L-ring protein)
           [Bradyrhizobium sp. BTAi1]
          Length = 259

 Score =  243 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 138/245 (56%), Gaps = 8/245 (3%)

Query: 1   MYRYSFIVLCYSSL--LFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDS 56
           + R + + + ++ L    GC S   IS+I   P+++ + +   +    P      K    
Sbjct: 14  LRRVALVSVSFAVLSFAGGCSSIDRISQIGERPKLTEIDNPTTQPGYKPVQMPMPKPEVV 73

Query: 57  TKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
           +    SLWR+   A FKD RA  VGD+LTV + I D+A   N+T RSR N     ++   
Sbjct: 74  SYAPNSLWRNGSRAFFKDQRARQVGDLLTVTVSISDKANIANETQRSRTNKEDSGITDFV 133

Query: 117 S---LFGQQTPQMNGN-LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
               L       + G  L  DG  +S GKG+I R+E L   +AA+VT +L NGNL++ G 
Sbjct: 134 GSKTLGATGKNILPGRILTADGTSSSDGKGTIQRSESLTTSVAAVVTQVLPNGNLVVEGK 193

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           QE+RVN EIR L V GIVRP+D+ + N++   KIA+ARISYGG+G+ T++ +P  G Q++
Sbjct: 194 QEIRVNYEIRELIVAGIVRPEDIQSDNTIDSTKIAQARISYGGRGQITDVQQPRYGQQVM 253

Query: 233 ENLSP 237
           + L P
Sbjct: 254 DILLP 258


>gi|90423015|ref|YP_531385.1| flagellar basal body L-ring protein [Rhodopseudomonas palustris
           BisB18]
 gi|90105029|gb|ABD87066.1| flagellar L-ring protein [Rhodopseudomonas palustris BisB18]
          Length = 252

 Score =  241 bits (615), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 87/244 (35%), Positives = 132/244 (54%), Gaps = 8/244 (3%)

Query: 2   YRYSF--IVLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDST 57
            R     ++L +  L  GC S   +S+I   P+++ + +   +    P      K   ++
Sbjct: 8   NRIVLAGLLLAFGGLAGGCSSIDRLSQIGEKPKLAAIENPTAQPGYKPVQMPMPKPEAAS 67

Query: 58  KKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
             + SLWR+   A F+D RA  VGDILTV +   D+A   N+T RSR N     ++    
Sbjct: 68  YNANSLWRNGSRAFFRDQRAHQVGDILTVTVNFTDKANIANETQRSRTNKEDSGITDFAG 127

Query: 118 LFGQQTPQMNGN----LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                           L  D   +S GKGS+ R E L   +AA+VT +L NGNL++ G Q
Sbjct: 128 SKLIGGAASQVMPGRILTADATSSSDGKGSVQRQEALQTSVAAVVTQLLPNGNLVVEGKQ 187

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+RVN EIR L V GIVRP+D+ + N++   KIA+ARI+YGG+G+ +++ +P  G Q+++
Sbjct: 188 EIRVNFEIRELIVAGIVRPEDIQSDNTIDSAKIAQARIAYGGRGQISDVQQPRYGQQVMD 247

Query: 234 NLSP 237
            L P
Sbjct: 248 VLLP 251


>gi|254780374|ref|YP_003064787.1| flagellar basal body L-ring protein [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040051|gb|ACT56847.1| flagellar basal body L-ring protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 238

 Score =  241 bits (615), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 238/238 (100%), Positives = 238/238 (100%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS
Sbjct: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG
Sbjct: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
           QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE
Sbjct: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL
Sbjct: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238


>gi|39936963|ref|NP_949239.1| flagellar basal body L-ring protein [Rhodopseudomonas palustris
           CGA009]
 gi|192292791|ref|YP_001993396.1| flagellar basal body L-ring protein [Rhodopseudomonas palustris
           TIE-1]
 gi|81619648|sp|Q6N2Z5|FLGH_RHOPA RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|226701929|sp|B3QIW5|FLGH_RHOPT RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|39650820|emb|CAE29343.1| putative flagellar L-ring protein FlgH [Rhodopseudomonas palustris
           CGA009]
 gi|192286540|gb|ACF02921.1| flagellar L-ring protein [Rhodopseudomonas palustris TIE-1]
          Length = 252

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 88/237 (37%), Positives = 130/237 (54%), Gaps = 6/237 (2%)

Query: 7   IVLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
            ++    L  GC S   ++ I   P ++P+ +   +    P      K   ++  + SLW
Sbjct: 15  ALMATGGLAGGCSSIDRLAAIGERPALTPIENPTTQPGYKPVQMPMPKPEVASYNANSLW 74

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP 124
           R+   A FKD RA  VGDILTV +   D+A   N+T RSR +     ++         TP
Sbjct: 75  RNGSRAFFKDQRAAKVGDILTVTVNFTDKANIANETQRSRTSKEDSGITDFIGSKTITTP 134

Query: 125 Q----MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                    L  D   +S GKGS+ R E L   +AA+VT +L NGNL++ G QE+RVN E
Sbjct: 135 ATAVLPGRILTTDSTSSSDGKGSVQRQEALQTNVAAVVTQVLPNGNLVVEGKQEIRVNFE 194

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           IR L V GIVRP+D+ + N++   KIA+ARI+YGG+G+ T++ +P  G Q+++ L P
Sbjct: 195 IRELIVAGIVRPEDIQSDNTIDSSKIAQARIAYGGRGQITDVQQPRYGQQVMDVLLP 251


>gi|91976159|ref|YP_568818.1| flagellar basal body L-ring protein [Rhodopseudomonas palustris
           BisB5]
 gi|91682615|gb|ABE38917.1| flagellar L-ring protein [Rhodopseudomonas palustris BisB5]
          Length = 252

 Score =  238 bits (608), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 87/244 (35%), Positives = 131/244 (53%), Gaps = 8/244 (3%)

Query: 2   YRYSFI--VLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDST 57
            R   I  +L    L  GC S   ++ I   P +S + +   +    P      K   ++
Sbjct: 8   NRIVLITALLATGGLAGGCSSIDRLASIGERPALSAIENPTTQPGYKPVQMPMPKPEVAS 67

Query: 58  KKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
             + SLWR+   A F+D RA  VGDI+TV +   D+A   NQT RSR++S    ++    
Sbjct: 68  YNANSLWRNGSRAFFRDQRAAKVGDIMTVTVNFTDKANIANQTQRSRSSSEDSGITDFAG 127

Query: 118 LFGQQTPQM----NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                           L+ D    + GKGS+ R E L   +AA+VT +L NGNL++ G Q
Sbjct: 128 SKLLTGNAAQVLPGRLLSTDSTSTADGKGSVQRQEALQTSVAAVVTQVLPNGNLVVEGKQ 187

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+RVN E+R L V GIVRP+D+ + N++   KIA+ARI+YGG+G+ T++ +P  G Q+++
Sbjct: 188 EIRVNFEVRELIVAGIVRPEDIQSDNTIDSSKIAQARIAYGGRGQITDVQQPRYGQQVMD 247

Query: 234 NLSP 237
            L P
Sbjct: 248 VLLP 251


>gi|170742323|ref|YP_001770978.1| flagellar basal body L-ring protein [Methylobacterium sp. 4-46]
 gi|168196597|gb|ACA18544.1| flagellar L-ring protein [Methylobacterium sp. 4-46]
          Length = 246

 Score =  238 bits (608), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 83/241 (34%), Positives = 130/241 (53%), Gaps = 7/241 (2%)

Query: 3   RYSFIVLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           R +   L   + L  C++   +S+I   P +S +     +    P      +    +   
Sbjct: 6   RLALACL-LGAGLSACNTVDRLSQIGARPPLSAIEDPTAQAGYKPVRLPMPEVQPVSYAP 64

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SLWR    A FKD RA  VGD++TV + + D+A  +N+T RSR N+    +   F L  
Sbjct: 65  NSLWRTGSRAFFKDQRAAKVGDLVTVKVNVTDKANLNNETKRSRANTEAFGVPNAFGLEK 124

Query: 121 Q----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                        L+     ++ G GSI RAE +   +AAIVT +L NGNL++ G QE+R
Sbjct: 125 SAKLIGAADPKNLLDTASTMSNDGAGSIQRAETVTTNVAAIVTQVLPNGNLVVEGKQEIR 184

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN E+R L V G++RP+D+++ N++   KIAEARI+YGG+G+ T++ +P  G Q ++ + 
Sbjct: 185 VNFEVRELVVAGVIRPEDIESDNTIDSAKIAEARIAYGGRGQITDVQQPRYGQQFLDVML 244

Query: 237 P 237
           P
Sbjct: 245 P 245


>gi|209964692|ref|YP_002297607.1| flagellar L-ring protein FlgH [Rhodospirillum centenum SW]
 gi|209958158|gb|ACI98794.1| flagellar L-ring protein FlgH [Rhodospirillum centenum SW]
          Length = 259

 Score =  238 bits (608), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 86/244 (35%), Positives = 138/244 (56%), Gaps = 10/244 (4%)

Query: 4   YSFIVLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
              ++    SLL  C S   ++ +   P ++P+ +        P        +   +++ 
Sbjct: 15  KVLVLAAAVSLLSACSSMDRLASVGQTPPLTPIQNPATAPGYQPVSLPMPAPAQGEREAN 74

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLWR    A F+D RA  VGDILT+ I+I+D+A   NQ+ R+RN   +  + G F L   
Sbjct: 75  SLWRAGARAFFRDQRANRVGDILTITIQINDKAQIQNQSQRTRNGKENMGIPGLFGLQRN 134

Query: 122 QTPQMNGNLN--------YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
               +    N             +S G GSI R+E++N+ +AA++T +L NGNL++ G Q
Sbjct: 135 IARVLPTPDNDTLESLVKTTADSSSVGTGSIGRSEQINMQVAALITQVLPNGNLVVQGKQ 194

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           EVRVN E+R L + GI+RP+D+ + N++SY+KIAEARISYGG+G  +++ +P  G Q+ +
Sbjct: 195 EVRVNYEVRELTINGIIRPEDITSQNTISYEKIAEARISYGGRGHISDVQQPRWGQQVFD 254

Query: 234 NLSP 237
            ++P
Sbjct: 255 IVAP 258


>gi|150395489|ref|YP_001325956.1| flagellar basal body L-ring protein [Sinorhizobium medicae WSM419]
 gi|166214829|sp|A6U641|FLGH_SINMW RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|150027004|gb|ABR59121.1| flagellar L-ring protein [Sinorhizobium medicae WSM419]
          Length = 236

 Score =  238 bits (607), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 125/238 (52%), Positives = 157/238 (65%), Gaps = 3/238 (1%)

Query: 2   YRYSFIVLCYSSLLFGCHSS-ISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
            R     +  + LL GC +   +EI   P MSP+GS L +  + P L +  K        
Sbjct: 1   MRMRITAILAAGLLAGCQNQAFNEIGRAPAMSPIGSGL-QYTQTPQLAMYPKQPRHVTNG 59

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           YSLW D  AALFKD+RA+N+GDILTVDIRIDD+A F+N+T RSR NS    L G      
Sbjct: 60  YSLWNDQQAALFKDARAINIGDILTVDIRIDDKASFENETDRSRKNSSGFNL-GASGESQ 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                 +G+L Y     + G G   R+EKL LL+AA+VT +LENGNL+ISGSQEVRVN E
Sbjct: 119 TSDFAWSGDLEYGSNTKTEGDGKTERSEKLRLLVAAVVTGVLENGNLLISGSQEVRVNHE 178

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +R LNV GIVRP+DVDA N +SYD+IAEARISYGG+GR TE+ +PP G QL++ +SPL
Sbjct: 179 LRILNVAGIVRPRDVDADNVISYDRIAEARISYGGRGRLTEVQQPPWGQQLVDLVSPL 236


>gi|12057225|gb|AAB81417.2| FlgH [Sinorhizobium meliloti]
          Length = 236

 Score =  237 bits (605), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 125/238 (52%), Positives = 157/238 (65%), Gaps = 3/238 (1%)

Query: 2   YRYSFIVLCYSSLLFGCHSS-ISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
            R     +  + LL GC +   +EI   P MSP+GS L +  + P L +  K        
Sbjct: 1   MRTRITAVLAAGLLAGCQNQAFNEIGRAPAMSPIGSGL-QYTQTPQLAMYPKQPRHVTNG 59

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           YSLW D  AALFKD+RA+N+GDILTVDIRIDD+A F+N+T RSR NS    L G      
Sbjct: 60  YSLWNDQQAALFKDARAINIGDILTVDIRIDDKASFENETDRSRTNSSGFNL-GASGQSQ 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                 +G+L Y     + G G   R+EKL LL+AA+VT +LENGNL+ISGSQEVRVN E
Sbjct: 119 TSDFAWSGDLEYGSNTKTEGDGKTERSEKLRLLVAAVVTGVLENGNLLISGSQEVRVNHE 178

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +R LNV GIVRP+DVDA N +SYD+IAEARISYGG+GR TE+ +PP G QL++ +SPL
Sbjct: 179 LRILNVAGIVRPRDVDADNVISYDRIAEARISYGGRGRLTEVQQPPWGQQLVDLVSPL 236


>gi|86750898|ref|YP_487394.1| flagellar basal body L-ring protein [Rhodopseudomonas palustris
           HaA2]
 gi|86573926|gb|ABD08483.1| Flagellar L-ring protein [Rhodopseudomonas palustris HaA2]
          Length = 252

 Score =  237 bits (605), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 135/244 (55%), Gaps = 8/244 (3%)

Query: 2   YRYSFI--VLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDST 57
            R   I  +L    L  GC S   ++ I   P +S + +   +    P      K   ++
Sbjct: 8   NRIVLITALLATGGLAGGCSSIDRLAAIGEKPALSAIENPTTQPGYKPVQMPMPKPEVAS 67

Query: 58  KKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
             + SLWR+   A F+D RA  VGDI+TV +   D+A   N+T RSR+ S    ++    
Sbjct: 68  YNANSLWRNGSRAFFRDQRAAKVGDIMTVTVNFTDKAAIANETKRSRSGSEDSGITDFAG 127

Query: 118 ---LFGQQTPQMNGN-LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
              L G     + G  L  D   +S GKG++ R EKL   +AA+VT +L NGNL++ G Q
Sbjct: 128 SKLLTGDAAQVLPGRILTTDSSSSSGGKGTVDRQEKLQTSVAAVVTQVLPNGNLVVEGKQ 187

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+RVN E+R L V GIVRP+D+ + N++   KIA+ARI+YGG+G+ T++ +P  G Q+++
Sbjct: 188 EIRVNFEVRELIVAGIVRPEDIQSDNTIDSSKIAQARIAYGGRGQITDVQQPRYGQQVMD 247

Query: 234 NLSP 237
            L P
Sbjct: 248 VLLP 251


>gi|15964419|ref|NP_384772.1| flagellar basal body L-ring protein [Sinorhizobium meliloti 1021]
 gi|307311561|ref|ZP_07591202.1| flagellar L-ring protein [Sinorhizobium meliloti BL225C]
 gi|17380483|sp|Q52950|FLGH_RHIME RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|15073596|emb|CAC45238.1| Flagellar L-ring protein precursor (basal body L-ring protein)
           [Sinorhizobium meliloti 1021]
 gi|306899578|gb|EFN30207.1| flagellar L-ring protein [Sinorhizobium meliloti BL225C]
          Length = 236

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 125/238 (52%), Positives = 157/238 (65%), Gaps = 3/238 (1%)

Query: 2   YRYSFIVLCYSSLLFGCHSS-ISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
            R     +  + LL GC +   +EI   P MSP+GS L +  + P L +  K        
Sbjct: 1   MRTRITAVLAAGLLAGCQNQAFNEIGRAPAMSPIGSGL-QYTQTPQLAMYPKQPRHVTNG 59

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           YSLW D  AALFKD+RA+N+GDILTVDIRIDD+A F+N+T RSR NS    L G      
Sbjct: 60  YSLWNDQQAALFKDARAINIGDILTVDIRIDDKASFENETDRSRKNSSGFNL-GASGQSQ 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                 +G+L Y     + G G   R+EKL LL+AA+VT +LENGNL+ISGSQEVRVN E
Sbjct: 119 TSDFAWSGDLEYGSNTKTEGDGKTERSEKLRLLVAAVVTGVLENGNLLISGSQEVRVNHE 178

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +R LNV GIVRP+DVDA N +SYD+IAEARISYGG+GR TE+ +PP G QL++ +SPL
Sbjct: 179 LRILNVAGIVRPRDVDADNVISYDRIAEARISYGGRGRLTEVQQPPWGQQLVDLVSPL 236


>gi|316932821|ref|YP_004107803.1| flagellar L-ring protein [Rhodopseudomonas palustris DX-1]
 gi|315600535|gb|ADU43070.1| flagellar L-ring protein [Rhodopseudomonas palustris DX-1]
          Length = 252

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 90/243 (37%), Positives = 134/243 (55%), Gaps = 8/243 (3%)

Query: 3   RYSFIVLCYSS--LLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
           R   I    ++  L  GC S   ++ I   P ++P+ +   +    P      K   ++ 
Sbjct: 9   RIVLIAALMATGGLAGGCSSIDRLAAIGERPALTPIENPTTQPGYKPVQMPMPKPEVASY 68

Query: 59  KSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS- 117
            + SLWR+   A FKD RA  VGDILTV +   D+A   NQT RSR++     ++     
Sbjct: 69  NANSLWRNGSRAFFKDQRAAKVGDILTVTVNFTDKANIANQTQRSRSSKEDSGVTDFIGS 128

Query: 118 --LFGQQTPQMNGN-LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
             +    T  + G  L  D   ++ GKGS+ R E L   +AA+VT +L NGNL++ G QE
Sbjct: 129 KTITNTATAVLPGRILTTDSTSSTDGKGSVQRQEALQTTVAAVVTQVLPNGNLVVEGKQE 188

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           +RVN EIR L V GIVRP+D+ + N +   KIA+ARI+YGG+G+ T++ +P  G Q+++ 
Sbjct: 189 IRVNFEIRELIVAGIVRPEDIQSDNIIDSSKIAQARIAYGGRGQITDVQQPRYGQQVMDV 248

Query: 235 LSP 237
           L P
Sbjct: 249 LLP 251


>gi|307318916|ref|ZP_07598347.1| flagellar L-ring protein [Sinorhizobium meliloti AK83]
 gi|306895330|gb|EFN26085.1| flagellar L-ring protein [Sinorhizobium meliloti AK83]
          Length = 236

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 124/238 (52%), Positives = 157/238 (65%), Gaps = 3/238 (1%)

Query: 2   YRYSFIVLCYSSLLFGCHSS-ISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
            R     +  + LL GC +   +EI   P MSP+GS L +  + P L +  K        
Sbjct: 1   MRTRITAVLAAGLLAGCQNQAFNEIGRAPAMSPIGSGL-QYTQTPQLAMYPKQPRHVTNG 59

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           YSLW D  AALFKD+RA+N+GDILTVDIRIDD+A F+N+T RSR NS    L G      
Sbjct: 60  YSLWNDQQAALFKDARAINIGDILTVDIRIDDKASFENETDRSRKNSSGFNL-GASGQSQ 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                 +G+L Y     + G G   R+EKL LL+AA+VT +LENGNL+ISGSQEVRVN E
Sbjct: 119 TSDFAWSGDLEYGSNTKTEGDGKTERSEKLRLLVAAVVTGVLENGNLLISGSQEVRVNHE 178

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +R LNV GIVRP+DVDA N +SYD+IAEARISYGG+GR TE+ +PP G Q+++ +SPL
Sbjct: 179 LRILNVAGIVRPRDVDADNVISYDRIAEARISYGGRGRLTEVQQPPWGQQIVDLVSPL 236


>gi|46203669|ref|ZP_00209069.1| COG2063: Flagellar basal body L-ring protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 247

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 83/240 (34%), Positives = 130/240 (54%), Gaps = 7/240 (2%)

Query: 5   SFIVLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
              V+   + L  C++   +S++   P +S +     +    P           +    S
Sbjct: 7   RLAVILALAPLGACNTVDRLSQVGATPTLSAIEDPTAQPGYRPVRMAMPDIQPVSYAPNS 66

Query: 63  LWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF--- 119
           LWR    A FKD RA  +GD+LTV + + D+A  +N+T RSR N+    L   F L    
Sbjct: 67  LWRTGSRAFFKDQRAARIGDLLTVKVNVTDKANLNNETKRSRTNAEGFGLPNAFGLEKNA 126

Query: 120 --GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                    +  LN     +S G GS+ RAE +   +AA+VT +L NGNL++ G QE+R+
Sbjct: 127 GVAAAGISADKLLNGTSTSSSDGAGSVQRAETVTTNVAAVVTQVLPNGNLVVEGKQEIRI 186

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N E+R L V G+VRP+D+++ N++   KIA+ARI+YGG+G+ T++ +P  G QL++ L P
Sbjct: 187 NFEVRELIVAGVVRPEDIESDNTIDSTKIAQARIAYGGRGQITDVQQPRYGQQLVDILLP 246


>gi|307945668|ref|ZP_07661004.1| flagellar L-ring protein FlgH [Roseibium sp. TrichSKD4]
 gi|307771541|gb|EFO30766.1| flagellar L-ring protein FlgH [Roseibium sp. TrichSKD4]
          Length = 250

 Score =  236 bits (601), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 86/244 (35%), Positives = 133/244 (54%), Gaps = 8/244 (3%)

Query: 1   MYRYSFIVLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
           + R S  VL  + +L  C +   +S++   P ++ +          P      +   +  
Sbjct: 7   LTRLSLCVLTAT-MLTACGTADKLSQVGKAPALNAIQDPTTTPGYRPVQMPMPEPQQAHY 65

Query: 59  KSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS- 117
              SLWR  + A F+D RA  VGDILTV + I D+A  DN+T R R ++ +    G    
Sbjct: 66  SPNSLWRSGNRAFFEDQRANQVGDILTVLVTIADKAEIDNKTERKREDTSNTGAGGVLGS 125

Query: 118 ----LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                        +   + +     SG+GS+ R EKL   +AA+VT +L NGN++I G Q
Sbjct: 126 QIEQWVLPDAASASALASINSSTDFSGEGSVDREEKLQTTVAAVVTQVLPNGNMVIEGRQ 185

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           EVRVN E+R L V GIVRP+D+ ++N+++ +KIAEARI YGG+G+ T++ +P  G Q+++
Sbjct: 186 EVRVNFEVRELIVAGIVRPEDIASNNTIASEKIAEARIGYGGRGQITDVQQPRYGSQVMD 245

Query: 234 NLSP 237
            L P
Sbjct: 246 ILLP 249


>gi|92116934|ref|YP_576663.1| flagellar basal body L-ring protein [Nitrobacter hamburgensis X14]
 gi|91799828|gb|ABE62203.1| flagellar L-ring protein [Nitrobacter hamburgensis X14]
          Length = 252

 Score =  236 bits (601), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 135/244 (55%), Gaps = 8/244 (3%)

Query: 2   YRYSFI--VLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDST 57
            R      +L  + L  GC S   +S+I   P+++ + +   +    P      K   ++
Sbjct: 8   NRIVLTGTLLAAAGLASGCSSIDRLSQIGERPKLTAIDNPTTQPGYKPVQMPMPKPELAS 67

Query: 58  KKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
             + SLWR+   A FKD RA  VGD+LTV +   D+A   N+T RSR N     ++    
Sbjct: 68  YNANSLWRNGSRAFFKDQRAARVGDLLTVTVNFTDKANIANETQRSRTNKEDSGITDFIG 127

Query: 118 ---LFGQQTPQMNGN-LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
              +    T  + G  L  D   +S GKGS+ R E L   +AA+VT +L NGNL++ G Q
Sbjct: 128 SKVIKNPATAVLPGRILTADSTASSDGKGSVQRQENLQTSVAAVVTQVLPNGNLVVEGKQ 187

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+RVN EIR L V GIVRP+D+ + N++   KIA+ARISYGG+G+ +++ +P  G Q+++
Sbjct: 188 EIRVNLEIRELIVAGIVRPEDIQSDNTIDSSKIAQARISYGGRGQISDVQQPRYGQQVMD 247

Query: 234 NLSP 237
            L P
Sbjct: 248 VLLP 251


>gi|75675312|ref|YP_317733.1| flagellar basal body L-ring protein [Nitrobacter winogradskyi
           Nb-255]
 gi|110816533|sp|Q3STL0|FLGH_NITWN RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|74420182|gb|ABA04381.1| flagellar L-ring protein [Nitrobacter winogradskyi Nb-255]
          Length = 252

 Score =  235 bits (600), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 88/245 (35%), Positives = 132/245 (53%), Gaps = 8/245 (3%)

Query: 1   MYRYSFI--VLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDS 56
           + R      +L  + L  GC S   +S+I   P+++ + +   +    P      K    
Sbjct: 7   LNRIVLTGTLLAAAGLASGCSSIDRLSQIGESPKLTAIDNPTTQPGYKPVQMPMPKPETV 66

Query: 57  TKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
           +  + SLWR+   A F+D RA  VGD+LTV +   D+A   NQT RSR +     ++   
Sbjct: 67  SYNANSLWRNGSRAFFRDQRAARVGDLLTVTVNFTDRANIANQTQRSRVSKDDSGIADFA 126

Query: 117 S---LFGQQTPQMNGNL-NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
               L G     + G L   D    S GKG + R E L   +A +VT +L NGNL++ G 
Sbjct: 127 GSKLLGGTAQKVLPGRLLTTDSESLSDGKGLVQRQENLQTSVATVVTQVLPNGNLVVEGK 186

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           QE+RVN EIR L V GIVRP+D+ + N++   KIA+ARI+YGG+G+ T++ +P  G Q++
Sbjct: 187 QEIRVNFEIRELIVAGIVRPEDIQSDNTIDSSKIAQARIAYGGRGQITDVQQPRYGQQVM 246

Query: 233 ENLSP 237
           + L P
Sbjct: 247 DVLLP 251


>gi|188582484|ref|YP_001925929.1| flagellar basal body L-ring protein [Methylobacterium populi BJ001]
 gi|179345982|gb|ACB81394.1| flagellar L-ring protein [Methylobacterium populi BJ001]
          Length = 250

 Score =  235 bits (599), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 83/240 (34%), Positives = 131/240 (54%), Gaps = 7/240 (2%)

Query: 5   SFIVLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
              V+   + L  C++   +S++   P +S +     +    P        +  +    S
Sbjct: 10  RLAVILALAPLGACNTVDRLSQVGATPTLSAIEDPTAQPGYRPVRMAMPDVAPVSYAPNS 69

Query: 63  LWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ 122
           LWR    A FKD RA  +GD+LTV + + D+A  +N+T RSR N+    L   F L    
Sbjct: 70  LWRTGSRAFFKDQRAARIGDLLTVKVNVTDRANLNNETKRSRTNAEGFGLPNAFGLENSA 129

Query: 123 TPQMNG-----NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                G      +N     +S G GS+ RAE +   +AA+VT +L NGNL++ G QE+R+
Sbjct: 130 GVAAAGISPDKLINGTSTSSSDGAGSVQRAETVTTSVAAVVTQVLPNGNLVVEGKQEIRI 189

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N E+R L V G+VRP+D+++ N++   KIA+ARI+YGG+G+ T++ +P  G QL++ L P
Sbjct: 190 NFEVRELIVAGVVRPEDIESDNTIDSTKIAQARIAYGGRGQITDVQQPRYGQQLVDILLP 249


>gi|227820862|ref|YP_002824832.1| flagellar basal body L-ring protein [Sinorhizobium fredii NGR234]
 gi|254789283|sp|C3MG28|FLGH_RHISN RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|227339861|gb|ACP24079.1| flagellar L-ring protein precursor (basal body L-ring protein) FlgH
           [Sinorhizobium fredii NGR234]
          Length = 236

 Score =  234 bits (596), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 124/238 (52%), Positives = 156/238 (65%), Gaps = 3/238 (1%)

Query: 2   YRYSFIVLCYSSLLFGCHSS-ISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
            R     +  +SLL GC +    EI   P MSP+GS L +  + P L    K        
Sbjct: 1   MRMQLTAVLAASLLAGCQNQAFREIGQAPSMSPIGSGL-QYTQAPQLAAYPKQPHQMTAG 59

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           YSLW D  AALFKD+RA+NVGDILTVDI+IDD+A F+N+T RSR NS    L G      
Sbjct: 60  YSLWNDQQAALFKDARAINVGDILTVDIQIDDKASFNNETDRSRTNSSGFNL-GASGESQ 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
               + +GNL Y     + G G   R+EKL LL+AA+VT +LENGNL+ISGSQEVRVN E
Sbjct: 119 TSDFEWSGNLKYGSNIKTEGDGKTERSEKLRLLVAAVVTGVLENGNLLISGSQEVRVNHE 178

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +R LNV GIVRP+DVDA N +SYD+IAEARISYGG+GR  E+ +PP G Q+++ +SP+
Sbjct: 179 LRILNVAGIVRPRDVDADNIISYDRIAEARISYGGRGRLMEVQQPPWGQQVVDLVSPI 236


>gi|328543154|ref|YP_004303263.1| flagellar L-ring protein FlgH [polymorphum gilvum SL003B-26A1]
 gi|326412900|gb|ADZ69963.1| Flagellar L-ring protein FlgH [Polymorphum gilvum SL003B-26A1]
          Length = 248

 Score =  234 bits (596), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 85/247 (34%), Positives = 129/247 (52%), Gaps = 10/247 (4%)

Query: 1   MYRYS---FIVLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSD 55
           M R      +    + L+  C +   +S++   P ++ +          P          
Sbjct: 1   MTRPLATPLMATAIAFLVGACGAPDRLSQVGRTPPLNAIQDPTTTPGYRPVQMPMPAPQP 60

Query: 56  STKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG 115
           +     SLW+  + A F+D RA  +GDILTV + I D+A FDNQT R+R+ S      G 
Sbjct: 61  AHYNPNSLWKSGNRAFFEDQRAKQIGDILTVMVTISDKAQFDNQTKRARSGSDSTGAGGA 120

Query: 116 FS-----LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
                  +F       +     +      G GS+ R EKL   +AA+VT +L NGNL+I 
Sbjct: 121 LGAAIDKIFLPAGMDASSLATLNSSSNYQGSGSVDREEKLQTTVAAVVTQVLPNGNLVIE 180

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ 230
           G QE+RVN E+R L V GIVRP+D+ + N+++ +KIAEARI YGG+G+ T++ +P  G Q
Sbjct: 181 GRQEIRVNFEVRELVVAGIVRPEDIASDNTIASEKIAEARIGYGGRGQITDVQQPRYGTQ 240

Query: 231 LIENLSP 237
           +++ L P
Sbjct: 241 VLDILLP 247


>gi|218531218|ref|YP_002422034.1| flagellar basal body L-ring protein [Methylobacterium
           chloromethanicum CM4]
 gi|218523521|gb|ACK84106.1| flagellar L-ring protein [Methylobacterium chloromethanicum CM4]
          Length = 250

 Score =  234 bits (596), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 83/240 (34%), Positives = 131/240 (54%), Gaps = 7/240 (2%)

Query: 5   SFIVLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
              V+   + L  C++   +S++   P +S +     +    P        S  +    S
Sbjct: 10  RLAVILALAPLGACNTVDRLSQVGATPTLSAIEDPTAQPGYRPVRMAMPDTSPVSYAPNS 69

Query: 63  LWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ 122
           LWR    A FKD RA  +GD+LT+ + + D+A  +N+T RSR N+    L   F L    
Sbjct: 70  LWRTGSRAFFKDQRAARIGDLLTIKVNVTDRANLNNETKRSRTNAEGFGLPNAFGLENSA 129

Query: 123 TPQMNG-----NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                G      +N     +S G GS+ RAE +   +AA+VT +L NGNL++ G QE+R+
Sbjct: 130 GVAAAGIAPDKLINGTSTSSSDGAGSVQRAETVTTNVAAVVTQVLPNGNLVVEGKQEIRI 189

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N E+R L V G+VRP+D+++ N++   KIA+ARI+YGG+G+ T++ +P  G QL++ L P
Sbjct: 190 NFEVRELIVAGVVRPEDIESDNTIDSSKIAQARIAYGGRGQITDVQQPRYGQQLVDILLP 249


>gi|163852462|ref|YP_001640505.1| flagellar basal body L-ring protein [Methylobacterium extorquens
           PA1]
 gi|240139799|ref|YP_002964276.1| Flagellar L-ring protein precursor (Basal body L-ring protein)
           [Methylobacterium extorquens AM1]
 gi|254562214|ref|YP_003069309.1| flagellar L-ring protein [Methylobacterium extorquens DM4]
 gi|163664067|gb|ABY31434.1| flagellar L-ring protein [Methylobacterium extorquens PA1]
 gi|240009773|gb|ACS40999.1| Flagellar L-ring protein precursor (Basal body L-ring protein)
           [Methylobacterium extorquens AM1]
 gi|254269492|emb|CAX25458.1| Flagellar L-ring protein precursor (Basal body L-ring protein)
           [Methylobacterium extorquens DM4]
          Length = 250

 Score =  234 bits (596), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 83/240 (34%), Positives = 131/240 (54%), Gaps = 7/240 (2%)

Query: 5   SFIVLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
              V+   + L  C++   +S++   P +S +     +    P        S  +    S
Sbjct: 10  RLAVILALAPLGACNTVDRLSQVGATPTLSAIEDPTAQPGYRPVRMAMPDTSPVSYAPNS 69

Query: 63  LWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ 122
           LWR    A FKD RA  +GD+LT+ + + D+A  +N+T RSR N+    L   F L    
Sbjct: 70  LWRTGSRAFFKDQRAARIGDLLTIKVNVTDRANLNNETKRSRTNAEGFGLPNAFGLENSA 129

Query: 123 TPQMNG-----NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                G      +N     +S G GS+ RAE +   +AA+VT +L NGNL++ G QE+R+
Sbjct: 130 GVAAAGIAPDKLINGTSTSSSDGAGSVQRAETVTTNVAAVVTQVLPNGNLVVEGKQEIRI 189

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N E+R L V G+VRP+D+++ N++   KIA+ARI+YGG+G+ T++ +P  G QL++ L P
Sbjct: 190 NFEVRELIVAGVVRPEDIESDNTIDSSKIAQARIAYGGRGQITDVQQPRYGQQLVDILLP 249


>gi|288958677|ref|YP_003449018.1| flagellar L-ring protein precursor [Azospirillum sp. B510]
 gi|288910985|dbj|BAI72474.1| flagellar L-ring protein precursor [Azospirillum sp. B510]
          Length = 255

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 94/245 (38%), Positives = 137/245 (55%), Gaps = 8/245 (3%)

Query: 1   MYRYSFIVLCYSSL-LFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           + R++ I    +SL   G  S I++I   P+MS +     +    P          + + 
Sbjct: 10  LIRFAMIATAATSLTACGAASRIADIGKAPEMSNIQDPQAKPGYQPVSLPMPTPLPTERN 69

Query: 60  SYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
             SLWR    A FKD RA  VGDILT++I I DQA   N++ R+R N+    +   F + 
Sbjct: 70  PNSLWRTGAKAFFKDQRAGKVGDILTINISIADQAKLSNESKRARANTEKAGIPNLFGME 129

Query: 120 GQQTP-------QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
           G                +N +    + GKGS+ R EK+ L +AA+VT  L NGNL+I G 
Sbjct: 130 GDTLNRILPTGASATNLVNMNSNTNNDGKGSVDRNEKIELKVAALVTQTLPNGNLVIQGR 189

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           QEVRVN E+R L + G++RP+D+ A N++SY+KIAEARISYGG+G+ T++ +P  G QL 
Sbjct: 190 QEVRVNYELRDLQIHGVIRPEDITAQNTISYEKIAEARISYGGRGQITDVQQPRYGQQLY 249

Query: 233 ENLSP 237
           + + P
Sbjct: 250 DIIMP 254


>gi|118588713|ref|ZP_01546121.1| flagellar L-ring protein precursor H [Stappia aggregata IAM 12614]
 gi|118438699|gb|EAV45332.1| flagellar L-ring protein precursor H [Stappia aggregata IAM 12614]
          Length = 249

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 86/242 (35%), Positives = 133/242 (54%), Gaps = 7/242 (2%)

Query: 3   RYSFIVLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           R+    +  S+L  GC +   ++ +   P ++ +          P      +   +    
Sbjct: 7   RHLLASIALSTLAAGCGTADKLANVGQQPALNAIQDPTTTPGYRPVQMPMPEPQQAHYNP 66

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS--- 117
            SLW+    A FKD RA  VGDILTV + IDDQA  +N+T R R+ S    + G      
Sbjct: 67  NSLWQSGSRAFFKDQRASQVGDILTVVVTIDDQAEIENKTERKRSESSGAGVGGALGTAI 126

Query: 118 --LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
             +F   +   +   N +   + SG GS+ R E L   +AA+VT +L NGN++I G QEV
Sbjct: 127 DTIFLPASSAASDLANVNSDSSFSGDGSVDRNETLQTTVAAVVTQVLPNGNMVIEGRQEV 186

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
           RVN E+R L V GIVRP+D+ + N ++ ++IAEARI YGG+G+ T++ +P +G+Q+++ L
Sbjct: 187 RVNFEVRELIVAGIVRPEDITSDNRIASEQIAEARIGYGGRGQITDVQQPRVGNQVLDIL 246

Query: 236 SP 237
            P
Sbjct: 247 LP 248


>gi|27380941|ref|NP_772470.1| flagellar basal body L-ring protein [Bradyrhizobium japonicum USDA
           110]
 gi|81736030|sp|Q89I09|FLGH1_BRAJA RecName: Full=Flagellar L-ring protein 1; AltName: Full=Basal body
           L-ring protein 1; Flags: Precursor
 gi|27354107|dbj|BAC51095.1| flagellar L-ring protein precursor [Bradyrhizobium japonicum USDA
           110]
          Length = 254

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 84/227 (37%), Positives = 125/227 (55%), Gaps = 5/227 (2%)

Query: 16  FGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFK 73
            GC S   +S+I   P++S + +   +    P      K   ++    SLWR    A FK
Sbjct: 27  SGCSSIDRLSQIGEQPKLSAIDNPTAQPGYKPVQMPMPKPEVASYNPNSLWRSGSRAFFK 86

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ---MNGNL 130
           D RA  +GD+LTV + I D+A   N+T RSR       ++          P        L
Sbjct: 87  DQRAHQIGDLLTVTVNITDKANIANETQRSRTAKEDSGITDFIGSQTVTQPLKVLPGRLL 146

Query: 131 NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIV 190
             D   ++ GKGS++R E L   +AA+VT +L NGNL++ G QE+RVN EIR L V GIV
Sbjct: 147 TTDSTSSADGKGSVNRQEALQTNVAAVVTQVLPNGNLVVEGKQEIRVNYEIRELVVAGIV 206

Query: 191 RPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           RP+D+ + N++   KIA+ARI+YGG+G+  ++ +P  G Q+++ L P
Sbjct: 207 RPEDIQSDNTIDSSKIAQARIAYGGRGQIMDVQQPRYGQQVMDVLLP 253


>gi|115523554|ref|YP_780465.1| flagellar basal body L-ring protein [Rhodopseudomonas palustris
           BisA53]
 gi|115517501|gb|ABJ05485.1| flagellar L-ring protein [Rhodopseudomonas palustris BisA53]
          Length = 252

 Score =  231 bits (588), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 130/244 (53%), Gaps = 8/244 (3%)

Query: 2   YRYSFIVLCYSSLLFG--CHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDST 57
            R     +   +   G  C S   +S+I   P ++ + +   +    P      K   ++
Sbjct: 8   NRIVLAGVLAVTGGLGGGCSSLDRLSQIGEKPALAAIENPTAQPGYKPVSMPMPKPEPAS 67

Query: 58  KKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
             + SLWR+   A FKD RA  VGDILTV +   D+A   NQT RSR N     ++    
Sbjct: 68  YNANSLWRNGSRAFFKDQRAHQVGDILTVTVNFTDKANIANQTQRSRTNKEDSGVTDFIG 127

Query: 118 LFGQQTPQ----MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                TP         L  D   +S GKGS+ R E L   +AA+VT +L NGNL++ G Q
Sbjct: 128 SKTIGTPATAILPGRILTTDSTASSDGKGSVQRQEALQTSVAAVVTQLLPNGNLVVEGKQ 187

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+RVN EIR L V GIVRP+D+ + N++   KIA+ARI+YGG+G+ T++ +P  G Q+++
Sbjct: 188 EIRVNFEIRELIVAGIVRPEDIQSDNTIDSAKIAQARIAYGGRGQITDVQQPRYGQQVMD 247

Query: 234 NLSP 237
            L P
Sbjct: 248 VLLP 251


>gi|315121843|ref|YP_004062332.1| flagellar basal body L-ring protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495245|gb|ADR51844.1| flagellar basal body L-ring protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 239

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 181/239 (75%), Positives = 206/239 (86%), Gaps = 1/239 (0%)

Query: 1   MYRYSFIVLCYSSLLFGCH-SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           MYRYS I+LC   LL GCH    SEITG PQMSP+GSSL+++ R+   GIDFKN  +TKK
Sbjct: 1   MYRYSVIILCNILLLAGCHLGRFSEITGSPQMSPIGSSLNQHRRILLSGIDFKNPRATKK 60

Query: 60  SYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
           SYSLWRDS++ LFKDSRALNVGDILTVDI+IDDQAVFDN+TGRSR+NSLH+KLSGGFS+F
Sbjct: 61  SYSLWRDSNSTLFKDSRALNVGDILTVDIKIDDQAVFDNKTGRSRDNSLHKKLSGGFSIF 120

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
           G+ +P M+ + NYDG   S GKGSISRAEKLN+LIAAIVT ILENGNLIISGSQEV VND
Sbjct: 121 GKNSPGMSADANYDGKSTSVGKGSISRAEKLNILIAAIVTEILENGNLIISGSQEVCVND 180

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           E+RSLNV GIVRPQDVDA+N VSYDKIAEARISYGGKG TTELL+ PIG +LI++ SPL
Sbjct: 181 EMRSLNVAGIVRPQDVDANNIVSYDKIAEARISYGGKGTTTELLKTPIGQRLIDSFSPL 239


>gi|110677665|ref|YP_680672.1| flagellar basal body L-ring protein [Roseobacter denitrificans OCh
           114]
 gi|109453781|gb|ABG29986.1| flagellar L-ring protein FlgH, putative [Roseobacter denitrificans
           OCh 114]
          Length = 243

 Score =  229 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 84/243 (34%), Positives = 128/243 (52%), Gaps = 7/243 (2%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M      V+  + ++ GC   +  +   P  SP  ++ +    +        ++ +    
Sbjct: 1   MKNVFLCVMTAALVMSGCA-RLDHLGKPPSFSPASATKEHTAMLSPGLPLRVDTSTPTDD 59

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SLW  +  +LF D RA+  GDILTV I ID++A   N T RSR+ S    +   F L  
Sbjct: 60  ASLWSGARQSLFGDRRAVQQGDILTVVIEIDEEAEISNATDRSRSGSESLGIPSLFGLPQ 119

Query: 121 QQTPQMNGNLNYDGG------GASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
           +   ++                 SSG GS+ R EKL L +AA +  +L NG L I+GSQE
Sbjct: 120 RIDRELPTGATLSDAVSINSSSNSSGDGSVKRNEKLTLRVAATIVDVLPNGVLSIAGSQE 179

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           +RVN E+R L V+G VRP+D+   N ++YDKIA AR+SYGG+G+ T++ +P  G Q ++ 
Sbjct: 180 LRVNFEMRELLVSGYVRPEDISRKNEITYDKIATARVSYGGRGQITDVQQPRWGQQALDI 239

Query: 235 LSP 237
           + P
Sbjct: 240 VLP 242


>gi|260431746|ref|ZP_05785717.1| flagellar L-ring protein FlgH [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415574|gb|EEX08833.1| flagellar L-ring protein FlgH [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 242

 Score =  229 bits (583), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 89/243 (36%), Positives = 128/243 (52%), Gaps = 8/243 (3%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M + S  +L     L  C   +  +   P +SP   S +    +                
Sbjct: 1   MTKLS-NLLVAVLALSAC-GRLDHLGKPPSLSPNTESPEHVAMLWPGLPMHTQPQRAVDR 58

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF- 119
            SLW     +L  D RA+  GDILTV I +D++A   N T RSR+ S   ++ G F L  
Sbjct: 59  SSLWSGGQQSLLGDQRAMKKGDILTVVIELDEKAEISNDTSRSRSGSEDLQVPGLFGLPQ 118

Query: 120 -----GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
                  +   ++  ++ D    S GKGS+ R EKL L +AA V  IL NG L I+GSQE
Sbjct: 119 RVAGHLPEGASLDEAVSIDSASVSKGKGSVKRKEKLTLRVAATVVDILPNGVLSIAGSQE 178

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           +RVN E+R L V+G VRPQD+   N ++YDKIA AR+SYGG+G+ +++ +P  G Q+++ 
Sbjct: 179 LRVNFELRELLVSGYVRPQDISRQNEITYDKIASARVSYGGRGQISDVQQPRYGQQVLDA 238

Query: 235 LSP 237
           L P
Sbjct: 239 LLP 241


>gi|254501335|ref|ZP_05113486.1| flagellar L-ring protein FlgH [Labrenzia alexandrii DFL-11]
 gi|222437406|gb|EEE44085.1| flagellar L-ring protein FlgH [Labrenzia alexandrii DFL-11]
          Length = 249

 Score =  228 bits (582), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 80/228 (35%), Positives = 123/228 (53%), Gaps = 7/228 (3%)

Query: 17  GCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKD 74
           GC S   ++ +   P ++ +          P          +     SLW+    A FKD
Sbjct: 21  GCGSADRLANVGQQPALNAIQDPTTTPGYRPVQMPMPDPVQAHYNPNSLWQSGSRAFFKD 80

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS-----LFGQQTPQMNGN 129
            RA  VGDILTV + ID++A  +N T RSR  +    + G        +F       +  
Sbjct: 81  QRASQVGDILTVVVSIDEKAEIENDTARSRTETNGAGVGGALGTAIDTIFLPAGTSASDL 140

Query: 130 LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
            N +     +G G + R E+L   +AA+VT +L NGNL+I G QE+RVN E+R L V GI
Sbjct: 141 GNVNSSSTFAGAGEVDREEELRTTVAAVVTQVLPNGNLVIEGRQEIRVNFEVRELIVAGI 200

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           VRP+D+ ++N+++  +IAEARI YGG+G+ T++ +P  G+Q+++ L P
Sbjct: 201 VRPEDITSNNTIASQQIAEARIGYGGRGQITDVQQPRYGNQVLDILLP 248


>gi|222147575|ref|YP_002548532.1| flagellar basal body L-ring protein [Agrobacterium vitis S4]
 gi|254789275|sp|B9JRQ0|FLGH_AGRVS RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|221734563|gb|ACM35526.1| flagellar L-ring protein precursor [Agrobacterium vitis S4]
          Length = 237

 Score =  228 bits (580), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 129/238 (54%), Positives = 168/238 (70%), Gaps = 3/238 (1%)

Query: 1   MYRYSFIVLCYSSLLFGCHS-SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M + S  V+  + +L GC + ++ E+   P MSP+GS L   N+ P L    K + +   
Sbjct: 1   MIKRS-AVVLMAVILTGCGNKTLEEVGNAPAMSPVGSGL-RYNQAPQLASYPKQTKAVSN 58

Query: 60  SYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            YSLW DS AALFKDSRA+NVGD+LTV+I I D+A F N T RSR NS     S   +LF
Sbjct: 59  GYSLWNDSQAALFKDSRAINVGDLLTVNISIADKAKFKNDTSRSRKNSTSLTWSTVINLF 118

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
           G   P  +G+++ D   +S GKGS+ R+E L L++AA+VT+ILENGNL+ISGSQEVRVN 
Sbjct: 119 GITPPDSSGDMSTDSNSSSDGKGSVDRSETLTLMVAAVVTSILENGNLLISGSQEVRVNH 178

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           E+R LNV GIVRPQDVDA N++SY+KIAEARISYGGKGR TE+ +PP+G Q+++  SP
Sbjct: 179 EVRILNVAGIVRPQDVDAKNTISYEKIAEARISYGGKGRLTEVQQPPVGQQVVDMFSP 236


>gi|149912836|ref|ZP_01901370.1| flagellar L-ring protein precursor [Roseobacter sp. AzwK-3b]
 gi|149813242|gb|EDM73068.1| flagellar L-ring protein precursor [Roseobacter sp. AzwK-3b]
          Length = 241

 Score =  228 bits (580), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 86/237 (36%), Positives = 123/237 (51%), Gaps = 7/237 (2%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           +      LL  C      +   P  +P  ++++    M                 SLWR 
Sbjct: 5   LCFSLIFLLGACA-RADHLGRAPTFTPTKNAVEHTAMMDPGLPLVAEPQRLVDQASLWRA 63

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
              +L  D RAL  GDILTV I ID++A   N T RSR+ S    +   F L  +   ++
Sbjct: 64  GRTSLLGDRRALQKGDILTVRIEIDEEAEISNSTSRSRSGSDSLGIPQLFGLPQRLNEKL 123

Query: 127 N------GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                    ++ +    S G GS+SR E+L L +AA V  +L NG L I GSQEVRVN E
Sbjct: 124 PEGASMADAVSLNSNSRSDGDGSVSRREELTLRLAATVMEVLPNGVLAIKGSQEVRVNFE 183

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +R L VTG VRP+D+   N ++YDKIA ARISYGG+G+ +++ +P  G Q+++ + P
Sbjct: 184 LRELLVTGYVRPEDISRQNEITYDKIAAARISYGGRGQISDMQQPRYGQQVLDMILP 240


>gi|110632652|ref|YP_672860.1| flagellar basal body L-ring protein [Mesorhizobium sp. BNC1]
 gi|123058276|sp|Q11LN0|FLGH_MESSB RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|110283636|gb|ABG61695.1| flagellar L-ring protein [Chelativorans sp. BNC1]
          Length = 235

 Score =  228 bits (580), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 99/238 (41%), Positives = 149/238 (62%), Gaps = 5/238 (2%)

Query: 1   MYRYS-FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M + +  + L     + GC ++  E+   P +SP+GS  +      +   D + +  ++ 
Sbjct: 1   MNKIAGTLFLLAGLAMAGCTTT-EELGKPPALSPVGSGAEPTAMQAYHYPDRRQAHVSR- 58

Query: 60  SYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            YSLW D  + LF D RAL VGDILTV I I+D+A F+N++ RSR  + +  L+G F++ 
Sbjct: 59  -YSLWSDRQSRLFTDPRALEVGDILTVVISINDKAKFENESERSRQATRNLGLAGTFAI- 116

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
           G  T     + +   G ++ G G+  R+E + L+IAAIVT  L NGNL ISG+QEVRVN 
Sbjct: 117 GSATGSAEADADIGSGTSTVGSGATKRSEDMRLVIAAIVTERLPNGNLRISGTQEVRVNA 176

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           E+R L + G+VRP D+  +N++SY++IAEARISYGG+GR TE+ +PP G Q ++ + P
Sbjct: 177 ELRVLTIAGLVRPADIGPNNTISYERIAEARISYGGRGRLTEVQQPPYGQQFLDTVLP 234


>gi|114706775|ref|ZP_01439675.1| flagellar L-ring protein precursor H [Fulvimarina pelagi HTCC2506]
 gi|114537723|gb|EAU40847.1| flagellar L-ring protein precursor H [Fulvimarina pelagi HTCC2506]
          Length = 235

 Score =  228 bits (580), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 93/236 (39%), Positives = 134/236 (56%), Gaps = 2/236 (0%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
               +       LL GC ++  +    P +SP+G+ + +   +       K    T    
Sbjct: 1   MTLRYAAPLVLVLLAGCSTNSQDAFREPALSPVGAGIYQYPNLVTPASFPK--GGTGAKN 58

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLW DS A  ++D RAL++GDI+TV I I D+A   N + R R + +        S    
Sbjct: 59  SLWTDSRADFYQDPRALSMGDIVTVKINISDKASLANLSERERESGISGGADISGSFGSW 118

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
             P +   L  DGG  + G G + R+E + L +AA+VT  L NGNL ISG QEVRVN E+
Sbjct: 119 ALPTVGATLGLDGGSDAKGSGRVKRSEDIELSVAAVVTQELPNGNLFISGQQEVRVNFEV 178

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           R L++ GI+RP+D+  +N++ YDKIAEARISYGG+GR TE+ +P  GHQ+ + +SP
Sbjct: 179 RVLSIAGIIRPRDILPNNTIDYDKIAEARISYGGRGRITEVQQPGWGHQVYDTVSP 234


>gi|170747258|ref|YP_001753518.1| flagellar basal body L-ring protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653780|gb|ACB22835.1| flagellar L-ring protein [Methylobacterium radiotolerans JCM 2831]
          Length = 249

 Score =  227 bits (579), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 79/227 (34%), Positives = 124/227 (54%), Gaps = 7/227 (3%)

Query: 18  CHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDS 75
           C++   +S++   P +S +     +    P           +    SLWR    A FKD 
Sbjct: 22  CNTADRLSQVGATPALSAIEDPTAQPGYKPVRMPMPDVQPVSYAPNSLWRTGSRAFFKDQ 81

Query: 76  RALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM-----NGNL 130
           RA  +GDILTV +++ DQA   N+T RSR N+    L     L      +         L
Sbjct: 82  RAAKLGDILTVKVKVTDQANISNETKRSRANTESFGLPNALGLENNTVGKSFGVGSTALL 141

Query: 131 NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIV 190
           +     A+ G GS+ R E +   +AA+VT +L NGNL++ G QE+RVN E+R + V G+V
Sbjct: 142 SATSATANDGAGSVQRTESVTTNVAAVVTQVLPNGNLVVEGKQEIRVNFEVREMIVAGVV 201

Query: 191 RPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           RP+D+++ N++   KIA+ARI+YGG+G+ T++ +P  G Q+++ L P
Sbjct: 202 RPEDIESDNTIDSAKIAQARIAYGGRGQITDVQQPRYGQQIVDILLP 248


>gi|217976229|ref|YP_002360376.1| flagellar L-ring protein [Methylocella silvestris BL2]
 gi|217501605|gb|ACK49014.1| flagellar L-ring protein [Methylocella silvestris BL2]
          Length = 233

 Score =  226 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 95/238 (39%), Positives = 134/238 (56%), Gaps = 5/238 (2%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R   I+      L GC   + E+   P MSP+G+ L    +     +         + 
Sbjct: 1   MERAILILTMLC--LCGCAGDLRELGREPSMSPVGTGLMAEVQPTASALFLPAPKPDSR- 57

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            S+W    A +F D RA  +GD++T++I I+D+A F N T RS ++++   L     L  
Sbjct: 58  -SIWSGGRADIFSDPRAAKIGDVVTINIGINDRASFGNTTDRSLDSAVGASLDWKLGL-N 115

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
               +            + G+G+  RAEK+ L +AAIVT +L NGNLIISGSQEVRVN E
Sbjct: 116 NTRNEFKPEYLATAISKTKGEGNTDRAEKIQLSVAAIVTDVLPNGNLIISGSQEVRVNFE 175

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +R LNV GIVRP+D+   N++SYDK+AEARISYGG+GR  E+ +P  G Q+ +   PL
Sbjct: 176 LRLLNVAGIVRPRDISKENTISYDKVAEARISYGGRGRIMEVQQPAWGQQVYDWFKPL 233


>gi|85715050|ref|ZP_01046035.1| flagellar L-ring protein precursor [Nitrobacter sp. Nb-311A]
 gi|85698247|gb|EAQ36119.1| flagellar L-ring protein precursor [Nitrobacter sp. Nb-311A]
          Length = 252

 Score =  225 bits (573), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 85/228 (37%), Positives = 126/228 (55%), Gaps = 6/228 (2%)

Query: 16  FGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFK 73
            GC S   +S+I   P+++ + +   +    P      K    +  + SLWR+   A F+
Sbjct: 24  SGCSSINRLSQIGESPKLTAIDNPTTQPGYKPVQMPMPKPETVSYNANSLWRNGSRAFFR 83

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ----MNGN 129
           D RA  VGD+LTV +   D+A   NQT RSR N     ++          P         
Sbjct: 84  DQRAARVGDLLTVIVNFTDKANIANQTQRSRINKEDSGITDFIGSKTISNPATAVLPGRI 143

Query: 130 LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
           L  D    S GKGS+ R E L   +AA+VT +L NGNL++ G QE+RVN+EIR L V GI
Sbjct: 144 LTTDSTSLSDGKGSVQRQENLQTRVAAVVTQLLPNGNLVVEGKQEIRVNNEIRELIVAGI 203

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           VRP+D+ + N++   KIA+ARI+YGG+G+ +++ +P  G Q+++ L P
Sbjct: 204 VRPEDIQSDNTIDSSKIAQARIAYGGRGQISDVQQPRYGQQVMDVLLP 251


>gi|296283230|ref|ZP_06861228.1| flagellar L-ring protein FlgH [Citromicrobium bathyomarinum JL354]
          Length = 253

 Score =  224 bits (571), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 95/253 (37%), Positives = 136/253 (53%), Gaps = 17/253 (6%)

Query: 1   MYRYSFIVLCYSSLLFGCHS--SISEITGIPQMSPMGS--------------SLDENNRM 44
           M +   I +  +SLL GC +   +  +   P MSP+ +               +     +
Sbjct: 1   MKKVVTIAV-TASLLSGCGTIDRLKNVGKAPSMSPVEAYTTPAYEPSIASTDPVRMRGTV 59

Query: 45  PFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR 104
           P        + +   + SL+R     LF+D RA  VGDILTV+I I D+A F N T RSR
Sbjct: 60  PTAPAPQAPAQAQAPNASLFRAGAGELFQDQRASRVGDILTVEINIADKAEFGNSTSRSR 119

Query: 105 NNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN 164
           + S    +     L           ++     AS G+GS +R+E +N+ +AAIVT +L N
Sbjct: 120 SGSESMGIGALLGLQDLLPGNPAQAVDATSNSASGGQGSTTRSETINMTMAAIVTDVLPN 179

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           GNL+I G QE+RVN E+R L VTGIVRPQD+   N++ + KIAEARISYGG+G+ T++ +
Sbjct: 180 GNLVIRGRQEMRVNFELRELIVTGIVRPQDIAKGNTIQHGKIAEARISYGGRGQLTDVQQ 239

Query: 225 PPIGHQLIENLSP 237
              G Q+ E L P
Sbjct: 240 ARWGQQIYEALFP 252


>gi|62317106|ref|YP_222959.1| flagellar basal body L-ring protein [Brucella abortus bv. 1 str.
           9-941]
 gi|163844350|ref|YP_001622005.1| flagellar basal body L-ring protein [Brucella suis ATCC 23445]
 gi|75495898|sp|Q579T6|FLGH_BRUAB RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|110816524|sp|Q2YJ67|FLGH_BRUA2 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|189044480|sp|A9WXL7|FLGH_BRUSI RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|62197299|gb|AAX75598.1| FlgH, flagellar L-ring protein [Brucella abortus bv. 1 str. 9-941]
 gi|163675073|gb|ABY39183.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
          Length = 238

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 103/241 (42%), Positives = 141/241 (58%), Gaps = 8/241 (3%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M + + + +    LL GC +   EI   P +SP+ + L   N   F G   +   ++   
Sbjct: 1   MNK-AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPARPGKASY-- 57

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL-- 118
            SLW       FKD RA   GD+LTV I I+D+A  DN+T R R +       G F+   
Sbjct: 58  -SLWDQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRERVSKGIYGGGGSFATSS 116

Query: 119 --FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                    M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVR
Sbjct: 117 ITGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVR 176

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  S
Sbjct: 177 VNNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFS 236

Query: 237 P 237
           P
Sbjct: 237 P 237


>gi|254691408|ref|ZP_05154662.1| flagellar basal body L-ring protein [Brucella abortus bv. 6 str.
           870]
 gi|256256594|ref|ZP_05462130.1| flagellar basal body L-ring protein [Brucella abortus bv. 9 str.
           C68]
 gi|260757022|ref|ZP_05869370.1| flagellar basal body L-ring protein [Brucella abortus bv. 6 str.
           870]
 gi|260882832|ref|ZP_05894446.1| flagellar L-ring protein [Brucella abortus bv. 9 str. C68]
 gi|297249950|ref|ZP_06933651.1| flagellar L-ring protein FlgH [Brucella abortus bv. 5 str. B3196]
 gi|260677130|gb|EEX63951.1| flagellar basal body L-ring protein [Brucella abortus bv. 6 str.
           870]
 gi|260872360|gb|EEX79429.1| flagellar L-ring protein [Brucella abortus bv. 9 str. C68]
 gi|297173819|gb|EFH33183.1| flagellar L-ring protein FlgH [Brucella abortus bv. 5 str. B3196]
          Length = 242

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 103/241 (42%), Positives = 141/241 (58%), Gaps = 8/241 (3%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M + + + +    LL GC +   EI   P +SP+ + L   N   F G   +   ++   
Sbjct: 5   MNK-AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPARPGKASY-- 61

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL-- 118
            SLW       FKD RA   GD+LTV I I+D+A  DN+T R R +       G F+   
Sbjct: 62  -SLWDQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRERVSKGIYGGGGSFATSS 120

Query: 119 --FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                    M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVR
Sbjct: 121 ITGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVR 180

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  S
Sbjct: 181 VNNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQKPPYGQQILDQFS 240

Query: 237 P 237
           P
Sbjct: 241 P 241


>gi|23499920|ref|NP_699360.1| flagellar basal body L-ring protein [Brucella suis 1330]
 gi|161620240|ref|YP_001594126.1| flagellar basal body L-ring protein [Brucella canis ATCC 23365]
 gi|254702580|ref|ZP_05164408.1| flagellar basal body L-ring protein [Brucella suis bv. 3 str. 686]
 gi|260568512|ref|ZP_05838981.1| flagellar L-ring protein [Brucella suis bv. 4 str. 40]
 gi|261753160|ref|ZP_05996869.1| flagellar L-ring protein [Brucella suis bv. 3 str. 686]
 gi|31076710|sp|Q8FXC2|FLGH_BRUSU RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|189044479|sp|A9MDR7|FLGH_BRUC2 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|23463497|gb|AAN33365.1| flagellar L-ring protein FlgH [Brucella suis 1330]
 gi|161337051|gb|ABX63355.1| Flagellar L-ring protein precursor [Brucella canis ATCC 23365]
 gi|260155177|gb|EEW90258.1| flagellar L-ring protein [Brucella suis bv. 4 str. 40]
 gi|261742913|gb|EEY30839.1| flagellar L-ring protein [Brucella suis bv. 3 str. 686]
          Length = 238

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 103/241 (42%), Positives = 141/241 (58%), Gaps = 8/241 (3%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M + + + +    LL GC +   EI   P +SP+ + L   N   F G   +   ++   
Sbjct: 1   MNK-AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPARPGKASY-- 57

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL-- 118
            SLW       FKD RA   GD+LTV I I+D+A  DN+T R R +       G F+   
Sbjct: 58  -SLWDQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRERVSKGIYGGGGSFATSS 116

Query: 119 --FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                    M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVR
Sbjct: 117 ITGAAAGGDMDASINTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVR 176

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  S
Sbjct: 177 VNNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFS 236

Query: 237 P 237
           P
Sbjct: 237 P 237


>gi|225686016|ref|YP_002733988.1| flagellar basal body L-ring protein [Brucella melitensis ATCC
           23457]
 gi|31076715|sp|Q8YB19|FLGH_BRUME RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|254789277|sp|C0RKA1|FLGH_BRUMB RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|225642121|gb|ACO02034.1| Flagellar L-ring protein precursor [Brucella melitensis ATCC 23457]
          Length = 238

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 103/241 (42%), Positives = 142/241 (58%), Gaps = 8/241 (3%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M + + + +    LL GC +   EI   P +SP+ + L   N   F G   +   ++   
Sbjct: 1   MNK-AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPARPGKASY-- 57

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL-- 118
            SLW    +  FKD RA   GD+LTV I I+D+A  DN+T R R +       G F+   
Sbjct: 58  -SLWDQRSSNFFKDPRAATPGDVLTVIISINDRANLDNKTDRERVSKGIYGGGGSFATSS 116

Query: 119 --FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                    M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVR
Sbjct: 117 ITGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVR 176

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  S
Sbjct: 177 VNNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFS 236

Query: 237 P 237
           P
Sbjct: 237 P 237


>gi|209963567|ref|YP_002296482.1| flagellar L-ring protein FlgH [Rhodospirillum centenum SW]
 gi|209957033|gb|ACI97669.1| flagellar L-ring protein FlgH [Rhodospirillum centenum SW]
          Length = 245

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 83/229 (36%), Positives = 126/229 (55%), Gaps = 6/229 (2%)

Query: 15  LFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKD 74
           L GC      +   P MSP+     +             S   ++  SLWR       +D
Sbjct: 16  LPGCAGQFDHLGRAPAMSPIEDPGMQTEARLVRMPMPVPSTEARQPASLWRTGSTGFLRD 75

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL---- 130
            RA  VGDI+TV I + +QA   NQT RSR +           L  +    +   +    
Sbjct: 76  LRAKRVGDIVTVVIDMSEQAQIRNQTQRSRASGEQMGTPNFLGLESRLGAVLPDAVDPER 135

Query: 131 --NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
             N +   +S+G GS++R E++ L +AA+VT +L NGNL+I+G QEVRVN E+R L + G
Sbjct: 136 LVNLNSSSSSTGAGSVNRQEQIQLKVAAVVTDVLPNGNLVIAGKQEVRVNFELRELRIAG 195

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           ++RP+D+   N +SY+KIAEARI+YGG+G+ T++ +P IG Q+++ + P
Sbjct: 196 VIRPEDISTRNIISYEKIAEARIAYGGRGQITDVQQPRIGQQVLDVVLP 244


>gi|254475405|ref|ZP_05088791.1| flagellar L-ring protein FlgH [Ruegeria sp. R11]
 gi|214029648|gb|EEB70483.1| flagellar L-ring protein FlgH [Ruegeria sp. R11]
          Length = 246

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 85/246 (34%), Positives = 122/246 (49%), Gaps = 10/246 (4%)

Query: 1   MYRYSFIV---LCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDST 57
           M +  F     L    +L  C   +  +   P  SP   + +    +         +   
Sbjct: 1   MNKKLFSAKTALMGVVMLSAC-GRMDHVGKPPSFSPANETPEHVAMLFQGLPTDTQTQRP 59

Query: 58  KKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
               SLW  S  +L  D RA   GDILTV I ID++A   N T RSR+ S    +     
Sbjct: 60  VDQASLWSGSRQSLLGDRRATKRGDILTVVIEIDEEAEISNDTKRSRSGSESLAMPQLLG 119

Query: 118 LFGQQ------TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
           L  +              ++      S GKGS+ R+E+L L +AA V  +L NG L ISG
Sbjct: 120 LPQRLDRHLPEGATAADAVDLSSTSQSGGKGSVKRSERLELRVAATVVDVLPNGVLAISG 179

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           +QE+RVN E+R L VTG VRP D+   N ++YDKIA AR+SYGG+G+ T++ +P  G Q+
Sbjct: 180 TQELRVNFELRELLVTGYVRPDDISRQNEITYDKIASARVSYGGRGQITDVQQPRYGQQV 239

Query: 232 IENLSP 237
           ++ + P
Sbjct: 240 LDVILP 245


>gi|90418388|ref|ZP_01226300.1| flagellar L-ring protein FlgH [Aurantimonas manganoxydans SI85-9A1]
 gi|90338060|gb|EAS51711.1| flagellar L-ring protein FlgH [Aurantimonas manganoxydans SI85-9A1]
          Length = 234

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 93/219 (42%), Positives = 134/219 (61%), Gaps = 1/219 (0%)

Query: 17  GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSR 76
           GC ++ ++    P +SP+G+ L E   +      F  S     S+SLW D+ A  ++D R
Sbjct: 14  GCSTAGNDALREPSLSPVGAGLYEYPPIIAQPASFPASKP-HTSHSLWSDARADFYQDPR 72

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGG 136
           AL+ GDI+TV IRI DQA  DN + RSR + +   L    +L     P +   L  D   
Sbjct: 73  ALSEGDIVTVKIRIRDQASIDNNSERSRKSGIAAGLDLAGNLGQYTLPTVGAQLGSDNSS 132

Query: 137 ASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVD 196
             +GKG I R+E ++L +AA+V   L NGNL ISG QEVRVN E+R L++ GI+RP+D+ 
Sbjct: 133 DMTGKGKIKRSEDIDLSVAAVVGQKLPNGNLFISGQQEVRVNFEVRVLSIAGIIRPRDIL 192

Query: 197 AHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
             N+++YDKIAEARISYGG+GR T++ +P  G Q+ + +
Sbjct: 193 PDNTINYDKIAEARISYGGRGRITDVQQPGWGQQIYDAV 231


>gi|83269098|ref|YP_418389.1| flagellar basal body L-ring protein [Brucella melitensis biovar
           Abortus 2308]
 gi|189022371|ref|YP_001932112.1| flagellar basal body L-ring protein [Brucella abortus S19]
 gi|237816668|ref|ZP_04595660.1| Flagellar L-ring protein precursor [Brucella abortus str. 2308 A]
 gi|254698389|ref|ZP_05160217.1| flagellar basal body L-ring protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731836|ref|ZP_05190414.1| flagellar basal body L-ring protein [Brucella abortus bv. 4 str.
           292]
 gi|260544345|ref|ZP_05820166.1| flagellar L-ring protein [Brucella abortus NCTC 8038]
 gi|260759606|ref|ZP_05871954.1| flagellar basal body L-ring protein [Brucella abortus bv. 4 str.
           292]
 gi|260762848|ref|ZP_05875180.1| flagellar basal body L-ring protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|294853180|ref|ZP_06793852.1| flagellar L-ring protein FlgH [Brucella sp. NVSL 07-0026]
 gi|82939372|emb|CAJ12322.1| Flagellar L-ring protein [Brucella melitensis biovar Abortus 2308]
 gi|189020945|gb|ACD73666.1| Flagellar L-ring protein [Brucella abortus S19]
 gi|237787481|gb|EEP61697.1| Flagellar L-ring protein precursor [Brucella abortus str. 2308 A]
 gi|260097616|gb|EEW81490.1| flagellar L-ring protein [Brucella abortus NCTC 8038]
 gi|260669924|gb|EEX56864.1| flagellar basal body L-ring protein [Brucella abortus bv. 4 str.
           292]
 gi|260673269|gb|EEX60090.1| flagellar basal body L-ring protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|294818835|gb|EFG35835.1| flagellar L-ring protein FlgH [Brucella sp. NVSL 07-0026]
          Length = 242

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 103/241 (42%), Positives = 141/241 (58%), Gaps = 8/241 (3%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M + + + +    LL GC +   EI   P +SP+ + L   N   F G   +   ++   
Sbjct: 5   MNK-AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPARPGKASY-- 61

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL-- 118
            SLW       FKD RA   GD+LTV I I+D+A  DN+T R R +       G F+   
Sbjct: 62  -SLWDQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRERVSKGIYGGGGSFATSS 120

Query: 119 --FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                    M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVR
Sbjct: 121 ITGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVR 180

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  S
Sbjct: 181 VNNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFS 240

Query: 237 P 237
           P
Sbjct: 241 P 241


>gi|225628629|ref|ZP_03786663.1| Flagellar L-ring protein precursor [Brucella ceti str. Cudo]
 gi|254706288|ref|ZP_05168116.1| flagellar basal body L-ring protein [Brucella pinnipedialis
           M163/99/10]
 gi|254711418|ref|ZP_05173229.1| flagellar basal body L-ring protein [Brucella pinnipedialis B2/94]
 gi|256029952|ref|ZP_05443566.1| flagellar basal body L-ring protein [Brucella pinnipedialis
           M292/94/1]
 gi|256158114|ref|ZP_05456032.1| flagellar basal body L-ring protein [Brucella ceti M490/95/1]
 gi|256252932|ref|ZP_05458468.1| flagellar basal body L-ring protein [Brucella ceti B1/94]
 gi|261220023|ref|ZP_05934304.1| flagellar L-ring protein [Brucella ceti B1/94]
 gi|261313732|ref|ZP_05952929.1| flagellar L-ring protein [Brucella pinnipedialis M163/99/10]
 gi|261319026|ref|ZP_05958223.1| flagellar L-ring protein [Brucella pinnipedialis B2/94]
 gi|265986971|ref|ZP_06099528.1| flagellar L-ring protein [Brucella pinnipedialis M292/94/1]
 gi|265996631|ref|ZP_06109188.1| flagellar L-ring protein [Brucella ceti M490/95/1]
 gi|225616475|gb|EEH13523.1| Flagellar L-ring protein precursor [Brucella ceti str. Cudo]
 gi|260918607|gb|EEX85260.1| flagellar L-ring protein [Brucella ceti B1/94]
 gi|261298249|gb|EEY01746.1| flagellar L-ring protein [Brucella pinnipedialis B2/94]
 gi|261302758|gb|EEY06255.1| flagellar L-ring protein [Brucella pinnipedialis M163/99/10]
 gi|262550928|gb|EEZ07089.1| flagellar L-ring protein [Brucella ceti M490/95/1]
 gi|264659168|gb|EEZ29429.1| flagellar L-ring protein [Brucella pinnipedialis M292/94/1]
          Length = 242

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 102/241 (42%), Positives = 140/241 (58%), Gaps = 8/241 (3%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M + + + +    LL GC +   EI   P +SP+ + L   N   F G   +   ++   
Sbjct: 5   MNK-AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPARPGKASY-- 61

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL-- 118
            SLW       FKD RA   GD+LTV I I+D+A  DN+T R R +       G F+   
Sbjct: 62  -SLWDQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRERVSKGIYGGGGSFATSS 120

Query: 119 --FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                    M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII G QEVR
Sbjct: 121 ITGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGLQEVR 180

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  S
Sbjct: 181 VNNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFS 240

Query: 237 P 237
           P
Sbjct: 241 P 241


>gi|148558224|ref|YP_001257216.1| flagellar basal body L-ring protein [Brucella ovis ATCC 25840]
 gi|148369509|gb|ABQ62381.1| flagellar L-ring protein FlgH [Brucella ovis ATCC 25840]
          Length = 242

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 103/241 (42%), Positives = 141/241 (58%), Gaps = 8/241 (3%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M + + + +    LL GC +   EI   P +SP+ + L   N   F G   +   ++   
Sbjct: 5   MNK-AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPARPGKASY-- 61

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS--- 117
            SLW       FKD RA   GD+LTV I I+D+A  DN+T R R +       G F+   
Sbjct: 62  -SLWDQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRERVSKGIYGGGGSFAASS 120

Query: 118 -LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                    M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVR
Sbjct: 121 ITGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVR 180

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  S
Sbjct: 181 VNNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFS 240

Query: 237 P 237
           P
Sbjct: 241 P 241


>gi|256014946|ref|YP_003104955.1| flagellar L-ring protein precursor [Brucella microti CCM 4915]
 gi|255997606|gb|ACU49293.1| flagellar L-ring protein precursor [Brucella microti CCM 4915]
          Length = 238

 Score =  223 bits (568), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 103/241 (42%), Positives = 141/241 (58%), Gaps = 8/241 (3%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M + + + +    LL GC +   EI   P +SP+ + L   N   F G   +   ++   
Sbjct: 1   MNK-AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPARPGKASY-- 57

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL-- 118
            SLW       FKD RA   GD+LTV I I+D+A  DN+T R R +       G F+   
Sbjct: 58  -SLWDQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRERVSKGIYGGGGSFATSS 116

Query: 119 --FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                    M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVR
Sbjct: 117 ITGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVR 176

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  S
Sbjct: 177 VNNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRVSEIQQPPYGQQILDQFS 236

Query: 237 P 237
           P
Sbjct: 237 P 237


>gi|17989427|ref|NP_542060.1| flagellar basal body L-ring protein [Brucella melitensis bv. 1 str.
           16M]
 gi|256043077|ref|ZP_05446021.1| flagellar basal body L-ring protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256262861|ref|ZP_05465393.1| flagellar L-ring protein [Brucella melitensis bv. 2 str. 63/9]
 gi|260564307|ref|ZP_05834792.1| flagellar L-ring protein [Brucella melitensis bv. 1 str. 16M]
 gi|265989515|ref|ZP_06102072.1| flagellar L-ring protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|17985304|gb|AAL54324.1| flagellar l-ring protein flgh [Brucella melitensis bv. 1 str. 16M]
 gi|260151950|gb|EEW87043.1| flagellar L-ring protein [Brucella melitensis bv. 1 str. 16M]
 gi|263000184|gb|EEZ12874.1| flagellar L-ring protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092696|gb|EEZ16905.1| flagellar L-ring protein [Brucella melitensis bv. 2 str. 63/9]
 gi|326410339|gb|ADZ67403.1| flagellar basal body L-ring protein [Brucella melitensis M28]
 gi|326553631|gb|ADZ88270.1| flagellar basal body L-ring protein [Brucella melitensis M5-90]
          Length = 242

 Score =  223 bits (568), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 103/241 (42%), Positives = 142/241 (58%), Gaps = 8/241 (3%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M + + + +    LL GC +   EI   P +SP+ + L   N   F G   +   ++   
Sbjct: 5   MNK-AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPARPGKASY-- 61

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL-- 118
            SLW    +  FKD RA   GD+LTV I I+D+A  DN+T R R +       G F+   
Sbjct: 62  -SLWDQRSSNFFKDPRAATPGDVLTVIISINDRANLDNKTDRERVSKGIYGGGGSFATSS 120

Query: 119 --FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                    M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVR
Sbjct: 121 ITGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVR 180

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  S
Sbjct: 181 VNNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFS 240

Query: 237 P 237
           P
Sbjct: 241 P 241


>gi|149203123|ref|ZP_01880094.1| flagellar L-ring protein precursor H [Roseovarius sp. TM1035]
 gi|149143669|gb|EDM31705.1| flagellar L-ring protein precursor H [Roseovarius sp. TM1035]
          Length = 244

 Score =  223 bits (568), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 86/243 (35%), Positives = 128/243 (52%), Gaps = 6/243 (2%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M      ++    LL    + +  +   P  +P  +S ++   +          ++  + 
Sbjct: 1   MTALRLNLIFVVVLLAASCARLDHLGKPPSFTPTMNSTEQLAMLDPGLPRSTAQNAPFQQ 60

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SLW     +L  D RA   GDI+TV I ID++A   N T RSR+ S    +   F +  
Sbjct: 61  ASLWSGGKQSLLGDRRAAQRGDIMTVVIEIDEEAQISNSTSRSRDGSESLAIPDLFGIPQ 120

Query: 121 QQTPQMNGNLNYDG------GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
           +    +    + D          S G+GS+SR+E+L L +AA V  +L NG L I GSQE
Sbjct: 121 RINRNLPEGASLDRAAGLNSTSQSGGEGSVSRSEELTLRVAATVMQVLPNGVLEIQGSQE 180

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           VRVN E+R L V+G VRP+D+   N ++YDKIA ARISYGG+G+ T++ +P IG QL++ 
Sbjct: 181 VRVNFELRELLVSGFVRPEDISRQNEITYDKIAAARISYGGRGQITDVQQPRIGQQLLDG 240

Query: 235 LSP 237
           L P
Sbjct: 241 LLP 243


>gi|296534163|ref|ZP_06896656.1| flagellar L-ring protein FlgH [Roseomonas cervicalis ATCC 49957]
 gi|296265509|gb|EFH11641.1| flagellar L-ring protein FlgH [Roseomonas cervicalis ATCC 49957]
          Length = 246

 Score =  223 bits (567), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 75/218 (34%), Positives = 120/218 (55%), Gaps = 1/218 (0%)

Query: 21  SISEITGIPQMSPMGSSLDENN-RMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALN 79
            ISEI   PQ++P+ +                       ++ SLWR       +D RA  
Sbjct: 28  RISEIGRGPQLAPIENPAQVAGLERTVAMPMPPAQAPLPETNSLWRPGSRTFLRDQRAAQ 87

Query: 80  VGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASS 139
           VGD++TV ++I D+A  +N T RSR N+    ++    +  +        L       + 
Sbjct: 88  VGDLVTVLVQITDKAELENTTARSRANNEDFGITRLLGMAARLPGGAGNLLETASNSGTE 147

Query: 140 GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHN 199
           G GSI+R E + L +AA V  +L NGNL+++G Q+VRVN E+R L V+GI+R QD+ + N
Sbjct: 148 GTGSINRNETVTLRVAATVVQMLPNGNLVVAGRQQVRVNHELRELQVSGIIRSQDIASDN 207

Query: 200 SVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +V +D++AEARI+YGG+G  +++ +P  G Q ++ + P
Sbjct: 208 TVRHDRLAEARIAYGGRGIISDVQQPRYGQQFLDLVLP 245


>gi|254695294|ref|ZP_05157122.1| flagellar basal body L-ring protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|261215663|ref|ZP_05929944.1| flagellar basal body L-ring protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|260917270|gb|EEX84131.1| flagellar basal body L-ring protein [Brucella abortus bv. 3 str.
           Tulya]
          Length = 242

 Score =  223 bits (567), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 103/241 (42%), Positives = 142/241 (58%), Gaps = 8/241 (3%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M + + + +    LL GC +   EI   P +SP+ + L   N   F G   +   ++   
Sbjct: 5   MNK-AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPARPGKASY-- 61

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL-- 118
            SLW       FKD RA   GD+LTV I I+D+A  DN+T R R ++      G F+   
Sbjct: 62  -SLWDQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRERVSNGIYGGGGSFATSS 120

Query: 119 --FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                    M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVR
Sbjct: 121 ITGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVR 180

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  S
Sbjct: 181 VNNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFS 240

Query: 237 P 237
           P
Sbjct: 241 P 241


>gi|312115245|ref|YP_004012841.1| flagellar L-ring protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311220374|gb|ADP71742.1| flagellar L-ring protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 243

 Score =  222 bits (566), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 96/244 (39%), Positives = 141/244 (57%), Gaps = 9/244 (3%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M   +      + +L GC + ++EI   P ++P+G+ L   +    +G       S    
Sbjct: 1   MKICTLAAAATTLMLGGCFNRMNEIGREPGLTPVGAGLVPAHTA--IGTMPATPASYVTR 58

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SLW+D+ A LFKD RA  VGD++TV I I D+A  DN   RSR+++    ++   +L  
Sbjct: 59  ASLWQDNGADLFKDPRATKVGDVITVKISIKDKASIDNNNSRSRSSTRELDITNKANLSW 118

Query: 121 QQTPQMNGNLNYDG-------GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
               +     +            ++  KG ISRAE +NLLI A+VT +L NGNLI++G Q
Sbjct: 119 SGLNKHLDTQSSGELDPKVESTTSTDAKGGISRAESINLLIGAVVTEVLPNGNLIVAGRQ 178

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           EVRVN E+R L ++GI+RP+D+   NS+SYDKIAEARISYGG+GR  ++ +P  G Q+ +
Sbjct: 179 EVRVNFELRELLISGIIRPRDIATDNSISYDKIAEARISYGGRGRIMDVAQPAWGQQVTD 238

Query: 234 NLSP 237
            L P
Sbjct: 239 WLLP 242


>gi|56695098|ref|YP_165445.1| flagellar basal body L-ring protein [Ruegeria pomeroyi DSS-3]
 gi|81350864|sp|Q5LWX7|FLGH_SILPO RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|56676835|gb|AAV93501.1| flagellar L-ring protein FlgH [Ruegeria pomeroyi DSS-3]
          Length = 246

 Score =  222 bits (565), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 78/246 (31%), Positives = 119/246 (48%), Gaps = 10/246 (4%)

Query: 1   MYRYSFI---VLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDST 57
           M +       ++    +L  C      +   P  +P   S +    +            +
Sbjct: 1   MMQKCLSPKTLIAALVVLSAC-GRADHLGKAPSFTPNTESPEHVAMLWPGLPLHTQPQRS 59

Query: 58  KKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
               SLW     +L  D RA+  GDILTV I ID++A   N T RSR+ S    +     
Sbjct: 60  VDRASLWSGGQNSLLGDQRAMKKGDILTVVIEIDEKAEISNDTNRSRSGSESLGVPHLLG 119

Query: 118 LFGQQTPQMNGNLNYDGGGASSGKGS------ISRAEKLNLLIAAIVTAILENGNLIISG 171
           L  +   ++    +     A     +      + R EKL L +AA V  +L NG L I+G
Sbjct: 120 LPQRIDEKLPEGASMSNAVAVDSSSASGGKGSVKRKEKLTLRVAATVVDVLPNGVLSITG 179

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           SQE+RVN E+R L V+G VRP+D+   N ++YDKIA AR+SYGG+G+ T++ +P  G Q+
Sbjct: 180 SQELRVNFELRELLVSGYVRPEDISRQNEITYDKIASARVSYGGRGQITDVQQPRYGQQV 239

Query: 232 IENLSP 237
           ++ + P
Sbjct: 240 LDMVLP 245


>gi|306838568|ref|ZP_07471405.1| flagellar basal body L-ring protein [Brucella sp. NF 2653]
 gi|306406354|gb|EFM62596.1| flagellar basal body L-ring protein [Brucella sp. NF 2653]
          Length = 238

 Score =  222 bits (565), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 103/241 (42%), Positives = 138/241 (57%), Gaps = 8/241 (3%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +          LL GC +   EI   P +SP+ + L   N   F G   +   ++   
Sbjct: 1   MNKAILAA-AMVFLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPARPGKASY-- 57

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL-- 118
            SLW       FKD RA   GD+LTV I I+D+A  DN+T R R +       G F+   
Sbjct: 58  -SLWDQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRERVSKGIYGGGGSFATSS 116

Query: 119 --FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                    M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVR
Sbjct: 117 ITGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVR 176

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  S
Sbjct: 177 VNNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFS 236

Query: 237 P 237
           P
Sbjct: 237 P 237


>gi|256111939|ref|ZP_05452890.1| flagellar basal body L-ring protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265993386|ref|ZP_06105943.1| flagellar L-ring protein [Brucella melitensis bv. 3 str. Ether]
 gi|262764256|gb|EEZ10288.1| flagellar L-ring protein [Brucella melitensis bv. 3 str. Ether]
          Length = 242

 Score =  221 bits (564), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 102/241 (42%), Positives = 141/241 (58%), Gaps = 8/241 (3%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M + + + +    LL GC +   EI   P +SP+ + L   N   F G   +   ++   
Sbjct: 5   MNK-AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPARPGKASY-- 61

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL-- 118
            SLW    +  FKD RA   GD+LTV I I+D+A  DN+  R R +       G F+   
Sbjct: 62  -SLWDQRSSNFFKDPRAATPGDVLTVIISINDRANLDNKADRERVSKGIYGGGGSFATSS 120

Query: 119 --FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                    M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVR
Sbjct: 121 ITGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVR 180

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  S
Sbjct: 181 VNNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFS 240

Query: 237 P 237
           P
Sbjct: 241 P 241


>gi|254720606|ref|ZP_05182417.1| flagellar basal body L-ring protein [Brucella sp. 83/13]
 gi|265985646|ref|ZP_06098381.1| flagellar L-ring protein [Brucella sp. 83/13]
 gi|264664238|gb|EEZ34499.1| flagellar L-ring protein [Brucella sp. 83/13]
          Length = 242

 Score =  221 bits (564), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 103/241 (42%), Positives = 138/241 (57%), Gaps = 8/241 (3%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +          LL GC +   EI   P +SP+ + L   N   F G   +   ++   
Sbjct: 5   MNKAILAA-AMVFLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPARPGKASY-- 61

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL-- 118
            SLW       FKD RA   GD+LTV I I+D+A  DN+T R R +       G F+   
Sbjct: 62  -SLWDQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRERVSKGIYGGGGSFATSS 120

Query: 119 --FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                    M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVR
Sbjct: 121 ITGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVR 180

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  S
Sbjct: 181 VNNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFS 240

Query: 237 P 237
           P
Sbjct: 241 P 241


>gi|260466615|ref|ZP_05812803.1| flagellar L-ring protein [Mesorhizobium opportunistum WSM2075]
 gi|259029621|gb|EEW30909.1| flagellar L-ring protein [Mesorhizobium opportunistum WSM2075]
          Length = 236

 Score =  221 bits (563), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 104/239 (43%), Positives = 145/239 (60%), Gaps = 6/239 (2%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R   +VLC  + L GC +++ E+   P +SP+GS +D  +               KK 
Sbjct: 1   MIRR-MLVLCAVAALSGCGTNLKEVGKEPALSPVGSGIDGGDTGSLYKYPETPRAPVKK- 58

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS--LHRKLSGGFSL 118
           +SLW D  + LF D RAL+ GDILTV I+I+D+A F NQ  RSR  +  L   +S  +  
Sbjct: 59  FSLWDDRQSRLFTDPRALSQGDILTVRIKINDRANFKNQNDRSRTANRKLGFDISAQWDK 118

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
            G    +  G LN      + G+  I R+E L L +AAIVT +L NGNL+I+GSQEVRVN
Sbjct: 119 IGSTAGKGAGALNSQTDTTADGE--IKRSETLELNVAAIVTDVLPNGNLMITGSQEVRVN 176

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            E+R L + GIVRP D+ A N++ Y++IAEARISYGG+GR TE+ +P  G Q+++ + P
Sbjct: 177 AELRVLTIAGIVRPADIGAENTIPYERIAEARISYGGRGRITEVQQPAYGQQVLDQVLP 235


>gi|254473379|ref|ZP_05086776.1| flagellar L-ring protein FlgH [Pseudovibrio sp. JE062]
 gi|211957495|gb|EEA92698.1| flagellar L-ring protein FlgH [Pseudovibrio sp. JE062]
          Length = 236

 Score =  221 bits (563), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 97/236 (41%), Positives = 148/236 (62%), Gaps = 1/236 (0%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            + + + +  +  L GC++ +  +   P ++P+G  L  +           +  S +  +
Sbjct: 1   MKRTLVCILAAITLTGCNA-MKNVGKEPHLTPLGQGLQPSVASLPATPAKSSGRSNRAYH 59

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
            LW D     F+D RA  VGD+LTV I+I D+A  DN + R R++S    L G FS  G 
Sbjct: 60  GLWADGEQDFFRDPRAKQVGDVLTVAIKIKDKAKLDNSSERKRDSSRSTGLKGAFSWAGV 119

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
            + + + +++  G  AS G+G+I R+E+++L IAA+VT +L NGNLIISG QEVRVN E+
Sbjct: 120 DSGEADASISGTGATASKGEGAIDRSEEIDLSIAAVVTKVLRNGNLIISGQQEVRVNYEV 179

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           R L+V GIVRP+D+   N++ YDKIAEAR+SYGG+GR TE+ +P +G Q+I+ +SP
Sbjct: 180 RVLSVAGIVRPEDITGRNTIQYDKIAEARVSYGGRGRMTEVQQPSVGQQVIDIISP 235


>gi|319781677|ref|YP_004141153.1| flagellar L-ring protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317167565|gb|ADV11103.1| flagellar L-ring protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 235

 Score =  221 bits (563), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 99/237 (41%), Positives = 142/237 (59%), Gaps = 3/237 (1%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R   +VLC  ++L GC +++ E+   P +SP+GS +D  +               KK 
Sbjct: 1   MIRK-MLVLCAVAMLSGCGTNLKEVGREPALSPVGSGIDGGSTGSLYRYPQTPPAPVKK- 58

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           +SLW D  + LF D RAL+ GDILTV I+I+D+A F NQ  RSR  +         + + 
Sbjct: 59  FSLWDDRQSRLFTDPRALSQGDILTVKIKINDRANFKNQNDRSRTANRKLGYD-LSAQWD 117

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
           + +    G         ++  G I R+E L L +AAIVT +L NGNL+I+GSQEVRVN E
Sbjct: 118 KWSTAGKGAGALSSTTDTTADGEIKRSETLELNVAAIVTDVLPNGNLMITGSQEVRVNAE 177

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +R L + GIVRP D+ A N++ Y++IAEARISYGG+GR TE+ +P  G Q+++ + P
Sbjct: 178 LRVLTLAGIVRPADIGAENTIPYERIAEARISYGGRGRITEVQQPAYGQQILDQVLP 234


>gi|162147476|ref|YP_001601937.1| flagellar basal body L-ring protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209545585|ref|YP_002277814.1| flagellar basal body L-ring protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786053|emb|CAP55635.1| putative flagellar L-ring protein precursor [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533262|gb|ACI53199.1| flagellar L-ring protein [Gluconacetobacter diazotrophicus PAl 5]
          Length = 250

 Score =  220 bits (561), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 80/235 (34%), Positives = 122/235 (51%), Gaps = 4/235 (1%)

Query: 7   IVLCYSSLLFGCH--SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
             +     L GC   S +SE    P+M+         +  P             +  SLW
Sbjct: 15  AAMAGLLFLTGCAGLSDLSENGHPPRMTTTSDPTQSPDYRPVTMPMPPLQAPPTEVGSLW 74

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ--Q 122
           R    + FKD RA  VGD++T+ +++ D A   N T  + + S    +   F L G+   
Sbjct: 75  RPGSRSFFKDQRASQVGDLITIIVQVADNANIVNNTSAAGSGSEDFGIPSIFGLKGKVAS 134

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
               +  LN     A++  G I+R E + L +   +T +L NGN ++   QEVRVN E+R
Sbjct: 135 HLSSSSALNTSSATANTATGRITRTEAVGLTLGGTITQVLPNGNFVVVARQEVRVNGELR 194

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            L V+G+VRPQD+   N+V++D+IAEARISYGG+G+ T+L  P  G Q+++N+ P
Sbjct: 195 QLMVSGVVRPQDITEDNTVTHDRIAEARISYGGRGQLTKLQTPRYGQQILDNVLP 249


>gi|153011520|ref|YP_001372734.1| flagellar basal body L-ring protein [Ochrobactrum anthropi ATCC
           49188]
 gi|151563408|gb|ABS16905.1| flagellar L-ring protein [Ochrobactrum anthropi ATCC 49188]
          Length = 242

 Score =  220 bits (560), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 101/241 (41%), Positives = 139/241 (57%), Gaps = 8/241 (3%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M + + +      LL GC +   EI   P +SP+               +   +  +K +
Sbjct: 5   MNK-ATLTAAVLVLLAGCATKPEEIGRAPDLSPV---AAHLGMQNNPQSNGYPARPSKAT 60

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF---- 116
           YSLW       FKD RA   GD+LTV I I+D+A  DN+T R R +       G F    
Sbjct: 61  YSLWDQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRERVSKGIYGAGGSFATSS 120

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
           S        M+ +LN      S GKG+I R+E + L +AAIVT  L NGN+II GSQEVR
Sbjct: 121 STGAGAGGDMDASLNTHSDSKSKGKGTIERSEDIRLQVAAIVTDTLPNGNMIIRGSQEVR 180

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++ +S
Sbjct: 181 VNNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQVS 240

Query: 237 P 237
           P
Sbjct: 241 P 241


>gi|163758019|ref|ZP_02165107.1| flagellar L-ring protein [Hoeflea phototrophica DFL-43]
 gi|162284308|gb|EDQ34591.1| flagellar L-ring protein [Hoeflea phototrophica DFL-43]
          Length = 239

 Score =  219 bits (559), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 112/241 (46%), Positives = 154/241 (63%), Gaps = 5/241 (2%)

Query: 1   MYRYSFIVLCYSSLLFGCHSS-ISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R +  +   +  L GC +  + E+   P MSP+G+ L      P +    K      +
Sbjct: 1   MNR-AVAITILALSLGGCSAQTLKEVGRAPSMSPVGAGL-AYGETPQMAAYPKQPMPRSQ 58

Query: 60  SYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL- 118
            +SLW D+ + LF+D+RA++VGDILTVD+ I+D+A FDN T RSR NS          L 
Sbjct: 59  GFSLWDDNKSKLFQDARAMSVGDILTVDLAINDKATFDNATDRSRQNSSGINAGFNLPLL 118

Query: 119 -FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                     G+L +    ++SG+G+  R+E+L L IAA+VT IL NGNL+ISGSQEVRV
Sbjct: 119 EGLGIGAVNEGDLEFGSNTSTSGQGTTERSEQLELRIAAVVTGILPNGNLVISGSQEVRV 178

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N E+R LNV GIVRP DVD +N+V+YDKIAEAR+SYGG+GR  E+ +PP+G QL++ LSP
Sbjct: 179 NQELRILNVAGIVRPLDVDHNNTVAYDKIAEARVSYGGRGRLMEVQQPPVGQQLVDILSP 238

Query: 238 L 238
           +
Sbjct: 239 I 239


>gi|256059605|ref|ZP_05449803.1| flagellar basal body L-ring protein [Brucella neotomae 5K33]
 gi|261323572|ref|ZP_05962769.1| flagellar L-ring protein [Brucella neotomae 5K33]
 gi|261299552|gb|EEY03049.1| flagellar L-ring protein [Brucella neotomae 5K33]
          Length = 242

 Score =  219 bits (558), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 102/241 (42%), Positives = 140/241 (58%), Gaps = 8/241 (3%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M + + + +    LL GC +   EI   P +SP+ + L   N   F G   +   ++   
Sbjct: 5   MNK-AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPARPGKASY-- 61

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL-- 118
            SLW       FKD RA   GD+LTV I I+D+A  DN+T R R +       G F+   
Sbjct: 62  -SLWDQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRERVSKGIYGGGGSFATSS 120

Query: 119 --FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                    M+ ++N      S GKG+I R+E + L IAAIVT  L N NLII GSQEVR
Sbjct: 121 ITGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNANLIIRGSQEVR 180

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  S
Sbjct: 181 VNNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFS 240

Query: 237 P 237
           P
Sbjct: 241 P 241


>gi|288962680|ref|YP_003452974.1| flagellar L-ring protein precursor [Azospirillum sp. B510]
 gi|288914946|dbj|BAI76430.1| flagellar L-ring protein precursor [Azospirillum sp. B510]
          Length = 249

 Score =  219 bits (558), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 82/228 (35%), Positives = 128/228 (56%), Gaps = 7/228 (3%)

Query: 16  FGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDS 75
            GC   +++I   P +S + +   +           + S + +   SLWR      F+D 
Sbjct: 22  GGCA-RLADIGSAPTLSEINNPALQPEARVISLPMPQPSMAEQIPSSLWRTGSRDFFRDP 80

Query: 76  RALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL----- 130
           RA +VGD+LTV I I DQA   N T R R+NS    L     L  +    +   +     
Sbjct: 81  RAKSVGDLLTVVIDISDQAQMRNSTQRGRSNSEKEGLPNFLGLESRLPAVLPDAVDPSNL 140

Query: 131 -NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
            N D    S+G G+I R E++ + +AA+VT +L NGN +I+G QEVRVN E+R + + G+
Sbjct: 141 VNLDSTSNSTGNGTIQRNERIAMRVAAVVTQVLPNGNFVIAGRQEVRVNFELREMRIAGV 200

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +RP+D+   N++ YDKIAEARI+YGG+G+ T++ +P  G Q+++ + P
Sbjct: 201 IRPEDISNANTIEYDKIAEARITYGGRGQITDVQQPRYGQQVLDVILP 248


>gi|254470268|ref|ZP_05083672.1| flagellar L-ring protein FlgH [Pseudovibrio sp. JE062]
 gi|211960579|gb|EEA95775.1| flagellar L-ring protein FlgH [Pseudovibrio sp. JE062]
          Length = 253

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 79/238 (33%), Positives = 123/238 (51%), Gaps = 7/238 (2%)

Query: 7   IVLCYSSLLFGC--HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
            V      L GC     +S++   P ++ +     +    P              + SLW
Sbjct: 15  AVAIGLLALAGCETADKLSKVGQEPALTAIQDPRTQPGYRPVQMPMPVKETERYNANSLW 74

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG-----GFSLF 119
           R  + A F+D RA  +GDI+TV++ I D+A F+N +  SR+++ +    G       +L 
Sbjct: 75  RTGNRAFFQDQRAKRIGDIVTVNVTISDEAAFENSSRSSRSDAKNSGAGGALGAAINTLA 134

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
              +   +   + +      G GSI R E L   +AA+VT +L N NL+I G QEVRVN 
Sbjct: 135 LPASASADALASINSSDTFQGSGSIDRTESLKTTVAAVVTQVLPNSNLVIEGRQEVRVNH 194

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           E+R L V G++RPQD+ + N+V   KIAEARI YGG+G+ +   +P  G Q+++ + P
Sbjct: 195 EVRELIVAGVIRPQDIASDNTVESTKIAEARIGYGGRGQISVAQQPRYGSQVLDIVLP 252


>gi|118589977|ref|ZP_01547381.1| flagellar L-ring protein precursor H [Stappia aggregata IAM 12614]
 gi|118437474|gb|EAV44111.1| flagellar L-ring protein precursor H [Stappia aggregata IAM 12614]
          Length = 230

 Score =  219 bits (557), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 94/231 (40%), Positives = 140/231 (60%), Gaps = 2/231 (0%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           +    +++L GC   + ++   P+M+P+G  L       +    F    + K   SLW  
Sbjct: 1   MFSFGAAMLTGCAGQLEDVGRAPEMTPVGYGLAVQQPAAYPLSTFGQG-TVKDYNSLWAS 59

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
                F D RA  VGD+LTV I+I+D+A  DN++ R R + +    +  +   G      
Sbjct: 60  GRDNFFADPRAKKVGDVLTVTIQINDRANMDNKSDRRRTSDIGWGGTMDYDWDGIGHGG- 118

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
           +GNL  D G  S+G GSI R+E++ L +AA+VT  L NGNL+ISGSQE+RVN E+R L +
Sbjct: 119 SGNLGVDSGSGSAGSGSIDRSEEIQLSVAAVVTDRLPNGNLVISGSQEMRVNFEMRILQI 178

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            GIVRP+D+ A+N++ YDKIAEAR+SYGG+GR TE+ +P  G Q+ + ++P
Sbjct: 179 AGIVRPRDIQANNTIPYDKIAEARVSYGGRGRITEVQQPAWGQQIYDIVTP 229


>gi|13472580|ref|NP_104147.1| flagellar basal body L-ring protein [Mesorhizobium loti MAFF303099]
 gi|20138306|sp|Q98HD3|FLGH_RHILO RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|14023326|dbj|BAB49933.1| flagellar L-ring protein; FlgH [Mesorhizobium loti MAFF303099]
          Length = 235

 Score =  218 bits (556), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 99/237 (41%), Positives = 142/237 (59%), Gaps = 3/237 (1%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R + I LC  + L GC +++ E+   P +SP+GS +D  N               KK 
Sbjct: 1   MIRRTLI-LCAVAALSGCGTNLREVGKEPSLSPVGSGIDGGNTSALYKYPEPPRAPVKK- 58

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           +SLW D  + LF D RAL+ GDILTV I+I+D+A F NQ  RSR  +         + + 
Sbjct: 59  FSLWDDRQSRLFTDPRALSQGDILTVRIKINDRANFKNQNDRSRTANRKLGFD-LSAQWD 117

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
           + +    G    +    ++  G I R+E L L +AAIVT +L NGNL+I+GSQEVRVN E
Sbjct: 118 KWSTAGKGAGALNSATDTTADGEIKRSETLELNVAAIVTDVLPNGNLMITGSQEVRVNAE 177

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +R L + GIVRP D+ A N++ Y++IAEARISYGG+GR +E+ +P  G Q+++ + P
Sbjct: 178 LRVLTIAGIVRPADIGAENTIPYERIAEARISYGGRGRISEIQQPAYGQQVLDQVLP 234


>gi|78221654|ref|YP_383401.1| flagellar L-ring protein [Geobacter metallireducens GS-15]
 gi|110816530|sp|Q39YJ8|FLGH_GEOMG RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|78192909|gb|ABB30676.1| Flagellar L-ring protein [Geobacter metallireducens GS-15]
          Length = 226

 Score =  218 bits (556), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 64/244 (26%), Positives = 105/244 (43%), Gaps = 26/244 (10%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R +  +LC +  L GC    +E+                 R P           +  S
Sbjct: 1   MKRLAVSILCLA--LAGCAIEKAEV-----------------RTPSFDEQLPAPQPSYAS 41

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            S+W+ + A + +D +A   GDI+TV I  +  A     T   R  S+   +     L  
Sbjct: 42  GSIWQAASAGIAEDHKARRKGDIITVVIVENASASKQATTDTDRKASISASIPYLMGLEK 101

Query: 121 Q-------QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
           Q           +   L         G G+ +R E L   ++A +  +L NGN +I G +
Sbjct: 102 QKLILGKLTGADLGNLLGASTDSTFGGSGATTRKENLVATMSAKIIDVLPNGNFLIEGRR 161

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
            V+VN+E + + + G VRP+DV   N+V+   IA+ARI+Y G+G  ++  RP      ++
Sbjct: 162 NVKVNNEDQIIILQGTVRPRDVSPDNTVNSSLIADARITYTGEGVISDRQRPGWLMNFLD 221

Query: 234 NLSP 237
            + P
Sbjct: 222 YIWP 225


>gi|126730132|ref|ZP_01745944.1| flagellar L-ring protein precursor H [Sagittula stellata E-37]
 gi|126709512|gb|EBA08566.1| flagellar L-ring protein precursor H [Sagittula stellata E-37]
          Length = 246

 Score =  218 bits (555), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 89/243 (36%), Positives = 127/243 (52%), Gaps = 8/243 (3%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R +F+ +   +    C   ++ I   P  +P   S +    +     +          
Sbjct: 5   MLRVTFL-IALVATASACA-RMNHIGKAPDFTPQTESTERVAMVASGIPEAAPPGRASDG 62

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF- 119
            SLW    A+L  D RA+  GDILTV I IDD A   N T RSRN S    +   F +  
Sbjct: 63  ASLWSAGQASLLGDRRAMKRGDILTVVILIDDSAEIQNSTSRSRNGSESLAIPDLFGVPE 122

Query: 120 -----GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
                      ++  ++ +   +S G GS+ R+E L L IAA V  +L NG L I GSQE
Sbjct: 123 RINQGITDGASLDSAVDLNSSASSGGDGSVRRSESLTLRIAATVVDVLPNGILSIEGSQE 182

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           VRVN E+R L V+G VRP+D+   N ++YDKIA ARISYGG+G+ T++ +P IG Q+++ 
Sbjct: 183 VRVNFELRELLVSGYVRPEDISRQNEITYDKIASARISYGGRGQITDVQQPRIGQQVLDA 242

Query: 235 LSP 237
           + P
Sbjct: 243 ILP 245


>gi|294679029|ref|YP_003579644.1| flagellar L-ring protein FlgH [Rhodobacter capsulatus SB 1003]
 gi|294477849|gb|ADE87237.1| flagellar L-ring protein FlgH [Rhodobacter capsulatus SB 1003]
          Length = 241

 Score =  218 bits (555), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 86/240 (35%), Positives = 122/240 (50%), Gaps = 7/240 (2%)

Query: 4   YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSL 63
            S + +  +  L  C   + ++   P  + +  S +          +     +  +  SL
Sbjct: 2   RSLLFVFMALSLAAC-GRLEQVGKAPDFNTVEGSDEFFAMNSPPLPEDALRQTRAQEASL 60

Query: 64  WRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT 123
           W  +  +L  D RA   GDILTV I IDD+A   N +GRSR +S    +   F +  +  
Sbjct: 61  WSGNRGSLLGDRRAATRGDILTVVIEIDDKAEISNTSGRSRKSSDKMGIPSMFGIPQRLD 120

Query: 124 PQMN------GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
            Q+                +  G GS++R EKL L +AA V   L NG L I GSQEVRV
Sbjct: 121 AQLPEGATMADAFETGSSSSYKGDGSVARKEKLTLRVAATVLDRLPNGVLRIQGSQEVRV 180

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N E+R L VTG VRP+DV   N ++YDKIA ARISYGG+G+ T++ +P  G Q+ + L P
Sbjct: 181 NFEVRELIVTGFVRPEDVSRQNEITYDKIAGARISYGGRGQITDVQQPRYGQQVSDILLP 240


>gi|255263180|ref|ZP_05342522.1| flagellar L-ring protein [Thalassiobium sp. R2A62]
 gi|255105515|gb|EET48189.1| flagellar L-ring protein [Thalassiobium sp. R2A62]
          Length = 246

 Score =  218 bits (554), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 78/243 (32%), Positives = 124/243 (51%), Gaps = 9/243 (3%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M     + +    ++ GC   +  +   P+++P+ S+++    M               +
Sbjct: 6   MNSKFILPIFL--IMSGCA-RMESVGQEPEITPVRSTIEHTAMMTPSLPQTLVQTPPVAN 62

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SLW     +LF D RA   GDILTV I IDD+A   N + R+R+ S +  +   F +  
Sbjct: 63  ASLWSGGRESLFGDKRAATRGDILTVVIEIDDKAEISNSSNRARSGSENLSVPSLFGIPQ 122

Query: 121 QQTPQMNGNLNYDGGGASSGKGSIS------RAEKLNLLIAAIVTAILENGNLIISGSQE 174
           +    +          + +   + S      R EKL L +AA V  +L NG L I G+QE
Sbjct: 123 RVDQSLPEGATLSEAVSLNSSSASSGNGSVSRNEKLTLRVAATVVDVLPNGVLSIQGTQE 182

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           VRVN E+R L V+G VRP+D+   N ++YDKIA AR+SYGG+G+ +++ +P  G Q+ + 
Sbjct: 183 VRVNFELRELLVSGFVRPKDITRQNEITYDKIASARVSYGGRGQISDMQQPRYGQQIADI 242

Query: 235 LSP 237
           + P
Sbjct: 243 ILP 245


>gi|126738576|ref|ZP_01754281.1| flagellar L-ring protein precursor H [Roseobacter sp. SK209-2-6]
 gi|126720375|gb|EBA17081.1| flagellar L-ring protein precursor H [Roseobacter sp. SK209-2-6]
          Length = 246

 Score =  218 bits (554), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 87/243 (35%), Positives = 124/243 (51%), Gaps = 6/243 (2%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M       L     + G  + +  +   P  +P   + +    +         S     +
Sbjct: 3   MKTLFTTGLIAGLFVLGACNRMDHLGKPPSFTPANETQEHVAMLWQGLPHQVQSQRPVDN 62

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF- 119
            SLW  S  +L  D RA+N GDILTV I ID++A   N T RSR++S    +     L  
Sbjct: 63  ASLWSGSQQSLLGDRRAMNKGDILTVVIEIDEEAEISNDTSRSRSSSESLNMPQLLGLPQ 122

Query: 120 -----GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
                          ++  G   S G GS+ R+EKL L +AA V  IL NG L ISGSQE
Sbjct: 123 RLDEHLPTGASAATAVDLGGASTSRGNGSVKRSEKLELKVAATVVDILPNGVLAISGSQE 182

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           +RVN E+R L V+G VRPQD+   N ++YDKIA AR+SYGG+G+ T++ +P  G Q+++ 
Sbjct: 183 LRVNFELRELLVSGYVRPQDISRKNEITYDKIASARVSYGGRGQITDVQQPRYGQQVLDA 242

Query: 235 LSP 237
           + P
Sbjct: 243 ILP 245


>gi|258404729|ref|YP_003197471.1| flagellar L-ring protein [Desulfohalobium retbaense DSM 5692]
 gi|257796956|gb|ACV67893.1| flagellar L-ring protein [Desulfohalobium retbaense DSM 5692]
          Length = 229

 Score =  218 bits (554), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 74/243 (30%), Positives = 107/243 (44%), Gaps = 21/243 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           MY+Y  IV C  +L  GC          PQ  P  +                        
Sbjct: 1   MYKYI-IVFCVFALACGCAPKHE-----PQWGPEAN---------APQKVVPQKPQRASQ 45

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SLW    A LF D++A   GDI+TV I    QA  D  T   R +S+   ++  F +  
Sbjct: 46  GSLWNTGEANLFSDNKAQAPGDIVTVSISEQAQASKDATTDTGRTSSVDAGINNLFGIPN 105

Query: 121 QQTPQMNGNLN------YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
            Q    N N++       +   +  G G  SR   L+  IA  V   L NGNL I G + 
Sbjct: 106 SQALLSNPNVDLKNLVGANFNNSFVGSGETSRNANLSATIATQVIEQLPNGNLRIFGRKR 165

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           V VN+E   + ++GIVRP+D+ A N V    + +A I+Y G+G  ++  +P    +LI+N
Sbjct: 166 VMVNNEEEFIGLSGIVRPEDISAQNVVDSSYVLDAEITYTGRGAISDKQKPGWLMRLIDN 225

Query: 235 LSP 237
           + P
Sbjct: 226 VWP 228


>gi|58039744|ref|YP_191708.1| flagellar basal body L-ring protein [Gluconobacter oxydans 621H]
 gi|81351941|sp|Q5FRE4|FLGH_GLUOX RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|58002158|gb|AAW61052.1| Flagellar L-ring protein flgH [Gluconobacter oxydans 621H]
          Length = 248

 Score =  218 bits (554), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 84/228 (36%), Positives = 125/228 (54%), Gaps = 4/228 (1%)

Query: 14  LLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAAL 71
           +L  C+S   +SEI   P+M+ +      N+  P             ++ SLWR    A 
Sbjct: 20  VLSACNSLAQMSEIGRPPRMTSITDPTLANSYRPVTMPMPPLQAPPDEAASLWRSGSKAF 79

Query: 72  FKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLN 131
           FKD RA  VGD++T+ + I D A F+N T   R       +   F + G+    + G  +
Sbjct: 80  FKDQRASQVGDLVTIIVDITDNAAFNNGTTADRTADEKFGIPNLFGIKGKVISAITGADS 139

Query: 132 YDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
                +S     G I+R E + L +A  +T +L NGN ++ G QEVRVN E+R L V+GI
Sbjct: 140 LSTASSSDSGATGKITRNETVTLRLAGTITQVLPNGNFVVMGKQEVRVNSELRELGVSGI 199

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           VRPQD+ A N+V++D++AEARISYGG+G  T+L  P  G Q+++ + P
Sbjct: 200 VRPQDITADNTVTHDRMAEARISYGGRGTLTQLQTPRYGQQVMDAILP 247


>gi|218778844|ref|YP_002430162.1| flagellar L-ring protein [Desulfatibacillum alkenivorans AK-01]
 gi|218760228|gb|ACL02694.1| Flagellar biosynthesis, basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein
           [Desulfatibacillum alkenivorans AK-01]
          Length = 242

 Score =  217 bits (553), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 62/243 (25%), Positives = 110/243 (45%), Gaps = 11/243 (4%)

Query: 2   YRYSFIVLCYSSLLF-GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
            R   I+L     L  GC +   +    P      S+      M         +      
Sbjct: 3   MRLGIIILAIVLALSMGCATQRQDTLANPA----PSAATAPQHMLEQPATVTYNAPRPAE 58

Query: 61  YSLW-RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SLW     +  F D RA  VGD++T+ I     A    +T  +R++S+   ++      
Sbjct: 59  GSLWVDPGGSQFFGDRRARQVGDLVTIRITETPTASLTAKTTTTRDSSVSADVTDLAGYM 118

Query: 120 -----GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
                  +  + +  L+     + +G+G+  R+  +   ++  V  ++ NGNL ISGS+ 
Sbjct: 119 TWLEAANKNLKGDSLLSAGYKPSFTGQGTNDRSGSVTAYVSGRVVGVMANGNLQISGSRA 178

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           ++VN+E + + ++GIVRP+D+D  N V    IA+ARI Y GKG   +   P  G +++++
Sbjct: 179 IKVNNETQYMTISGIVRPEDIDPSNVVQSTYIADARIEYYGKGVIADKQIPGWGTRVLDH 238

Query: 235 LSP 237
           + P
Sbjct: 239 VWP 241


>gi|90422614|ref|YP_530984.1| flagellar basal body L-ring protein [Rhodopseudomonas palustris
           BisB18]
 gi|90104628|gb|ABD86665.1| flagellar L-ring protein [Rhodopseudomonas palustris BisB18]
          Length = 234

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 92/237 (38%), Positives = 140/237 (59%), Gaps = 6/237 (2%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           + R   + +     L GC ++++E+   P MSP+G  L  + R          S   +  
Sbjct: 3   LMRLP-VAVTACLALAGCANNLAELGQAPAMSPIGQGLYADARAI---PVEPRSRYAQNR 58

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           YSLW +    L++D RA  VGD+LTV I ++D+A  DN+T RSR++    K +   + F 
Sbjct: 59  YSLWNE-RRDLYRDPRASRVGDLLTVTISMNDKATLDNKTDRSRDSETKFK-TNYLAEFL 116

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
             + +     N D   ++ G G I R E++   +AA V  +L NGNL+I+GSQEVRVN E
Sbjct: 117 PWSSKGKLEANVDSQTSTKGTGKIDRTEEVKFSVAAAVVDVLPNGNLLIAGSQEVRVNYE 176

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +R L+V GIVRP D+  +N+++Y+K+AEARISYGG+GR  E+ +P  GHQ+ + + P
Sbjct: 177 MRVLHVGGIVRPLDITRNNTIAYEKVAEARISYGGRGRLMEVQQPAWGHQVYDQVVP 233


>gi|144897834|emb|CAM74698.1| Flagellar L-ring protein [Magnetospirillum gryphiswaldense MSR-1]
          Length = 251

 Score =  217 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 85/250 (34%), Positives = 130/250 (52%), Gaps = 13/250 (5%)

Query: 1   MYRYSFI----VLCYSSLLFGCH--SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNS 54
           M     +    +      L  C+  S +SE+   P +S +          P +    +  
Sbjct: 1   MISRILLRTTVIALAVGSLSACNALSRLSEVGSGPTVSKIEDPTQRAGYQPVVMPMPQPV 60

Query: 55  DSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRI-DDQAVFDNQTGRSRNNSLHRKLS 113
              + + SLWR    A FKD RA  +GDILTV + I ++ A F+++  RSR    +  ++
Sbjct: 61  APPQNANSLWRPGSRAFFKDQRAKEIGDILTVAVAITNETASFESKLTRSREAEENAGIT 120

Query: 114 GGFSLFGQQTPQMNGNLNYDG------GGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
           G           +   +N            ++  G   R E L + +AAI+T +L NGNL
Sbjct: 121 GLLGFENSLNKILPDAVNPATLVGSTGTSTNTNSGKTERNESLTVSLAAIITQVLPNGNL 180

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
           +I+G QE+RVN E+R LNV GI+RP+D+ + NSV+YDKIAEARI YGG+G  ++L +P  
Sbjct: 181 VIAGKQEIRVNYEMRELNVQGIIRPEDISSANSVTYDKIAEARIYYGGRGVNSDLTQPRY 240

Query: 228 GHQLIENLSP 237
           G QL++ + P
Sbjct: 241 GQQLLDVILP 250


>gi|254502121|ref|ZP_05114272.1| flagellar L-ring protein FlgH [Labrenzia alexandrii DFL-11]
 gi|222438192|gb|EEE44871.1| flagellar L-ring protein FlgH [Labrenzia alexandrii DFL-11]
          Length = 231

 Score =  217 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 97/232 (41%), Positives = 140/232 (60%), Gaps = 2/232 (0%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
            +V   + LL GC   + +I   P+M+P+G  L  N       +   +    K   SLWR
Sbjct: 1   MLVSLGAVLLSGCAGQLEDIGRAPEMTPVGYGL-ANRPATVYPLGTFSKGGIKDYNSLWR 59

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
           +     F D RA  +GD+LTV I+IDD+A  DN + R R+  +    S         +  
Sbjct: 60  NDRENFFADPRAKKIGDVLTVVIQIDDRAELDNTSERGRSADIGIGGSYSAGSNNSTSGG 119

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
               LN + G +S+G GSI R+E++ L +AAIV   L NGN++ISGSQEVRVN E+R LN
Sbjct: 120 -EAELNGNSGSSSAGSGSIDRSEEIELSVAAIVIDRLPNGNMVISGSQEVRVNYEMRILN 178

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           V GIVRP+D++++N++ YDKIAEARISYGG+GR +E+ +P  G Q+ + ++P
Sbjct: 179 VGGIVRPRDIESNNTIPYDKIAEARISYGGRGRISEVQQPGWGQQIYDIVTP 230


>gi|99082798|ref|YP_614952.1| flagellar basal body L-ring protein [Ruegeria sp. TM1040]
 gi|99039078|gb|ABF65690.1| Flagellar L-ring protein precursor [Ruegeria sp. TM1040]
          Length = 245

 Score =  217 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 86/245 (35%), Positives = 127/245 (51%), Gaps = 10/245 (4%)

Query: 2   YRYSFIVLCYSSLLF---GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
            +    V C    L    GC   +  +   P  +P   + +    +         +    
Sbjct: 1   MKPLLAVKCAVLGLSLVGGCA-RMDHLGKPPSFTPANETQEHVAMLYQGLPVSSQTPRAV 59

Query: 59  KSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
            + SLW  S  +L  D RA   GDILTV I I+++A   N T RSRN+S   ++     L
Sbjct: 60  DNASLWSGSRGSLLGDRRATKKGDILTVVIEINEKASISNDTQRSRNSSESLQVPQLLGL 119

Query: 119 FGQQTPQMNGN------LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
             +   ++         ++     +S G GS+SR+EKL L +AA V  +L NG L ISGS
Sbjct: 120 PQRLDERLPEGASSADLVDLGSTSSSGGSGSVSRSEKLELRVAATVVDVLPNGVLAISGS 179

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           QE+RVN E+R L V+G VRP D+   N V+YDKIA AR+SYGG+G+ T++ +P  G Q++
Sbjct: 180 QELRVNFELRELLVSGYVRPDDISRQNEVTYDKIASARVSYGGRGQITDVQQPRYGQQVL 239

Query: 233 ENLSP 237
           + + P
Sbjct: 240 DAVLP 244


>gi|222084869|ref|YP_002543398.1| flagellar L-ring protein [Agrobacterium radiobacter K84]
 gi|221722317|gb|ACM25473.1| flagellar L-ring protein [Agrobacterium radiobacter K84]
          Length = 238

 Score =  217 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 121/240 (50%), Positives = 158/240 (65%), Gaps = 4/240 (1%)

Query: 1   MYRYSFIVLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
           M           ++L GC S  ++ E+   P MSP+GS L +  + P +    K      
Sbjct: 1   MNMRLTATCAIVAVLAGCQSPQALKELGRAPAMSPIGSGL-QYAQTPQMSQYPKRPHQVA 59

Query: 59  KSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + YSLW DS AALFKD+RALNVGDILTV I+I+D+A +DN+T R+R N           +
Sbjct: 60  QGYSLWNDSQAALFKDARALNVGDILTVTIQINDKANWDNETNRNRTNKSDMNWDISAKI 119

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
           FG   P  N +       ++  KG + R+E++NLL+AA+VT ILENGNL+ISGSQEVR+N
Sbjct: 120 FG-WKPATNADATSGSDTSTDSKGKMQRSEQINLLVAAVVTGILENGNLMISGSQEVRMN 178

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            EIR LNV GIVRPQDV A N++SYDKIAEARISYGG+GR TE+ +PP+G Q ++ LSPL
Sbjct: 179 QEIRILNVAGIVRPQDVTADNTISYDKIAEARISYGGRGRLTEIQQPPVGQQAVDLLSPL 238


>gi|170748103|ref|YP_001754363.1| flagellar L-ring protein [Methylobacterium radiotolerans JCM 2831]
 gi|170654625|gb|ACB23680.1| flagellar L-ring protein [Methylobacterium radiotolerans JCM 2831]
          Length = 232

 Score =  216 bits (551), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 99/237 (41%), Positives = 144/237 (60%), Gaps = 6/237 (2%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R     +   + L  C + + EI   P +SP+G  +D N+           +   +  
Sbjct: 1   MKR--LAAIAALTTLGACATPVQEIGRAPALSPVGLGIDPNHDA---VPPLAVASQAQGY 55

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           +S W    A LF+D RA NVGD+LTV I ++D+A FDN T RSR++     L   F LFG
Sbjct: 56  HSTWAQQSADLFQDPRAKNVGDVLTVLIAMNDKAQFDNATDRSRDSRAKTSLDLQFDLFG 115

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
             TP+   +   +G  ++ G+G+I R E+L L +AA+VT +  NGN++ISGSQEVRVN E
Sbjct: 116 -LTPESKNHYEVNGNSSTKGQGTIDRKEQLRLSVAAVVTHVFPNGNMLISGSQEVRVNFE 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +R LN+ GIVRP+D+   N++ YDKIAEAR+SYGG+GR  E+ +P +  Q+ + +SP
Sbjct: 175 VRVLNIAGIVRPRDISRRNTIDYDKIAEARVSYGGRGRLMEVQQPAVAQQVYDLVSP 231


>gi|326404067|ref|YP_004284149.1| flagellar L-ring protein [Acidiphilium multivorum AIU301]
 gi|325050929|dbj|BAJ81267.1| flagellar L-ring protein [Acidiphilium multivorum AIU301]
          Length = 253

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 77/242 (31%), Positives = 125/242 (51%), Gaps = 8/242 (3%)

Query: 4   YSFIVLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
           +        SLL GC +  +++ +   P M+P+ +     +  P          +  +  
Sbjct: 11  FRLAAFGLVSLLEGCGTFSNLAYVGHAPPMTPITNPTKAPSWRPVSMPMPPLRRAPTEPD 70

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG- 120
           SLWR    A FKD RA  VGDI+T+ I I+D A   +QT   R  S    +   F L   
Sbjct: 71  SLWRRGARAFFKDQRASQVGDIITILININDAATLKDQTTLGRTGSESLGVPNLFGLESL 130

Query: 121 -----QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
                 ++   +  ++    G S+G G I R E ++L +A  +T +L +GN ++   QE+
Sbjct: 131 IPRVLGKSVNPSSLVSLSSAGNSTGTGQIQRNESVSLSLAGEITQVLPDGNFVVVARQEM 190

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
           RVN E+R L V+GI RPQD+  +N++  +++AEARISYGG+G  +    P  G Q+++++
Sbjct: 191 RVNHELRVLTVSGICRPQDISGNNTIQSNQLAEARISYGGRGIVSGEQSPRYGQQVLDDI 250

Query: 236 SP 237
            P
Sbjct: 251 VP 252


>gi|77918758|ref|YP_356573.1| flagellar biosynthesis, basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein [Pelobacter
           carbinolicus DSM 2380]
 gi|77544841|gb|ABA88403.1| flagellar biosynthesis, basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein [Pelobacter
           carbinolicus DSM 2380]
          Length = 231

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 70/244 (28%), Positives = 112/244 (45%), Gaps = 21/244 (8%)

Query: 1   MYR--YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
           M R   ++ VL    +L GC +    +   P  +P+                    +  +
Sbjct: 1   MKRSMRTWAVLPILLMLVGCVTQ-RIVEPQPHSAPI-------------AARQVQPEQPQ 46

Query: 59  KSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
              SLW +   +LF+D++A  VGDI+TV I     A     T   R++S+   L+  F +
Sbjct: 47  APGSLWTEGRGSLFRDNKARRVGDIVTVAIYEQASASKQASTATGRSSSMSAGLTNLFGI 106

Query: 119 FGQQTP-----QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
            G              ++     A  G GS SR E L   + A V   L NGNL I+G +
Sbjct: 107 EGNIGNLNKFIDPTSLIDTSYENAFDGSGSTSRKEDLVATLTAQVIEELPNGNLCIAGGK 166

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
            V VN E + + + GI+RP+D+ A N VS   I +A+I+Y GKG  ++  RP    ++++
Sbjct: 167 TVTVNREDQIILLEGIIRPEDISARNVVSSKHILDAKIAYTGKGVISDKQRPGWMTRVLD 226

Query: 234 NLSP 237
           ++ P
Sbjct: 227 HIWP 230


>gi|206889518|ref|YP_002249846.1| flagellar L-ring protein FlgH [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|254789285|sp|B5YIX2|FLGH_THEYD RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|206741456|gb|ACI20513.1| flagellar L-ring protein FlgH [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 238

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 63/251 (25%), Positives = 103/251 (41%), Gaps = 28/251 (11%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +   I LC    L  C S + E+  I           +N  MP               
Sbjct: 1   MRKLILISLCI-FFLASC-SELQEVRDI-----------KNAGMPPKYYPEPPQTQVASE 47

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL-- 118
            SLWR + A+L++D +A  V D++T+ I     A     T  SR++S +  L   F +  
Sbjct: 48  GSLWR-NKASLYEDKKARRVNDLVTILINESTSAQKTASTTASRDSSTNYGLDTFFGMNT 106

Query: 119 ------------FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGN 166
                       F +     + ++         G G  +R  K+   I A V  +L NGN
Sbjct: 107 DFNIHNLPLINGFYKAGNVFSPSVKGSATSDFKGDGDTARTGKITGTITAKVVEVLPNGN 166

Query: 167 LIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPP 226
           L+I   +EV VN+E   L + GI+RP D+   N++    +A+A+I   G+G   +     
Sbjct: 167 LVIESRKEVIVNNEKEILVLRGIIRPDDISQSNTILSQYVADAQIYLVGEGTLGDKQSQG 226

Query: 227 IGHQLIENLSP 237
              + ++ + P
Sbjct: 227 WLVRFLDKIWP 237


>gi|192359552|ref|YP_001982397.1| flagellar L-ring protein FlgH [Cellvibrio japonicus Ueda107]
 gi|190685717|gb|ACE83395.1| flagellar L-ring protein FlgH [Cellvibrio japonicus Ueda107]
          Length = 229

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 53/240 (22%), Positives = 95/240 (39%), Gaps = 18/240 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M ++  +++   SLL GC  +   I   P  +P  +S                S   +  
Sbjct: 6   MCKW-LLMVSAVSLLIGCGGNRKPIADDPAYAPTIAS--------------NMSVPQRTE 50

Query: 61  YSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL++D +  +LF D +A  VGD++TV +     +   +     + + ++          
Sbjct: 51  GSLYQDVYGVSLFNDRKAHFVGDVITVTLSERTVSRKSSGVTTGKKSGVNFNAGPLLG-A 109

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                               G     ++  L   I   V  IL NGNLI+ G + + +N 
Sbjct: 110 NPTIKDRELTTTLTQDRTFDGSADADQSNSLQGNITVTVAEILPNGNLIVRGEKWITLNR 169

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSPL 238
               + ++GIVRP+D+   N++   ++A A+ISY G G      +     +   + L PL
Sbjct: 170 GDEFIRISGIVRPEDIAPDNTIVSTRLANAKISYSGTGELANAQKMGWLSRFFNSDLWPL 229


>gi|163738058|ref|ZP_02145474.1| flagellar L-ring protein [Phaeobacter gallaeciensis BS107]
 gi|161388674|gb|EDQ13027.1| flagellar L-ring protein [Phaeobacter gallaeciensis BS107]
          Length = 246

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 86/246 (34%), Positives = 123/246 (50%), Gaps = 10/246 (4%)

Query: 1   MYRYSFIV---LCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDST 57
           M   + +    L     L  C   +  +   P  SP   S +    +         +   
Sbjct: 1   MKNKTLLANTALAAMVALSAC-GRLDHVGKPPTFSPANESPEHVAMLFQGLPVNTQNQRP 59

Query: 58  KKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
               SLW  S  +L  D RA   GDILTV I ID++A   N T RSR+ S    +     
Sbjct: 60  VDQASLWSGSRQSLLGDRRATKQGDILTVVIEIDEEAEISNDTKRSRSGSESLAVPQLLG 119

Query: 118 LFGQQTPQMNGNLNYDGG------GASSGKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
           L  +   ++    +           +S GKGS+ R+EKL L +AA V  +L NG L ISG
Sbjct: 120 LPQRLDRKLPEGASMADAVDIGSSSSSGGKGSVKRSEKLELRVAATVVDVLPNGVLSISG 179

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           +QE+RVN E+R L VTG VRP D+   N ++YDKIA AR+SYGG+G+ T++ +P  G Q+
Sbjct: 180 TQELRVNFEMRELLVTGYVRPDDISRQNEITYDKIASARVSYGGRGQITDVQQPRYGQQV 239

Query: 232 IENLSP 237
           ++ + P
Sbjct: 240 LDVILP 245


>gi|56460249|ref|YP_155530.1| flagellar basal body L-ring protein [Idiomarina loihiensis L2TR]
 gi|81363527|sp|Q5R0P9|FLGH_IDILO RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|56179259|gb|AAV81981.1| Flagellar basal body L-ring protein [Idiomarina loihiensis L2TR]
          Length = 224

 Score =  215 bits (548), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 58/237 (24%), Positives = 102/237 (43%), Gaps = 18/237 (7%)

Query: 4   YSFIVLCYSSLLFGCH-SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
            S +    + +L GC  +    +   P  +P+         +P              + S
Sbjct: 2   RSLLFSLTALVLAGCVQTPHKPMPDDPYYAPVLPEERAQPVVP--------------TGS 47

Query: 63  LWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           L++D++A  L+ D +A  +GDI+TV +R    A     T  S+ ++        F     
Sbjct: 48  LFQDAYADNLYSDIKARRLGDIITVTLREQTTASKTATTETSKESTAELAAPTAFGRNIT 107

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
                  +   +G    SG GS  ++ +LN  I   V  +L NGNLI+ G + +R+N   
Sbjct: 108 VGGN-PLSAGINGTREFSGDGSSDQSNQLNGEITVTVIKVLPNGNLIVRGEKWMRINTGD 166

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
             + +TG++RPQD+ A N +   ++A ARI Y G G   ++       +   + + P
Sbjct: 167 EYIRLTGMIRPQDITAANQIPSTRVANARIEYSGTGSLAQVQEQGWLTRFFNSPIWP 223


>gi|218887606|ref|YP_002436927.1| flagellar basal body L-ring protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|226701917|sp|B8DQY1|FLGH_DESVM RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|218758560|gb|ACL09459.1| flagellar L-ring protein [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 238

 Score =  215 bits (547), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 67/250 (26%), Positives = 106/250 (42%), Gaps = 26/250 (10%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R      C   LL GC+++  +       SP+                 +  D+    
Sbjct: 1   MKRRLLAAGCAMLLLSGCNAARQQP------SPVPPVTQPQAYA-------EPEDTAANP 47

Query: 61  YSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL+ +S    LF D+RA  VGDI+ V +   D+A     T   + ++    +S  F   
Sbjct: 48  GSLYSESDSEFLFSDNRARRVGDIVLVKVVETDKAKNKADTTADKTSTNELGVSAFFGQS 107

Query: 120 GQQTPQMNGN------------LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
                 +N              L        S  G   R   +   IAA V  +L  G +
Sbjct: 108 SASINPINPAGPFSGAVGANPILGTSSTSKHSATGETKRESTVTTTIAARVLRVLPGGLM 167

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
            + G++E RVNDE + + V+G+VR +DV + NSV+  ++A ARI Y GKG   +  +P  
Sbjct: 168 EVEGARETRVNDETQYIVVSGLVRARDVSSDNSVTSSQMANARIEYYGKGTLADKQKPGW 227

Query: 228 GHQLIENLSP 237
             +L++N+ P
Sbjct: 228 FTRLMDNVWP 237


>gi|88911315|sp|Q748F4|FLGH_GEOSL RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|298507076|gb|ADI85799.1| flagellar L-ring lipoprotein FlgH [Geobacter sulfurreducens KN400]
          Length = 226

 Score =  215 bits (547), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 64/244 (26%), Positives = 104/244 (42%), Gaps = 26/244 (10%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R +  ++C +  L GC    +E+                 R P      + +  +  +
Sbjct: 1   MKRLAMSIICLA--LAGCAVEKTEV-----------------RTPTFDEQLRPAPPSYAN 41

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            S+W+ S   L  D +A + GDI+TV I     A  +  T   R   +   +     L  
Sbjct: 42  GSIWQASTTGLAVDHKARSRGDIITVLIVEQASASKEATTDTERKAEVSASVPYLMGLEK 101

Query: 121 Q-------QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                        N  L         G G+ +R E L   + A +T +L NGN +I G +
Sbjct: 102 SSTLFSKLTNANPNNLLGASTNSKYEGSGATTRKENLLATMTAKITDVLPNGNFLIEGRR 161

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
            V+VN+E + L + G +RP+DV   N++S   IA+ARISY G G  ++  RP     +++
Sbjct: 162 NVKVNNEDQILVLQGTIRPRDVSPDNTISSTMIADARISYTGNGVISDRQRPGWLMNILD 221

Query: 234 NLSP 237
            + P
Sbjct: 222 YIWP 225


>gi|182680544|ref|YP_001834690.1| flagellar L-ring protein [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182636427|gb|ACB97201.1| flagellar L-ring protein [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 344

 Score =  214 bits (546), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 102/237 (43%), Positives = 138/237 (58%), Gaps = 4/237 (1%)

Query: 3   RYSFIVLCY-SSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
           R+SF  +   S  L GC   I E+   P MS +G+ L    +     +    S +  +  
Sbjct: 111 RFSFAFVALGSVALAGCAGDIRELGREPAMSALGTGLAARVQPSATAVFQNASMTRPQ-- 168

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           S+W  S   +F D RA  +GD++TV I I+D A F N T RS    ++        L  Q
Sbjct: 169 SIWNGSRTDIFSDPRAARIGDVVTVMIFINDHATFGNNTDRSLEAKINTGFDYKLGLSNQ 228

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
              Q    +  D   ++ G+G+I R+EK+ L +AA+VT +L NGNLIISGSQEVRVN E+
Sbjct: 229 TI-QFKPTITSDILSSTQGQGAIDRSEKMQLSVAAVVTDVLPNGNLIISGSQEVRVNFEL 287

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           R LNV GIVRPQD+   N+VSYDKIAEARISYGG+GR  E+ +P IG Q+ +   P+
Sbjct: 288 RLLNVAGIVRPQDIAKDNTVSYDKIAEARISYGGRGRIMEVQQPAIGQQIYDRFKPI 344


>gi|254785375|ref|YP_003072804.1| flagellar L-ring protein FlgH [Teredinibacter turnerae T7901]
 gi|237685159|gb|ACR12423.1| flagellar L-ring protein FlgH [Teredinibacter turnerae T7901]
          Length = 234

 Score =  214 bits (546), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 53/240 (22%), Positives = 97/240 (40%), Gaps = 20/240 (8%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
           R     L    LL GC      +   P  +P+              +  K +    ++ S
Sbjct: 9   RLCATALFGGWLLAGCVGQ-PPLPDDPYYAPV--------------MQPKPAPDMPQNGS 53

Query: 63  LWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL--- 118
           L+ +S A +LF D +A  VGDI+ V ++    +   +     +NN +    S G  +   
Sbjct: 54  LFAESTAMSLFNDRKATRVGDIINVVLQERTTSSKSSNMDLKKNNDVSVGGSAGDPVVFG 113

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                  +    +        G+    ++ +L   I+  V  +  NG L++ G + + +N
Sbjct: 114 TVPGLGNLGLTADLSSAKEFKGEAGADQSNQLTGNISVTVVDVYPNGTLLVRGEKWITLN 173

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
                + ++G+VRP DV+  N+V   K+A ARI+Y G G   +  +     +   N + P
Sbjct: 174 QGNEYIRLSGLVRPDDVEPDNTVVSTKLANARITYSGTGEFADSQQMGWLTRFFHNPVWP 233


>gi|170741840|ref|YP_001770495.1| flagellar L-ring protein [Methylobacterium sp. 4-46]
 gi|168196114|gb|ACA18061.1| flagellar L-ring protein [Methylobacterium sp. 4-46]
          Length = 232

 Score =  214 bits (545), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 93/237 (39%), Positives = 130/237 (54%), Gaps = 6/237 (2%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R         + L  C   +  I   P ++P+G+ L               +   +  
Sbjct: 1   MKRLLTC--AAVAGLGACAQPLDPIGRPPLLTPIGTGLAAPRE---PLPASFAATPRRSY 55

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            S W    A LF+D RA N+GD++TV I I+D+A FDN T RSR+          + + G
Sbjct: 56  SSTWAPGAADLFQDPRARNIGDVITVSISINDKAQFDNATDRSRSQKSSLGFDFSYGVSG 115

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
            +      +     G  + G G+I R E L+L +AA+VT  L NGNL+ISGSQEVRVN E
Sbjct: 116 VKD-SATADAGIRSGTETKGNGTIDRKENLSLSVAAVVTDTLPNGNLLISGSQEVRVNSE 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +R L V GIVRP+D+   N++ YDKIAEARISYGG+GR T++  P IG ++ E ++P
Sbjct: 175 VRVLTVAGIVRPRDITRKNTIDYDKIAEARISYGGRGRITDVQDPTIGQRVFETVTP 231


>gi|68164543|gb|AAY87272.1| predicted flagellar basal body L-ring protein [uncultured bacterium
           BAC17H8]
          Length = 229

 Score =  214 bits (544), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 61/242 (25%), Positives = 111/242 (45%), Gaps = 17/242 (7%)

Query: 1   MYRYS--FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
           M R     ++LC + +  GC + +     +P               P         +   
Sbjct: 1   MRRLFAAILLLCAAGIASGCSTYVENEASLP-------------FEPIYPSAHVTPEGEA 47

Query: 59  KSYSLWRDSHAALF-KDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS-GGF 116
            +  +++ +   LF  D RA +VGDILTV +     A        ++N++    L  G  
Sbjct: 48  PTGGIFKSNGGGLFASDIRARDVGDILTVALNETFAATKAQTAASAKNDAFGVTLPTGLP 107

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
           +LF     +    LN     + +G GS +++  L  L+   VT + +NGN+ I+G +++ 
Sbjct: 108 NLFTGGYDKNAAGLNAGTARSFAGSGSAAQSNSLTGLLTVTVTRVFDNGNMEIAGQKKLT 167

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N+    + +TG++RP+D+ A N+V  ++IA+A I Y G G   +  R     + + N+S
Sbjct: 168 LNNGDEYVRLTGLIRPEDISATNTVQSNRIADAEIVYVGAGEIADSSRQGWLSRTLRNVS 227

Query: 237 PL 238
           PL
Sbjct: 228 PL 229


>gi|83594177|ref|YP_427929.1| flagellar basal body L-ring protein [Rhodospirillum rubrum ATCC
           11170]
 gi|110816540|sp|Q2RQF3|FLGH_RHORT RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|83577091|gb|ABC23642.1| Flagellar L-ring protein [Rhodospirillum rubrum ATCC 11170]
          Length = 255

 Score =  214 bits (544), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 79/229 (34%), Positives = 125/229 (54%), Gaps = 9/229 (3%)

Query: 18  CHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDS 75
           C++   +SEI   P MS + +     +  P          +     SLW     + FKD 
Sbjct: 26  CNTFKRLSEIGDGPAMSGVDNPTLRPDYRPVSMPMPAPMVAEPNPSSLWVPGARSFFKDQ 85

Query: 76  RALNVGDILTVDIRI-DDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLN--- 131
           RA  VGD+LTV + I +++A F N   R+R N     L+      G     +   ++   
Sbjct: 86  RAGEVGDLLTVIVDISNEKATFANNLSRTRGNKEGANLTSFLGFEGTLADVLPDGVDPAS 145

Query: 132 ---YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
              +      +G GS++R+E +++ +AA+V  IL NGN +I+G QEVRVN E+R L VTG
Sbjct: 146 LTSFGSDSKHTGNGSMARSETVSMRLAAVVLQILPNGNFVIAGKQEVRVNGELRELTVTG 205

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           ++RP+D+ + N++ + +IAEARISYGG+G  T+++ P  G Q+ + L P
Sbjct: 206 VIRPEDIRSDNTIFWHQIAEARISYGGRGTVTDMVEPRYGQQVYDILFP 254


>gi|89069816|ref|ZP_01157151.1| flagellar L-ring protein precursor [Oceanicola granulosus HTCC2516]
 gi|89044617|gb|EAR50733.1| flagellar L-ring protein precursor [Oceanicola granulosus HTCC2516]
          Length = 242

 Score =  214 bits (544), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 87/245 (35%), Positives = 122/245 (49%), Gaps = 13/245 (5%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK--- 58
            R   +      LL  C   +  +   P +SP  +  +    M           +     
Sbjct: 1   MRPILLSF---LLLAAC-GRLDHLGRPPPISPPRAGDEHIAMMTDALPLVDPVPAVAEPL 56

Query: 59  KSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
            + SLW     +L  D RA+  GDILTV I IDD+A   N T RSR+ S    +     +
Sbjct: 57  AAASLWTGERGSLLGDRRAVQRGDILTVVIEIDDRAEIQNSTSRSRSGSESLGIPQLLGI 116

Query: 119 FGQQTPQMN------GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
             +  P +         ++      S G GS+SR E+L L +AA +  +L NG L ISGS
Sbjct: 117 PQRVDPALPEGASLADAVSLTSNSFSDGDGSVSRNERLELRVAATILDVLPNGVLAISGS 176

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           QEVRVN E+R L V+G VRP+D+   N ++YDKIA ARISYGG+G  +++ +P  G QL 
Sbjct: 177 QEVRVNHELRELLVSGFVRPEDITRQNEITYDKIASARISYGGRGLISDVQQPRYGQQLA 236

Query: 233 ENLSP 237
           + L P
Sbjct: 237 DILLP 241


>gi|110816534|sp|Q3A5F4|FLGH_PELCD RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
          Length = 227

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 68/239 (28%), Positives = 110/239 (46%), Gaps = 19/239 (7%)

Query: 4   YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSL 63
            ++ VL    +L GC +    +   P  +P+                    +  +   SL
Sbjct: 2   RTWAVLPILLMLVGCVTQ-RIVEPQPHSAPI-------------AARQVQPEQPQAPGSL 47

Query: 64  WRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT 123
           W +   +LF+D++A  VGDI+TV I     A     T   R++S+   L+  F + G   
Sbjct: 48  WTEGRGSLFRDNKARRVGDIVTVAIYEQASASKQASTATGRSSSMSAGLTNLFGIEGNIG 107

Query: 124 P-----QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                      ++     A  G GS SR E L   + A V   L NGNL I+G + V VN
Sbjct: 108 NLNKFIDPTSLIDTSYENAFDGSGSTSRKEDLVATLTAQVIEELPNGNLCIAGGKTVTVN 167

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            E + + + GI+RP+D+ A N VS   I +A+I+Y GKG  ++  RP    ++++++ P
Sbjct: 168 REDQIILLEGIIRPEDISARNVVSSKHILDAKIAYTGKGVISDKQRPGWMTRVLDHIWP 226


>gi|119503647|ref|ZP_01625730.1| Flagellar basal body L-ring protein [marine gamma proteobacterium
           HTCC2080]
 gi|119460709|gb|EAW41801.1| Flagellar basal body L-ring protein [marine gamma proteobacterium
           HTCC2080]
          Length = 228

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 58/241 (24%), Positives = 103/241 (42%), Gaps = 19/241 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R     +     L GC    +++                   P   ID+ ++      
Sbjct: 1   MIRILLSTVALGITLVGCGGVETKV--------------HPAYAPIEPIDYADNREGTTP 46

Query: 61  YSLWRD-SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL+      +LF+D+RA ++GDI++V ++    A     T  S+ + +       F   
Sbjct: 47  ASLYNKRGGLSLFEDTRARSIGDIVSVVLQESTSAAKSADTDLSKGSDIGVDAPVLFGEP 106

Query: 120 GQQTPQMNGNLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                  + +L+          G+GS +++ +L   IA  V  +L NGNL++ G + +++
Sbjct: 107 FNFGGGDSYDLSQSIASEYGFQGQGSSNQSNRLQGAIAVQVAKVLPNGNLVVQGEKWIKL 166

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N     + + GI+RP+D+   N++    +A+ARISYGG G   E   P    +     SP
Sbjct: 167 NQGDEFIQLRGIIRPEDISPLNTIPSSLVADARISYGGTGIIEEANTPGWLTRFFT--SP 224

Query: 238 L 238
           L
Sbjct: 225 L 225


>gi|154253001|ref|YP_001413825.1| flagellar L-ring protein [Parvibaculum lavamentivorans DS-1]
 gi|154156951|gb|ABS64168.1| flagellar L-ring protein [Parvibaculum lavamentivorans DS-1]
          Length = 244

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 87/223 (39%), Positives = 124/223 (55%), Gaps = 11/223 (4%)

Query: 21  SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNV 80
            +S I   P  +P+ S               +      +  SLWR    A F+D RA  V
Sbjct: 26  RVSNIGKAPDFAPISSPATT-----IAMPMPEPEQIVYQPNSLWRSGSRAFFRDQRAARV 80

Query: 81  GDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG------ 134
           GDILTV I I D A  DN T RSR N+   +L   F             ++ D       
Sbjct: 81  GDILTVLIGIADSAKVDNSTKRSRANAEDAELGNLFGYENYLGKVFPDGVDNDNLARLGS 140

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
             +S+G GS+ R EK++L +AA+VT +L NGNL+I+G Q+VRVN E+R L VTGIVRP+D
Sbjct: 141 SSSSAGAGSVDRKEKIDLTVAAVVTQVLPNGNLVIAGRQQVRVNYEVRDLEVTGIVRPED 200

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +   N+V++ +IAEARI+YGG+G+ +++ +P  G QL + + P
Sbjct: 201 ISNTNTVAHTQIAEARIAYGGQGQISDVQQPRYGQQLFDIIMP 243


>gi|315127350|ref|YP_004069353.1| flagellar basal body L-ring protein [Pseudoalteromonas sp. SM9913]
 gi|315015864|gb|ADT69202.1| flagellar basal body L-ring protein [Pseudoalteromonas sp. SM9913]
          Length = 227

 Score =  213 bits (542), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 61/240 (25%), Positives = 98/240 (40%), Gaps = 18/240 (7%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISE--ITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
            R   +    + LL GC S+ +   +   P  +PM                  N +    
Sbjct: 1   MRNIMLFAVGTLLLSGCVSTQNNEVVQDDPYYAPMYPE--------------PNMEPVVA 46

Query: 60  SYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + SL+       L+ D +AL  GDI+TV ++   QA    +T   +          G   
Sbjct: 47  TGSLFSTQLSNDLYADKKALRTGDIITVKLQESTQATKAAKTETDKQTDASLDPVIGLGG 106

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                   +         +  G    +++  L   I+  V  +L NGNL+I G + + +N
Sbjct: 107 LPVNIGGDSIQFGVGSDASFKGDSKSNQSNSLVGDISVNVMRVLPNGNLVIRGEKWLTLN 166

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI-ENLSP 237
                + + G+VRPQDV+A N+V  ++IA ARI Y GKG+T E   P    +    +L P
Sbjct: 167 TGEEFIRLEGLVRPQDVNADNTVESNRIANARIQYSGKGQTQEAQSPGWLTRFFSSSLFP 226


>gi|332533172|ref|ZP_08409041.1| flagellar L-ring protein FlgH [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332037454|gb|EGI73908.1| flagellar L-ring protein FlgH [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 227

 Score =  213 bits (542), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 59/240 (24%), Positives = 96/240 (40%), Gaps = 18/240 (7%)

Query: 2   YRYSFIVLCYSSLLFGCHSSI--SEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
            R   +    +  L GC S+     +   P  +PM                    +    
Sbjct: 1   MRNIILFAAGTLFLSGCMSTQNSEVVQDDPYYAPMYPE--------------PILEPLVA 46

Query: 60  SYSLWRD-SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + SL+   +   L+ D +AL  GDI+TV ++   QA    +T   +          G   
Sbjct: 47  TGSLFNTHTSNDLYSDKKALRTGDIITVKLQESTQATKAAKTETDKETDASLDPVIGLGG 106

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                   +         + +G    +++  L   I+  V  +L NGNL+I G + + +N
Sbjct: 107 LPVNIGGDSIQFGIGSDSSFTGDSKSNQSNSLVGDISVNVMRVLPNGNLVIRGEKWLTLN 166

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI-ENLSP 237
                + + G+VRPQDV A N+V  ++IA ARI Y GKG+T E   P    +    +L P
Sbjct: 167 TGEEFIRLEGLVRPQDVSADNTVESNRIANARIQYSGKGQTQEAQSPGWLTRFFSSSLFP 226


>gi|94500244|ref|ZP_01306777.1| Flagellar basal body L-ring protein [Oceanobacter sp. RED65]
 gi|94427543|gb|EAT12520.1| Flagellar basal body L-ring protein [Oceanobacter sp. RED65]
          Length = 223

 Score =  213 bits (541), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 51/239 (21%), Positives = 99/239 (41%), Gaps = 22/239 (9%)

Query: 1   MYRYSFIVLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
           M      +    ++L GC +   + E    P  +P+                       +
Sbjct: 1   MNNRFISLFAIMTILQGCSTIVPMDEKPDDPNFAPV--------------PAQSLKPPAE 46

Query: 59  KSYSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
            + S+++ ++  AL+ D R+  +GDI+T+ ++    A   N    ++++ +    +  F 
Sbjct: 47  NNGSIYQANYSMALYGDQRSRRIGDIVTIILQEQTNASKSNSASTTKDSEIDVVPTSIFG 106

Query: 118 LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                        +++   A  G G   ++  L   I   ++ IL NG L I G + + +
Sbjct: 107 QGLDFLQN-----DFEAERAFDGSGDADQSNSLQGQITVTISDILPNGVLEIRGEKWLSL 161

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           N     + V G++RPQD+ + N+V   K+A+ARISYGG G      +P    +   +  
Sbjct: 162 NQGDEFIRVKGLIRPQDISSDNTVLSHKLADARISYGGTGYVHNASKPGWLDRFFTSQW 220


>gi|328545501|ref|YP_004305610.1| flagellar L-ring protein H [polymorphum gilvum SL003B-26A1]
 gi|326415243|gb|ADZ72306.1| Flagellar L-ring protein H [Polymorphum gilvum SL003B-26A1]
          Length = 234

 Score =  213 bits (541), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 96/220 (43%), Positives = 133/220 (60%), Gaps = 2/220 (0%)

Query: 18  CHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRA 77
           C   ++E+   P MSP+G  L       F    F  S + K+  SLW       F D RA
Sbjct: 16  CAGQLNEVGREPTMSPVGYGLMAQPGAMFPLNTFSPS-ARKEYNSLWVSGREDFFSDPRA 74

Query: 78  LNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGA 137
             +GD+LTV I I+D+A  DN + R RN+S+           G  T       +     +
Sbjct: 75  RRIGDVLTVRIAINDKATLDNTSNRRRNSSIGFGGEASAGWDGSSTGGDAAL-DASSASS 133

Query: 138 SSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDA 197
           S+GKGSI R E++ L +AA+VT  L NGNL+ISGSQEVRVN E+R L+VTGIVRP+D+  
Sbjct: 134 STGKGSIDRKEEIALSVAAVVTDRLPNGNLVISGSQEVRVNYEMRVLHVTGIVRPRDIGG 193

Query: 198 HNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            N+++YDKIAEARISYGG+GR +E+ +P  G Q+++ ++P
Sbjct: 194 DNTIAYDKIAEARISYGGRGRISEIQQPGWGQQVLDIVTP 233


>gi|115523183|ref|YP_780094.1| flagellar basal body L-ring protein [Rhodopseudomonas palustris
           BisA53]
 gi|115517130|gb|ABJ05114.1| flagellar L-ring protein [Rhodopseudomonas palustris BisA53]
          Length = 234

 Score =  213 bits (541), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 88/238 (36%), Positives = 135/238 (56%), Gaps = 6/238 (2%)

Query: 1   MYRYSF-IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M      + L       GC +++++    P MSP+G  L  + R        +    T  
Sbjct: 1   MRCLRLSVALAACLASAGCANNLADFNQAPLMSPIGQGLQADARAI---PIERRGRFTPG 57

Query: 60  SYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            +SLW D    L++D RA  +GD+LTV I ++D+A  DN+T RSR++            F
Sbjct: 58  RHSLW-DERKDLYRDPRASRIGDLLTVTISMNDKATLDNKTDRSRDSKTKFDFDYLA-EF 115

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
              + +   + N +   ++ G G I R E++   +AA+V  +L NG+L+ISGSQEVRVN 
Sbjct: 116 LPLSKKGKLDANVNSQSSTKGTGKIDRTEEVKFSVAAVVVDVLPNGSLLISGSQEVRVNY 175

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           E+R L V GIVRP D+  +N+++Y+K+AEARISYGG+GR  E+ +P  GHQ+ + + P
Sbjct: 176 EMRVLTVGGIVRPLDITRNNTIAYEKVAEARISYGGRGRLMEVQQPAWGHQVYDQVVP 233


>gi|238919262|ref|YP_002932777.1| flagellar basal body L-ring protein [Edwardsiella ictaluri 93-146]
 gi|238868831|gb|ACR68542.1| flagellar L-ring protein FlgH, putative [Edwardsiella ictaluri
           93-146]
          Length = 228

 Score =  212 bits (540), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 59/237 (24%), Positives = 94/237 (39%), Gaps = 10/237 (4%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M ++S I L  +  L GC     +                    P   +  + + S  ++
Sbjct: 1   MQKHSGIALLCTLALSGCAYIPHDQV----------VTGPTTATPAPAVPPRPNGSIFQT 50

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
                  +  LF+D R  NVGDILT+ ++ +  A  ++    SR+ S     S       
Sbjct: 51  VQPINYGYQPLFEDRRPRNVGDILTIVLQENVSASKNSSANASRDGSSKFDFSTVPRYLE 110

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   N+  DG    SGKG           I   V  +  NGNL + G +++ +N  
Sbjct: 111 GLFGNARANMEVDGDNKFSGKGGAKANNTFTGTITVTVDQVQANGNLKVVGEKQIAINQG 170

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
              +  +G+V P+ +  +NSVS  ++A+ARI Y G G   E        +   NLSP
Sbjct: 171 TEYIRFSGVVNPRTISGNNSVSSTQVADARIEYVGSGYINEAQNMGWLQRFFLNLSP 227


>gi|116250486|ref|YP_766324.1| flagellar basal body L-ring protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115255134|emb|CAK06208.1| putative flagellar L-ring protein precursor (basal body L-ring
           protein) [Rhizobium leguminosarum bv. viciae 3841]
          Length = 238

 Score =  212 bits (540), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 125/224 (55%), Positives = 157/224 (70%), Gaps = 4/224 (1%)

Query: 17  GCH--SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKD 74
           GC   +++SEI   P MSP+GS L    + P + +  K   +  + YSLW DS AALFKD
Sbjct: 17  GCQSPTAVSEIGRAPAMSPIGSGL-AYGQTPQMALYPKQPRAVAQGYSLWSDSQAALFKD 75

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
           +RALNVGDILTVDI+I+D+A FDN+T RSR NS          +FG  TP+   +L Y  
Sbjct: 76  ARALNVGDILTVDIQINDKASFDNETNRSRTNSSGMNWDVNAQIFG-WTPESKTDLTYGS 134

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
             ++ GKG I R +KL LL+AA+VT ILENGNL+ISGSQEVR+N E+R LNV GIVRPQD
Sbjct: 135 DTSTDGKGKIERTDKLTLLVAAVVTGILENGNLVISGSQEVRLNQELRILNVAGIVRPQD 194

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           V+A N +SYDKIAEARISYGG+GR  E+ +PP G Q ++  SPL
Sbjct: 195 VNADNQISYDKIAEARISYGGRGRLMEVQQPPRGQQAVDLFSPL 238


>gi|163850067|ref|YP_001638110.1| flagellar L-ring protein [Methylobacterium extorquens PA1]
 gi|240137201|ref|YP_002961670.1| flagellar L-ring protein FlgH [Methylobacterium extorquens AM1]
 gi|254559213|ref|YP_003066308.1| flagellar L-ring protein FlgH [Methylobacterium extorquens DM4]
 gi|163661672|gb|ABY29039.1| flagellar L-ring protein [Methylobacterium extorquens PA1]
 gi|240007167|gb|ACS38393.1| flagellar L-ring protein FlgH [Methylobacterium extorquens AM1]
 gi|254266491|emb|CAX22255.1| flagellar L-ring protein FlgH [Methylobacterium extorquens DM4]
          Length = 235

 Score =  212 bits (539), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 94/237 (39%), Positives = 139/237 (58%), Gaps = 3/237 (1%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M   S  V   +  L  C S +  +   P ++P+G+ L+       L   F         
Sbjct: 1   MRPSSAAVAVLALSLGACQSDLDRLGRPPLLTPIGTGLNAP--REPLPTSFGALGPRHSY 58

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           +S W  + AAL++D RA +VGD++TV I I+D+A FDN + R R+         G+ + G
Sbjct: 59  HSTWSPASAALYQDPRARDVGDVITVSIAINDKAQFDNASERGRSQKSSLGFDFGYGISG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
            +      +     G  + G+GSI R E L+L +AA+VT +L NGN++ISGSQEVRVN+E
Sbjct: 119 LKD-TATADTGIRSGTETKGQGSIDRKESLSLSVAAVVTEVLPNGNVLISGSQEVRVNNE 177

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +R L V GIVRP+D+   N++ YDKIAEARISYGG+GR T++  P +G ++ E ++P
Sbjct: 178 VRVLEVAGIVRPRDISRKNTIDYDKIAEARISYGGRGRITDVQGPSLGQRVFETVAP 234


>gi|77464902|ref|YP_354406.1| flagellar basal body L-ring protein [Rhodobacter sphaeroides 2.4.1]
 gi|126463744|ref|YP_001044858.1| flagellar basal body L-ring protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|221640823|ref|YP_002527085.1| flagellar basal body L-ring protein [Rhodobacter sphaeroides KD131]
 gi|332559800|ref|ZP_08414122.1| FlgH2 [Rhodobacter sphaeroides WS8N]
 gi|77389320|gb|ABA80505.1| Flagellar L-ring protein [Rhodobacter sphaeroides 2.4.1]
 gi|126105408|gb|ABN78086.1| flagellar L-ring protein [Rhodobacter sphaeroides ATCC 17029]
 gi|221161604|gb|ACM02584.1| Flagellar L-ring protein precursor [Rhodobacter sphaeroides KD131]
 gi|332277512|gb|EGJ22827.1| FlgH2 [Rhodobacter sphaeroides WS8N]
          Length = 239

 Score =  212 bits (539), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 85/225 (37%), Positives = 114/225 (50%), Gaps = 6/225 (2%)

Query: 19  HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRAL 78
            + +SE+   P  +P   +   +        +   +       SLW    A+L  D RA 
Sbjct: 14  CARLSEVGKAPSFTPADDTFQYHAMYALPLPEDVANSGPTAGSSLWAGDRASLLGDRRAS 73

Query: 79  NVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF------GQQTPQMNGNLNY 132
             GDILTV I IDD+A   N TGRSR+      L   F L             M   ++ 
Sbjct: 74  RRGDILTVVIEIDDRAEISNSTGRSRSGGETLGLPSFFGLPQRIDRHLPDGASMADAVST 133

Query: 133 DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRP 192
                 +G GS+ R EK+ L +AA V   L NG L I G QEVRVN E+R L VTG VRP
Sbjct: 134 TSSSNYAGDGSVRRKEKMTLRVAATVVEELPNGVLRIQGQQEVRVNYELRELVVTGYVRP 193

Query: 193 QDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            D+   N ++YDKIAEARISYGG+G+ T++ +P  G Q+ + + P
Sbjct: 194 GDISRQNEITYDKIAEARISYGGRGQITDVQQPRYGQQVADIILP 238


>gi|46398395|gb|AAS91883.1| flagelle L-ring protein [Legionella pneumophila]
          Length = 230

 Score =  212 bits (539), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 61/234 (26%), Positives = 105/234 (44%), Gaps = 13/234 (5%)

Query: 1   MYRYSFIVLCYS-SLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R++    C +  LLFGC +               +  D  +  P   +     +  K 
Sbjct: 1   MNRFNIATTCLATVLLFGCEALHP-----------PAPGDNPDYAPTYPVTPDPKELRKV 49

Query: 60  SYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           S +++    A  LF+  RA + GDILTV +     A  +  T + +N++           
Sbjct: 50  SGAIYSSETALPLFETPRARHPGDILTVYLIEKTDAQKNATTTQRKNDTEKITNKLFLGR 109

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                   + + + D     +G+G   +  KL   I+  V  +L NGN+++ G + VR+N
Sbjct: 110 PISLGSGYSMDFDLDNQRQFNGEGRSIQNNKLAGSISVTVAKVLANGNMVVQGEKWVRIN 169

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
                + ++GIVRPQD+ A N+++ D+IA ARISYGG G+           +++
Sbjct: 170 QGNEFVRLSGIVRPQDIKADNTITSDRIANARISYGGTGQINNTNAQGWLSRIL 223


>gi|90021852|ref|YP_527679.1| Hpt sensor hybrid histidine kinase [Saccharophagus degradans 2-40]
 gi|89951452|gb|ABD81467.1| Hpt sensor hybrid histidine kinase [Saccharophagus degradans 2-40]
          Length = 230

 Score =  212 bits (539), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 57/236 (24%), Positives = 94/236 (39%), Gaps = 17/236 (7%)

Query: 4   YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSL 63
            + I +  S    GC        G P  +P+ S+  +                   + SL
Sbjct: 9   KALIAVNCSLFFSGCVVHQPVAPGDPYYAPVLSTSSQ--------------AQPPANGSL 54

Query: 64  WRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ 122
           +  + +  LF D +AL VGDI+TV ++    +   +  G  ++N + +  S  F      
Sbjct: 55  YSPNSSIDLFSDRKALRVGDIITVVLQERTSSKKSSNIGVKKDNDISQGSSTVFGTTPGL 114

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
                G  +  G     G+    ++ +L   I   V  +  NG L I G + + +N    
Sbjct: 115 GNLGLGL-DVQGEREFKGEADSDQSNQLTGSITVTVVEVYPNGTLSIRGEKWMTLNRGDE 173

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
            + V+G+VRP DV   N+V   KIA A ISY G+G   +  +     Q     + P
Sbjct: 174 FIRVSGLVRPDDVGPDNTVVSTKIANAHISYSGEGEFADSQKMGWLTQFFNGPIWP 229


>gi|89056682|ref|YP_512133.1| flagellar basal body L-ring protein [Jannaschia sp. CCS1]
 gi|123400875|sp|Q28JK4|FLGH_JANSC RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|88866231|gb|ABD57108.1| flagellar L-ring protein FlgH [Jannaschia sp. CCS1]
          Length = 244

 Score =  211 bits (538), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 89/243 (36%), Positives = 127/243 (52%), Gaps = 6/243 (2%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M    FI L +++        ++ +   P ++      +          D ++  S  + 
Sbjct: 1   MNMRVFIFLIFAAASVSACGRLASVGQTPNLTSPADGNEVFAMNVVPIPDARDVPSRTEG 60

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF- 119
            SLW    A+L  D RA   GDILTV I IDD A F N + R R+ S    +S  F L  
Sbjct: 61  ASLWTSGRASLLGDRRASLRGDILTVVIEIDDSAEFSNSSERERSGSEQMGISNLFGLPQ 120

Query: 120 -----GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
                  Q   +   +  D    SSG+G+I R E+L L +AA +T +L+NG L I GSQE
Sbjct: 121 RVDGLLTQGGSLGEAVELDSASRSSGEGAIRRNEQLTLRVAATITEVLQNGVLRIEGSQE 180

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           VRVN+E+R L VTG VRP+D+   N++ YD+IA ARISYGG+G  T+  RP  G ++ + 
Sbjct: 181 VRVNNEVRELLVTGYVRPEDISRQNAIEYDRIAAARISYGGRGLITDAQRPRYGQEIADT 240

Query: 235 LSP 237
           + P
Sbjct: 241 VLP 243


>gi|328470104|gb|EGF41015.1| flagellar basal body L-ring protein [Vibrio parahaemolyticus 10329]
          Length = 234

 Score =  211 bits (538), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 60/248 (24%), Positives = 95/248 (38%), Gaps = 29/248 (11%)

Query: 1   MYRYSFI-----------VLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGI 49
           M +   +                 LL GC      I   P            N   +   
Sbjct: 1   MMKLVMMKEKAMKWLSKSWAVAVVLLVGCAGRQEFIPPQP------------NAEEYAPP 48

Query: 50  DFKNSDSTKKSYSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSL 108
               +    +S SL+R  +   LF+D RA  VGD+LTV +  +  +     T   +++++
Sbjct: 49  KLDYTLPDAQSGSLYRHQYTMTLFQDRRAYRVGDVLTVVLSEETSSSKKAGTKFGKSSAV 108

Query: 109 HRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLI 168
           +                    ++ DG     G  S S+  KL   I   V  +L NG L 
Sbjct: 109 NFAAPTI-----GTKKFDELGVSIDGSRNFDGSASSSQGNKLQGAITVTVHDVLPNGVLR 163

Query: 169 ISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIG 228
           ISG + +R+N     + +TGIVR  D+  +N VS  +IA+ARI+Y G+G   +       
Sbjct: 164 ISGEKWLRLNQGDEFIRLTGIVRVDDITRNNQVSSQRIADARITYAGRGALADSNAAGWL 223

Query: 229 HQLIENLS 236
            Q   +  
Sbjct: 224 TQFFNSPW 231


>gi|308094857|ref|ZP_05893052.2| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AN-5034]
 gi|308095485|ref|ZP_05906193.2| flagellar L-ring protein FlgH [Vibrio parahaemolyticus Peru-466]
 gi|308125941|ref|ZP_05778271.2| flagellar L-ring protein FlgH [Vibrio parahaemolyticus K5030]
 gi|308126101|ref|ZP_05907787.2| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AQ4037]
 gi|308086264|gb|EFO35959.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus Peru-466]
 gi|308091837|gb|EFO41532.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AN-5034]
 gi|308109222|gb|EFO46762.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AQ4037]
 gi|308114954|gb|EFO52494.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus K5030]
          Length = 233

 Score =  211 bits (537), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 61/237 (25%), Positives = 94/237 (39%), Gaps = 18/237 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M   S        LL GC      I   P            N   +       +    +S
Sbjct: 11  MKWLSKSWAVAVVLLVGCAGRQEFIPPQP------------NAEEYAPPKLDYTLPDAQS 58

Query: 61  YSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL+R  +   LF+D RA  VGD+LTV +  +  +     T   ++++++          
Sbjct: 59  GSLYRHQYTMTLFQDRRAYRVGDVLTVVLSEETSSSKKAGTKFGKSSAVNFAAPTI---- 114

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                     ++ DG     G  S S+  KL   I   V  +L NG L ISG + +R+N 
Sbjct: 115 -GTKKFDELGVSIDGSRNFDGSASSSQGNKLQGAITVTVHDVLPNGVLRISGEKWLRLNQ 173

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
               + +TGIVR  D+  +N VS  +IA+ARI+Y G+G   +        Q   +  
Sbjct: 174 GDEFIRLTGIVRVDDITRNNQVSSQRIADARITYAGRGALADSNAAGWLTQFFNSPW 230


>gi|90577347|ref|ZP_01233158.1| flagellar L-ring protein precursor [Vibrio angustum S14]
 gi|90440433|gb|EAS65613.1| flagellar L-ring protein precursor [Vibrio angustum S14]
          Length = 222

 Score =  211 bits (537), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 61/236 (25%), Positives = 99/236 (41%), Gaps = 18/236 (7%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            +   ++LC+ S + GC      I   P            N   F   D   S    K  
Sbjct: 1   MKTLLMLLCFLSFVSGCAVREEFIPPEP------------NDAAFAPPDLDYSLPEAKHG 48

Query: 62  SLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           SL+R ++   LF+D RA  VGD+LTV++    Q+     T   +++S+            
Sbjct: 49  SLYRHNYSMTLFQDRRAYRVGDVLTVELDEQTQSSKKANTKFGKSSSIEFAAPTL----- 103

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                 + + +  G     G  + ++  KL   I   V  +L NG L+I G + +R+N  
Sbjct: 104 GNKTFDDLSASVSGDRGFDGTAASTQGNKLQGAITVTVHKVLPNGVLMIRGEKWIRLNQG 163

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
              + +TG+VR  DV+ HN VS  +I +ARI+Y G+G   +        Q   +  
Sbjct: 164 DEYIRLTGVVRVDDVNRHNQVSSQRIGDARITYSGRGALADSNAAGWLTQFFTSPW 219


>gi|51246535|ref|YP_066419.1| flagellar L-ring protein precursor (FlgH) [Desulfotalea
           psychrophila LSv54]
 gi|81641310|sp|Q6AJR8|FLGH_DESPS RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|50877572|emb|CAG37412.1| related to flagellar L-ring protein precursor (FlgH) [Desulfotalea
           psychrophila LSv54]
          Length = 231

 Score =  211 bits (537), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 72/242 (29%), Positives = 112/242 (46%), Gaps = 21/242 (8%)

Query: 2   YRYSFIVLCYSSL-LFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
            R    + C   L L GC+S    +  IP+                L      S +T+++
Sbjct: 4   RRIPLYLSCLFLLALSGCNSKRPPLVEIPE---------------PLEELQTMSPATRQA 48

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF- 119
            SLW  +  +LF D +A NVGDI+TV I     A  +  T   +++S+   +   F L  
Sbjct: 49  GSLWDSNQNSLFSDRKASNVGDIVTVLIEEKSSASKNASTKTGKDSSIGASIPNLFGLEK 108

Query: 120 ----GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
                     MN  +         G GS SR+  L+  ++  V     NG L I G +EV
Sbjct: 109 SSIIANNHIDMNNLIGASFKNDFKGAGSTSRSGTLSAALSTQVIVKYPNGQLKIRGGKEV 168

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
            VN+E++ + +TGI+RP D+ A N+++ DKI  ARISY GKG   +   P    + ++++
Sbjct: 169 MVNNEVQVIYLTGIIRPVDITAANTINSDKILNARISYTGKGALGDKQEPGWLTRSLDHV 228

Query: 236 SP 237
            P
Sbjct: 229 WP 230


>gi|114765242|ref|ZP_01444374.1| flagellar L-ring protein precursor [Pelagibaca bermudensis
           HTCC2601]
 gi|114542377|gb|EAU45405.1| flagellar L-ring protein precursor [Roseovarius sp. HTCC2601]
          Length = 253

 Score =  211 bits (536), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 83/251 (33%), Positives = 124/251 (49%), Gaps = 17/251 (6%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRM-----PFLGIDFKNSDS 56
            R +       ++L GC +        PQ+SP+G +  E         P    +      
Sbjct: 4   RRITLFTGSALTILVGCGT--PAFDRDPQLSPVGVNPSELAAARNVSVPMPPPEAVRVPY 61

Query: 57  TKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
             +  SLW    +  F D RA  VGDILT+ I IDD+A   N++ R+R  S        F
Sbjct: 62  RAEGASLWEQGSSGFFGDQRATQVGDILTIIIEIDDEASLSNESDRNRTGSSTLAFPKFF 121

Query: 117 SLFGQQTPQMNG----------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGN 166
               Q    + G           ++      ++G GSI R E ++L +AA+V   L NGN
Sbjct: 122 GYGTQIDKILPGVGPEDLPEGNLVDITSTTGAAGDGSIERNEAISLRMAALVVQQLPNGN 181

Query: 167 LIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPP 226
           L++ G QEV+VN+E+R L V+GI+RPQD++  NS+ YDK+AEARI YGG+G  +      
Sbjct: 182 LVVLGRQEVKVNEELRELRVSGIIRPQDINRDNSIPYDKMAEARIGYGGRGAISRQQTRG 241

Query: 227 IGHQLIENLSP 237
            G  +++ + P
Sbjct: 242 YGEDVMDIILP 252


>gi|153837030|ref|ZP_01989697.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AQ3810]
 gi|149749618|gb|EDM60363.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AQ3810]
          Length = 229

 Score =  211 bits (536), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 61/237 (25%), Positives = 94/237 (39%), Gaps = 18/237 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M   S        LL GC      I   P            N   +       +    +S
Sbjct: 7   MKWLSKSWAVAVVLLVGCAGRQEFIPPQP------------NAEEYAPPKLDYTLPDAQS 54

Query: 61  YSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL+R  +   LF+D RA  VGD+LTV +  +  +     T   ++++++          
Sbjct: 55  GSLYRHQYTMTLFQDRRAYRVGDVLTVVLSEETSSSKKAGTKFGKSSAVNFAAPTI---- 110

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                     ++ DG     G  S S+  KL   I   V  +L NG L ISG + +R+N 
Sbjct: 111 -GTKKFDELGVSIDGSRNFDGSASSSQGNKLQGAITVTVHDVLPNGVLRISGEKWLRLNQ 169

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
               + +TGIVR  D+  +N VS  +IA+ARI+Y G+G   +        Q   +  
Sbjct: 170 GDEFIRLTGIVRVDDITRNNQVSSQRIADARITYAGRGALADSNAAGWLTQFFNSPW 226


>gi|306841045|ref|ZP_07473769.1| flagellar basal body L-ring protein [Brucella sp. BO2]
 gi|306288934|gb|EFM60234.1| flagellar basal body L-ring protein [Brucella sp. BO2]
          Length = 242

 Score =  211 bits (536), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 100/225 (44%), Positives = 134/225 (59%), Gaps = 7/225 (3%)

Query: 17  GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSR 76
           GC +   EI   P +SP+ + L   N   F G   +   ++    SLW       FKD R
Sbjct: 20  GCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPARPGKASY---SLWDQRSTNFFKDPR 76

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL----FGQQTPQMNGNLNY 132
           A   GD+LTV I I+D+A  DN+T R R +       G F+            M+ ++N 
Sbjct: 77  AATPGDVLTVIISINDRANLDNKTDRERVSKGIYGGGGSFATSSITGAAAGGDMDASVNT 136

Query: 133 DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRP 192
                S GKG+I R+E + L IAAIVT  L NGNLII GSQEVRVN+E+R LNV G+VRP
Sbjct: 137 HSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVRVNNELRVLNVAGVVRP 196

Query: 193 QDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  SP
Sbjct: 197 RDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFSP 241


>gi|46398401|gb|AAS91886.1| flagelle L-ring protein [Legionella pneumophila]
          Length = 230

 Score =  211 bits (536), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 62/234 (26%), Positives = 106/234 (45%), Gaps = 13/234 (5%)

Query: 1   MYRYSFIVLCYS-SLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R +  V C + +LLFGC +               +  D  +  P   +     +  K 
Sbjct: 1   MNRLNIAVSCLATALLFGCEALHP-----------PAPGDNPDYAPTYPVTPDPKELRKA 49

Query: 60  SYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           S +++    A  LF+  RA + GDILTV +     A  +  T + +N++           
Sbjct: 50  SGAIYSSETALPLFETPRARHPGDILTVYLIEKTDAQKNATTTQRKNDTTKITNKLFLGR 109

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                   + + + D     +G+G   +  KL   I+  V  +L NGN+++ G + VR+N
Sbjct: 110 PISLGSGYSMDFDLDNQRQFNGEGRSIQNNKLAGSISVTVAKVLANGNMVVQGEKWVRIN 169

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
                + ++GIVRPQD+ A N+++ D+IA ARISYGG G+           +++
Sbjct: 170 QGNEFVRLSGIVRPQDIKADNTITSDRIANARISYGGTGQINNTNAQGWLSRIL 223


>gi|52841454|ref|YP_095253.1| flagellar basal body L-ring protein [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|148358809|ref|YP_001250016.1| flagellar L-ring protein FlgH [Legionella pneumophila str. Corby]
 gi|296106854|ref|YP_003618554.1| flagellar L-ring protein precursor FlgH [Legionella pneumophila
           2300/99 Alcoy]
 gi|81377650|sp|Q5ZW65|FLGH_LEGPH RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|166214822|sp|A5IBC0|FLGH_LEGPC RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|46398375|gb|AAS91873.1| flagelle L-ring protein [Legionella pneumophila]
 gi|46398377|gb|AAS91874.1| flagelle L-ring protein [Legionella pneumophila]
 gi|46398385|gb|AAS91878.1| flagelle L-ring protein [Legionella pneumophila]
 gi|46398393|gb|AAS91882.1| flagelle L-ring protein [Legionella pneumophila]
 gi|46398397|gb|AAS91884.1| flagelle L-ring protein [Legionella pneumophila]
 gi|46398399|gb|AAS91885.1| flagelle L-ring protein [Legionella pneumophila]
 gi|52628565|gb|AAU27306.1| flagellar L-ring protein FlgH [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|148280582|gb|ABQ54670.1| flagellar L-ring protein FlgH [Legionella pneumophila str. Corby]
 gi|295648755|gb|ADG24602.1| flagellar L-ring protein precursor FlgH [Legionella pneumophila
           2300/99 Alcoy]
          Length = 230

 Score =  211 bits (536), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 62/234 (26%), Positives = 106/234 (45%), Gaps = 13/234 (5%)

Query: 1   MYRYSFIVLCYS-SLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R +  V C + +LLFGC +               +  D  +  P   +     +  K 
Sbjct: 1   MNRLNIAVSCLATALLFGCEALHP-----------PAPGDNPDYAPTYPVTPDPKELRKV 49

Query: 60  SYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           S +++    A  LF+  RA + GDILTV +     A  +  T + +N++           
Sbjct: 50  SGAIYSSETALPLFETPRARHPGDILTVYLIEKTDAQKNATTTQRKNDTTKITNKLFLGR 109

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                   + + + D     +G+G   +  KL   I+  V  +L NGN+++ G + VR+N
Sbjct: 110 PISLGSGYSMDFDLDNQRQFNGEGRSIQNNKLAGSISVTVAKVLANGNMVVQGEKWVRIN 169

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
                + ++GIVRPQD+ A N+++ D+IA ARISYGG G+           +++
Sbjct: 170 QGNEFVRLSGIVRPQDIKADNTITSDRIANARISYGGTGQINNTNAQGWLSRIL 223


>gi|163742546|ref|ZP_02149932.1| flagellar L-ring protein precursor H [Phaeobacter gallaeciensis
           2.10]
 gi|161384131|gb|EDQ08514.1| flagellar L-ring protein precursor H [Phaeobacter gallaeciensis
           2.10]
          Length = 232

 Score =  211 bits (536), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 84/232 (36%), Positives = 119/232 (51%), Gaps = 7/232 (3%)

Query: 12  SSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAAL 71
              L  C   +  +   P  SP   S +    +         +       SLW  S  +L
Sbjct: 1   MVALSAC-GRLDHVGKPPTFSPANESPEHVAMLFQGLPVNTQNQRPVDQASLWSGSRQSL 59

Query: 72  FKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLN 131
             D RA   GDILTV I ID++A   N T RSR+ S    +     L  +   ++    +
Sbjct: 60  LGDRRATKQGDILTVVIEIDEEAEISNDTKRSRSGSESLAVPQLLGLPQRLDRKLPEGAS 119

Query: 132 YDGG------GASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
                      +S GKGS+ R+EKL L +AA V  +L NG L ISG+QE+RVN E+R L 
Sbjct: 120 MADAVDIGSSSSSGGKGSVKRSEKLELRVAATVVDVLPNGVLSISGTQELRVNFEMRELL 179

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           VTG VRP D+   N ++YDKIA AR+SYGG+G+ T++ +P  G Q+++ + P
Sbjct: 180 VTGYVRPDDISRQNEITYDKIASARVSYGGRGQITDVQQPRYGQQVLDVILP 231


>gi|126734109|ref|ZP_01749856.1| flagellar L-ring protein FlgH, putative [Roseobacter sp. CCS2]
 gi|126716975|gb|EBA13839.1| flagellar L-ring protein FlgH, putative [Roseobacter sp. CCS2]
          Length = 244

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 86/245 (35%), Positives = 132/245 (53%), Gaps = 10/245 (4%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDS--TK 58
           M +  F  +    L+ GC   +S+I   P+ SP   + +    +         + +    
Sbjct: 1   MCKGKFFAVVLMLLVTGCG--VSDIGTPPRFSPPAQNTERAAMLNPSMPTPIAASALGPS 58

Query: 59  KSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
              SLW  +  +L  D RA+  GDI+TV I IDD+A   N + RSR+ S    +   F +
Sbjct: 59  SHASLWTGARGSLLGDRRAMQRGDIMTVVIEIDDRAEISNSSDRSRSASQQAGVPQLFGI 118

Query: 119 FGQQTPQMNGN------LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
             +    +         ++ +   ++SG GS+ R E+L L +A  +T +L NG L I G 
Sbjct: 119 PQRINRALPEGASSAAIVDLNSQSSASGDGSVRRNERLTLRVAVTITDVLPNGVLAIVGQ 178

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           QEVRVN E+R L VTG VRP+D+   N ++YDKIA ARISYGG+G+ T + +P +GHQ++
Sbjct: 179 QEVRVNFELRELIVTGYVRPEDITRQNEITYDKIASARISYGGRGQITNMQQPRLGHQVL 238

Query: 233 ENLSP 237
           E++ P
Sbjct: 239 ESVLP 243


>gi|86356316|ref|YP_468208.1| flagellar basal body L-ring protein [Rhizobium etli CFN 42]
 gi|190890367|ref|YP_001976909.1| flagellar L-ring protein [Rhizobium etli CIAT 652]
 gi|86280418|gb|ABC89481.1| flagellar L-ring protein [Rhizobium etli CFN 42]
 gi|190695646|gb|ACE89731.1| flagellar L-ring protein [Rhizobium etli CIAT 652]
          Length = 238

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 125/224 (55%), Positives = 157/224 (70%), Gaps = 4/224 (1%)

Query: 17  GCH--SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKD 74
           GC   +++SEI   P MSP+GS L    + P + +  K   +  + YSLW DS AALFKD
Sbjct: 17  GCQSPTAVSEIGRAPAMSPIGSGL-AYGQTPQMALYPKQPRAVAQGYSLWSDSQAALFKD 75

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
           +RALNVGDILTVDI+I+D+A FDN+T RSR NS          +FG  TP+   +L Y  
Sbjct: 76  ARALNVGDILTVDIQINDKASFDNETNRSRKNSSGMNWDVNAQIFG-WTPESKTDLTYGS 134

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
             ++ GKG I R +KL LL+AA+VT ILENGNL+ISGSQEVR+N E+R LNV GIVRPQD
Sbjct: 135 DTSTDGKGKIERTDKLTLLVAAVVTGILENGNLVISGSQEVRLNQELRILNVAGIVRPQD 194

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           V+A N +SYDKIAEARISYGG+GR  E+ +PP G Q ++  SPL
Sbjct: 195 VNAENQISYDKIAEARISYGGRGRLMEVQQPPRGQQAVDLFSPL 238


>gi|54294166|ref|YP_126581.1| flagellar basal body L-ring protein [Legionella pneumophila str.
           Lens]
 gi|54297185|ref|YP_123554.1| flagellar basal body L-ring protein [Legionella pneumophila str.
           Paris]
 gi|81368773|sp|Q5WX68|FLGH_LEGPL RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|81370716|sp|Q5X5U0|FLGH_LEGPA RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|46398383|gb|AAS91877.1| flagelle L-ring protein [Legionella pneumophila]
 gi|46398387|gb|AAS91879.1| flagelle L-ring protein [Legionella pneumophila]
 gi|46398389|gb|AAS91880.1| flagelle L-ring protein [Legionella pneumophila]
 gi|46398403|gb|AAS91887.1| flagelle L-ring protein [Legionella pneumophila]
 gi|53750970|emb|CAH12381.1| flagellar L-ring protein precursor FlgH [Legionella pneumophila
           str. Paris]
 gi|53753998|emb|CAH15469.1| flagellar L-ring protein precursor FlgH [Legionella pneumophila
           str. Lens]
 gi|307609980|emb|CBW99509.1| flagellar L-ring protein precursor FlgH [Legionella pneumophila
           130b]
          Length = 230

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 62/234 (26%), Positives = 106/234 (45%), Gaps = 13/234 (5%)

Query: 1   MYRYSFIVLCYS-SLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R +  V C + +LLFGC +               +  D  +  P   +     +  K 
Sbjct: 1   MNRLNIAVSCLATALLFGCEALHP-----------PAPGDNPDYAPTYPVTPDPKELRKV 49

Query: 60  SYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           S +++    A  LF+  RA + GDILTV +     A  +  T + +N++           
Sbjct: 50  SGAIYSSETALPLFETPRARHPGDILTVFLIEKTDAQKNATTTQRKNDTTKITNKLFLGR 109

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                   + + + D     +G+G   +  KL   I+  V  +L NGN+++ G + VR+N
Sbjct: 110 PISLGSGYSMDFDLDNQRQFNGEGRSIQNNKLAGSISVTVAKVLANGNMVVQGEKWVRIN 169

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
                + ++GIVRPQD+ A N+++ D+IA ARISYGG G+           +++
Sbjct: 170 QGNEFVRLSGIVRPQDIKADNTITSDRIANARISYGGTGQINNTNAQGWLSRIL 223


>gi|28900125|ref|NP_799780.1| flagellar basal body L-ring protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|81726358|sp|Q87JI3|FLGH2_VIBPA RecName: Full=Flagellar L-ring protein 2; AltName: Full=Basal body
           L-ring protein 2; Flags: Precursor
 gi|28808408|dbj|BAC61613.1| putative flagellar L-ring protein [Vibrio parahaemolyticus RIMD
           2210633]
          Length = 223

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 61/237 (25%), Positives = 94/237 (39%), Gaps = 18/237 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M   S        LL GC      I   P            N   +       +    +S
Sbjct: 1   MKWLSKSWAVAVVLLVGCAGRQEFIPPQP------------NAEEYAPPKLDYTLPDAQS 48

Query: 61  YSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL+R  +   LF+D RA  VGD+LTV +  +  +     T   ++++++          
Sbjct: 49  GSLYRHQYTMTLFQDRRAYRVGDVLTVVLSEETSSSKKAGTKFGKSSAVNFAAPTI---- 104

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                     ++ DG     G  S S+  KL   I   V  +L NG L ISG + +R+N 
Sbjct: 105 -GTKKFDELGVSIDGSRNFDGSASSSQGNKLQGAITVTVHDVLPNGVLRISGEKWLRLNQ 163

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
               + +TGIVR  D+  +N VS  +IA+ARI+Y G+G   +        Q   +  
Sbjct: 164 GDEFIRLTGIVRVDDITRNNQVSSQRIADARITYAGRGALADSNAAGWLTQFFNSPW 220


>gi|296531726|ref|ZP_06894554.1| flagellar L-ring protein FlgH [Roseomonas cervicalis ATCC 49957]
 gi|296267942|gb|EFH13741.1| flagellar L-ring protein FlgH [Roseomonas cervicalis ATCC 49957]
          Length = 272

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 81/221 (36%), Positives = 120/221 (54%), Gaps = 4/221 (1%)

Query: 21  SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNV 80
                   P    +   ++E + +        +        SLWR    + F+D RA  V
Sbjct: 51  QKPPTISAPGELAIPPGIEEESPIDVARRPRLDGMGPTMVGSLWRPGARSFFRDQRARMV 110

Query: 81  GDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG----QQTPQMNGNLNYDGGG 136
           GD+LTV+I IDD A FDN+T   R +    KL   F L G         ++  +   G  
Sbjct: 111 GDLLTVEIEIDDSAQFDNRTDLERESEQTFKLPFLFGLQGVLGRAFGGALDPAVELGGDS 170

Query: 137 ASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVD 196
            + G G I R EK+ L +AA V  +L +GNL I+GSQEVRVN+E+R L + G++RP+D+ 
Sbjct: 171 TAKGNGRIRRTEKIRLQLAATVVRVLPSGNLEIAGSQEVRVNNELRELQLRGLIRPEDIR 230

Query: 197 AHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            +N ++ +KIAEARI+YGG+G  ++L RP  G Q++E + P
Sbjct: 231 PNNRIASEKIAEARITYGGRGVASDLQRPRWGQQIMERVLP 271


>gi|118581851|ref|YP_903101.1| flagellar L-ring protein [Pelobacter propionicus DSM 2379]
 gi|118504561|gb|ABL01044.1| flagellar L-ring protein [Pelobacter propionicus DSM 2379]
          Length = 225

 Score =  210 bits (534), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 68/241 (28%), Positives = 110/241 (45%), Gaps = 21/241 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M   +  +L  ++LL GC +  +++                 R            +    
Sbjct: 1   MKCTASTILLATALLSGCVTQTADV-----------------RTTTFDQQLPRPQADYSR 43

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            S+W+ S A L +D +A   GDI+T+ I     A  + +T  SR+ +++  +     L  
Sbjct: 44  GSIWQASSAGLVEDLKARRKGDIITIVITETANASKEAKTDTSRDTTINAGIPNFLGLEN 103

Query: 121 QQTPQMNGNL----NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
               + N +L    N +      G GS SR E LN  I+A V  +L N NL+I G + V+
Sbjct: 104 AGFLKNNMDLSKLINANVASEYEGSGSTSRKETLNATISAKVIDVLPNSNLLIEGRRNVK 163

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN+E + + + G VRP D+   N V+   IA+ARISY GKG  ++   P     +++ L 
Sbjct: 164 VNNEDQIIIIEGTVRPSDIGPDNVVNSIYIADARISYSGKGIISDRQSPGWLMNIVDKLW 223

Query: 237 P 237
           P
Sbjct: 224 P 224


>gi|77359725|ref|YP_339300.1| flagellar basal body L-ring protein [Pseudoalteromonas haloplanktis
           TAC125]
 gi|110816537|sp|Q3IDW1|FLGH_PSEHT RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|76874636|emb|CAI85857.1| flagellar biosynthesis; basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 227

 Score =  210 bits (534), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 59/240 (24%), Positives = 96/240 (40%), Gaps = 18/240 (7%)

Query: 2   YRYSFIVLCYSSLLFGCHSSI--SEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
            R   +    + LL GC S+     +   P  +PM                  N +    
Sbjct: 1   MRNIILFAAGTLLLSGCVSTQNSDVVQDDPYYAPMYPE--------------PNVEPAVA 46

Query: 60  SYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + SL+       L+ D +AL  GDI+TV ++   QA    +T   + +        G   
Sbjct: 47  NGSLFNTYLSNDLYADKKALRTGDIITVKLQESTQASKAAKTETDKQSDAKLDPVIGLGG 106

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                   +         +  G    +++  L   I+  V  +L NGNL+I G + + +N
Sbjct: 107 LPVNIGGDSIQFGIGSDASFKGDSKSNQSNSLAGDISVNVMRVLPNGNLVIRGEKWLTLN 166

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI-ENLSP 237
                + + G+VRP+DV A N+V  ++IA ARI Y GKG+T E        +    +L P
Sbjct: 167 SGEEFIRLEGLVRPEDVTADNTVQSNRIANARIQYSGKGQTQEAQSAGWLTRFFSSSLFP 226


>gi|284007172|emb|CBA72456.1| flagellar basal body L-ring protein FlgH [Arsenophonus nasoniae]
          Length = 249

 Score =  210 bits (534), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 55/236 (23%), Positives = 99/236 (41%), Gaps = 10/236 (4%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            R+ F ++C + ++ GC      I   P +S            P    D K + S  ++ 
Sbjct: 23  NRWRFGIICLAVIMSGCA----YIPKKPLVS------GPTTVEPAERPDLKVTGSIYQAS 72

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
                S+  LF+D R  +VGD LT+ ++ +  A  ++    SR             +  +
Sbjct: 73  QPVNYSYQPLFEDRRPRHVGDTLTIILQENVSASKNSSANASRKGKSGFSAGATPQVLNK 132

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
                    + +G     GKG  +        I   VT +L NGNL + G +++ +N   
Sbjct: 133 LVGVDKLQFDMEGENEFGGKGGANANNTFKGTITVTVTKLLANGNLQVVGEKQIAINQGT 192

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
             +  +G+V P+ +   N+V+  ++A+ARI Y G G   E        +++ N+SP
Sbjct: 193 EYIRFSGVVNPRTISGSNTVNSTQVADARIEYVGDGYINEAQNMGWLQRILLNISP 248


>gi|148266114|ref|YP_001232820.1| flagellar L-ring protein [Geobacter uraniireducens Rf4]
 gi|146399614|gb|ABQ28247.1| flagellar L-ring protein [Geobacter uraniireducens Rf4]
          Length = 229

 Score =  210 bits (534), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 66/239 (27%), Positives = 104/239 (43%), Gaps = 22/239 (9%)

Query: 4   YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSL 63
              + L    LL  C    +E+                 R P      + S     + S+
Sbjct: 7   IKMMSLPVLLLLAACSIRTAEV-----------------RTPAFDEQLQPSRPNYANGSI 49

Query: 64  WRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT 123
           W+DS +    D +A   GD +TV I     A     TG +R +S+   +     L    T
Sbjct: 50  WQDSSSGFADDFKARKRGDTVTVVINEQSSASKQATTGTTRGSSISAGIPNLLGLETNVT 109

Query: 124 P-----QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                  +N  ++        G G  +R E LN  I A V  +L NGNL+I G + V+VN
Sbjct: 110 GIKNWMDLNKLISASFDSKFDGSGKTTRQENLNATITAKVVDVLGNGNLLIEGKRNVKVN 169

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +E + + +TG VRP+D+ + N V+   +A+ARI+Y GKG  ++  +P     L + + P
Sbjct: 170 NEDQVIVLTGTVRPRDISSDNVVNSIYVADARINYSGKGIISDRQKPGWLMGLFDTIWP 228


>gi|289208117|ref|YP_003460183.1| flagellar L-ring protein [Thioalkalivibrio sp. K90mix]
 gi|288943748|gb|ADC71447.1| flagellar L-ring protein [Thioalkalivibrio sp. K90mix]
          Length = 232

 Score =  210 bits (534), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 54/242 (22%), Positives = 95/242 (39%), Gaps = 19/242 (7%)

Query: 1   MYRYSFIV-----LCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSD 55
           M R   +V     L    +L  C ++               ++  +N      +  +   
Sbjct: 1   MNRLETLVRPILGLAAVLVLSACAAT-------------QPTMPGDNPDYNPVMPPQPVP 47

Query: 56  STKKSYSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG 114
             + +  +++      LF+D +A  VGDILTV +    QA     T   +++SL      
Sbjct: 48  QAQNNGGIYQVAQSQGLFEDYKARQVGDILTVILAESTQAQKSASTSTQKDSSLDLGNLQ 107

Query: 115 GFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
            F        +     +        G G  S++ +L+  I   V  +L NGNL++ G + 
Sbjct: 108 AFGGEATHRGRPLFGASNTSTRDFDGSGDSSQSNQLDGEITVTVAEVLPNGNLVVQGEKW 167

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           + +N     +   GIVRP DV  +N+V   ++A AR+ YGG G   +   P    +   +
Sbjct: 168 LGINQGEEYVRFRGIVRPVDVTTNNTVLSTQVANARVYYGGTGVLADSNTPGWITRFFNS 227

Query: 235 LS 236
             
Sbjct: 228 PW 229


>gi|114046841|ref|YP_737391.1| flagellar basal body L-ring protein [Shewanella sp. MR-7]
 gi|123030764|sp|Q0HX21|FLGH_SHESR RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|113888283|gb|ABI42334.1| flagellar L-ring protein [Shewanella sp. MR-7]
          Length = 224

 Score =  209 bits (533), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 99/240 (41%), Gaps = 20/240 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSS-ISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M RY  + +  + LL  C S+    I   P  +P+                         
Sbjct: 1   MARYFILAV--ALLLTACSSTSKKPIADDPFYAPVYPE--------------APPTKIAA 44

Query: 60  SYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + S+++DS A +L+ D RA  VGDI+T+ ++   QA         + + +          
Sbjct: 45  TGSIYQDSQAASLYSDIRAHKVGDIITIVLKEATQAKKSAGNQIKKGSDMSLD-PIYAGG 103

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                  +  +L Y     +  +    ++  L+  I+A V  +L NGNL++ G + + +N
Sbjct: 104 SNVSIGGVPLDLRYKDSMNTKRESDADQSNSLDGSISANVMQVLNNGNLVVRGEKWISIN 163

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
           +    + VTGIVR QD+   N++   ++A ARI Y G G   +  +     Q   +   P
Sbjct: 164 NGDEFIRVTGIVRSQDIKPDNTIDSTRMANARIQYSGTGTFADAQKVGWLSQFFMSDWWP 223


>gi|46398373|gb|AAS91872.1| flagelle L-ring protein [Legionella pneumophila]
          Length = 230

 Score =  209 bits (533), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 61/234 (26%), Positives = 106/234 (45%), Gaps = 13/234 (5%)

Query: 1   MYRYSFIVLCYS-SLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R +  V C + +LLFGC +               +  D  +  P   +     +  K 
Sbjct: 1   MNRLNIAVSCLATALLFGCEALHP-----------PAPGDNPDYAPTYPVTPDPKELRKV 49

Query: 60  SYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           S +++    A  LF+  +A + GDILTV +     A  +  T + +N++           
Sbjct: 50  SGAIYSSETALPLFETPKARHPGDILTVFLIEKTDAQKNATTTQRKNDTTKITNKLFLGR 109

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                   + + + D     +G+G   +  KL   I+  V  +L NGN+++ G + VR+N
Sbjct: 110 PISLGSGYSMDFDLDNQRQFNGEGRSIQNNKLAGSISVTVAKVLANGNMVVQGEKWVRIN 169

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
                + ++GIVRPQD+ A N+++ D+IA ARISYGG G+           +++
Sbjct: 170 QGNEFVRLSGIVRPQDIKADNTITSDRIANARISYGGTGQINNTNAQGWLSRIL 223


>gi|254227986|ref|ZP_04921416.1| flagellar L-ring protein FlgH [Vibrio sp. Ex25]
 gi|151939482|gb|EDN58310.1| flagellar L-ring protein FlgH [Vibrio sp. Ex25]
          Length = 233

 Score =  209 bits (533), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 61/237 (25%), Positives = 97/237 (40%), Gaps = 18/237 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M   S      + LL GC      I   P            N   +       +    +S
Sbjct: 11  MKWLSKSWAVAAVLLVGCAGRQEFIPPEP------------NAEEYAPPTLDYTLPETQS 58

Query: 61  YSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL+R  +   LF+D RA  VGD+LTV +  +  +     T   ++++++       +  
Sbjct: 59  GSLYRHQYTMTLFQDRRAYRVGDVLTVQLSEETSSSKKAGTKFGKSSAVNFAAPTIGTKT 118

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
             +       ++ DG     G  S S+  KL   I   V  +L NG L ISG + +R+N 
Sbjct: 119 FDELG-----VSVDGSRNFDGSASSSQGNKLQGAITVTVHEVLPNGVLRISGEKWLRLNQ 173

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
               + +TGIVR  D++  N VS  +IA+ARI+Y G+G   +        Q   +  
Sbjct: 174 GDEFIRLTGIVRVDDINRSNQVSSQRIADARITYAGRGALADSNAAGWLTQFFNSPW 230


>gi|254465003|ref|ZP_05078414.1| flagellar L-ring protein FlgH [Rhodobacterales bacterium Y4I]
 gi|206685911|gb|EDZ46393.1| flagellar L-ring protein FlgH [Rhodobacterales bacterium Y4I]
          Length = 246

 Score =  209 bits (532), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 82/225 (36%), Positives = 119/225 (52%), Gaps = 6/225 (2%)

Query: 19  HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRAL 78
              +  +   P  +P   + +    +         +  T    SLW  S  +L  D RA+
Sbjct: 21  CGRMDHLGKPPSFTPANETSEHVAMLYEGLPAQTQNRRTVDGSSLWSGSQQSLLGDRRAI 80

Query: 79  NVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGG--- 135
             GDILTV I ID++A   N T RSR+ S    +     L  +   ++            
Sbjct: 81  KRGDILTVVIEIDEEAEISNDTQRSRSGSESLNMPQLLGLPQRLDRKLPEGATSADAVEL 140

Query: 136 ---GASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRP 192
               ++ GKGS+ R+EKL L +AA V  +L NG L ISG+QE+RVN E+R L VTG VRP
Sbjct: 141 GSSSSAGGKGSVKRSEKLELRVAATVVDVLPNGVLAISGTQELRVNFELRELLVTGYVRP 200

Query: 193 QDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           QD+   N ++YDKIA AR+SYGG+G+ T++ +P  G QL++ + P
Sbjct: 201 QDISRQNEITYDKIASARVSYGGRGQITDVQQPRYGQQLLDAVLP 245


>gi|330830300|ref|YP_004393252.1| flagellar L-ring protein [Aeromonas veronii B565]
 gi|328805436|gb|AEB50635.1| Flagellar L-ring protein [Aeromonas veronii B565]
          Length = 224

 Score =  209 bits (532), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 55/241 (22%), Positives = 102/241 (42%), Gaps = 20/241 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSIS-EITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M +  +++      L GC S+ +      P+ SP+    +  +  P              
Sbjct: 1   MMKAVWMLGLLV--LGGCSSTPNTPKPDDPEFSPVYGESEPVSVRP-------------- 44

Query: 60  SYSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + ++++ D    ++ D +A  VGDI+T+++     A     T   +NN  +        +
Sbjct: 45  TGAIFQPDQVNGIYSDIKAHKVGDIITIELSESTSASKKANTQSGKNNKFNLDPVKLGGV 104

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
               +P  + + +     A  G+    ++  L   I+  V  +L NGNL++ G + + +N
Sbjct: 105 PVTASP-YDLSASIAQDSAFKGQAKADQSNSLQGNISVSVAKVLPNGNLVVRGEKWIMLN 163

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
           +    + +TG++RP+DV + NSVS  K+A ARI YGG G                    P
Sbjct: 164 NGNEYIRITGLIRPEDVTSDNSVSSQKVANARIYYGGTGDLANSQEQGWLTSFFNGPWWP 223

Query: 238 L 238
           L
Sbjct: 224 L 224


>gi|260429182|ref|ZP_05783159.1| flagellar L-ring protein FlgH [Citreicella sp. SE45]
 gi|260419805|gb|EEX13058.1| flagellar L-ring protein FlgH [Citreicella sp. SE45]
          Length = 243

 Score =  209 bits (532), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 81/225 (36%), Positives = 118/225 (52%), Gaps = 6/225 (2%)

Query: 19  HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRAL 78
            S +  +   P  +P   S++               +   +  SLW     +L  D RA+
Sbjct: 18  CSRLDHVGKPPSFTPQTESVERVAMAYSGMPTVILPERASERASLWSRERNSLLGDRRAM 77

Query: 79  NVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG------QQTPQMNGNLNY 132
             GDILTV I ID+ A   N T RSRN S    +   F +             +   ++ 
Sbjct: 78  ARGDILTVVIEIDESADISNSTSRSRNGSESLSIPQLFGIPQRHEHKMPDGSSLTNPVDL 137

Query: 133 DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRP 192
               +S G G +SR+EKL L +AA +  +L NG L I G QEVRVN E+R L V+G VRP
Sbjct: 138 SSQASSGGDGQVSRSEKLALRVAATILEVLPNGVLAIQGMQEVRVNFEMRELLVSGYVRP 197

Query: 193 QDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +D+  +N ++YDKIA ARISYGG+G+ T++ +P IG Q+++ + P
Sbjct: 198 EDITRNNEITYDKIASARISYGGRGQITDVQQPRIGQQVLDVILP 242


>gi|260779344|ref|ZP_05888236.1| flagellar L-ring protein FlgH [Vibrio coralliilyticus ATCC BAA-450]
 gi|260605508|gb|EEX31803.1| flagellar L-ring protein FlgH [Vibrio coralliilyticus ATCC BAA-450]
          Length = 223

 Score =  209 bits (532), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 60/237 (25%), Positives = 94/237 (39%), Gaps = 18/237 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M     +      LL GC             +P      E +   +       S    ++
Sbjct: 1   MKALLRVWPLVVILLAGCAGRQE-------FTP-----PEPDEEKYAPPTLDYSLPAAQN 48

Query: 61  YSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL+R  +   LF+D RA  VGD+LTV +  + ++     T   +N+S+           
Sbjct: 49  GSLYRHQYSMTLFQDRRAYRVGDMLTVVLSEETESSKKADTKYGKNSSVGFAAPSLGGKT 108

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
             +        + D   A  G  S S+  KL   I   V  +L NG L ISG + +R+N 
Sbjct: 109 IDELA-----ASVDAQRAFDGSASSSQGNKLEGAITVTVHEVLPNGVLRISGEKWIRLNQ 163

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
               + +TGIVR  D+  +N VS  +I +ARI+Y G+G   +        Q   +  
Sbjct: 164 GDEFIRLTGIVRVDDISRNNQVSSARIGDARITYSGRGTLADSNAAGWLSQFFNSPW 220


>gi|84502381|ref|ZP_01000517.1| flagellar L-ring protein precursor [Oceanicola batsensis HTCC2597]
 gi|84389193|gb|EAQ01990.1| flagellar L-ring protein precursor [Oceanicola batsensis HTCC2597]
          Length = 257

 Score =  209 bits (532), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 78/246 (31%), Positives = 120/246 (48%), Gaps = 12/246 (4%)

Query: 4   YSFIVLCYSSLLFGCHSSI---SEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
              I       + GC S            +MSP         ++P    +   +    + 
Sbjct: 11  RLTISTLAVVAVAGCASDPFDRDPRISGVEMSPHVMPEVARVQVPMPPPEVPRTPERGEQ 70

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SLW+      F D RA  VGDILT+ I IDDQA   N T R R+ +        F    
Sbjct: 71  SSLWQRGSGGFFADQRATKVGDILTITIEIDDQAQLSNSTDRERSGNSEFTKPQFFGYAS 130

Query: 121 QQTPQMNG---------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
           +    + G          +       +SG GSI+R E ++L +AA+V  +L NGN++++G
Sbjct: 131 KLHKILPGVGAGQVPDPLVQSSSSTTASGSGSIARNETISLKVAALVVQMLPNGNMVVAG 190

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
            QEV+VN+E+R L V GI+RP+D+  +N++ Y+KIAEARI+YGG+G  +       G  +
Sbjct: 191 RQEVKVNEELRELRVAGIIRPEDIATNNTIPYEKIAEARITYGGEGSLSRQQSRSYGEDI 250

Query: 232 IENLSP 237
           ++ + P
Sbjct: 251 VDIVLP 256


>gi|46398379|gb|AAS91875.1| flagelle L-ring protein [Legionella pneumophila]
 gi|46398381|gb|AAS91876.1| flagelle L-ring protein [Legionella pneumophila]
 gi|46398391|gb|AAS91881.1| flagelle L-ring protein [Legionella pneumophila]
          Length = 230

 Score =  209 bits (531), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 64/234 (27%), Positives = 106/234 (45%), Gaps = 13/234 (5%)

Query: 1   MYRYSFIVLCYS-SLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R +  V C + +LLFGC +               +  D  +  P   +     +  K 
Sbjct: 1   MNRLNIAVSCLATALLFGCEALHP-----------PAPGDNPDYAPTYPVTPDPKELRKV 49

Query: 60  SYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           S +++    A  LF+  RA + GDILTV +     A  +  T + +N++           
Sbjct: 50  SGAIYSSETALPLFETPRARHPGDILTVFLIEKTDAQKNATTTQRKNDTTKITNKLFLGR 109

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                   + + + D     +G+G   +  KL   I+  V  +L NGN+II G + VR+N
Sbjct: 110 PISLGSGYSMDFDLDNQRQFNGEGRSIQNNKLAGSISVTVAKVLANGNMIIQGEKWVRIN 169

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
                + ++GIVRPQD+ A N+++ D+IA ARISYGG G+           +++
Sbjct: 170 QGNEFVRLSGIVRPQDIKADNTITSDRIANARISYGGTGQINNTNAQGWLSRIL 223


>gi|119775447|ref|YP_928187.1| flagellar basal body L-ring protein [Shewanella amazonensis SB2B]
 gi|166214826|sp|A1S811|FLGH_SHEAM RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|119767947|gb|ABM00518.1| flagellar L-ring protein FlgH [Shewanella amazonensis SB2B]
          Length = 224

 Score =  209 bits (531), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 58/240 (24%), Positives = 95/240 (39%), Gaps = 20/240 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSI-SEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M RY    +    +L GC S+    I   P  +P+          P              
Sbjct: 1   MLRYLM--VGSLLVLAGCASTEHKPIPDDPYYAPVVPEEPPVALEP-------------- 44

Query: 60  SYSLW-RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + S++     A+L+ D RA  VGDI+TV +    QA         + + L+         
Sbjct: 45  TGSIFLDSQAASLYTDIRAHRVGDIITVVLTESTQATKSANNEIKKGSDLNMDAIQALGG 104

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
               +     +L Y     +  +    ++  L   I+A V  +L NGNL+I G + + +N
Sbjct: 105 PVTISGN-PLSLGYSDSMNTKREADADQSNSLRGNISAHVLQVLANGNLVIRGEKWISIN 163

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
           +    + VTG++RPQD+   N+V   ++A ARI Y G G      +     Q   +   P
Sbjct: 164 NGDEFIRVTGVIRPQDITTDNTVVSTRVANARIQYSGTGTFANSQQVGWLSQFFLSDWWP 223


>gi|145298494|ref|YP_001141335.1| flagellar basal body L-ring protein [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142851266|gb|ABO89587.1| flagellar L-ring protein FlgH [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 224

 Score =  209 bits (531), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 54/241 (22%), Positives = 104/241 (43%), Gaps = 20/241 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEI-TGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M +  +++   +  L GC S+++      P+ +P+    D  +  P              
Sbjct: 1   MMKTIWMLGLLA--LGGCSSTLNTAKPDDPEFAPVYGESDPVSVRP-------------- 44

Query: 60  SYSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + ++++ D    ++ D +A  VGDI+T+++     A     T   ++N L  +      +
Sbjct: 45  TGAIFQPDQVNGIYSDIKAHKVGDIITIELAESTSASKKANTQSGKDNKLSMEPVTLGGV 104

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                P  + + +     A  G+    ++  L   I+  V  +L NGNL++ G + + +N
Sbjct: 105 PVTAGP-YDLSASLGQNSAFKGQAKADQSNSLQGNISVSVAKVLPNGNLVVRGEKWIMLN 163

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
           +    + +TG++RP+DV + NSVS  ++A ARI YGG G                    P
Sbjct: 164 NGNEYIRITGMIRPEDVTSENSVSSQRVANARIHYGGTGDLANSQEQGWLTSFFNGPWWP 223

Query: 238 L 238
           L
Sbjct: 224 L 224


>gi|239834438|ref|ZP_04682766.1| Flagellar L-ring protein precursor [Ochrobactrum intermedium LMG
           3301]
 gi|239822501|gb|EEQ94070.1| Flagellar L-ring protein precursor [Ochrobactrum intermedium LMG
           3301]
          Length = 242

 Score =  209 bits (531), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 99/225 (44%), Positives = 136/225 (60%), Gaps = 7/225 (3%)

Query: 17  GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSR 76
           GC +   EI   P +SP+ ++L   N     G   + S ++    SLW       FKD R
Sbjct: 20  GCATKPEEIGRAPDLSPVAANLGMQNNPQSNGYPARPSKASY---SLWDQRSTNFFKDPR 76

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF----SLFGQQTPQMNGNLNY 132
           A   GD+LTV I I+D+A  DN+T R R +       G F    S        M+ ++N 
Sbjct: 77  AATPGDVLTVIISINDRANLDNKTDRERVSKGIYGAGGSFATSSSTGAGAGGDMDASVNT 136

Query: 133 DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRP 192
                S GKG+I R+E + L +AAIVT  L NGN+II GSQEVRVN+E+R LNV G+VRP
Sbjct: 137 HSDSKSKGKGTIERSEDIRLQVAAIVTDTLPNGNMIIRGSQEVRVNNELRVLNVAGVVRP 196

Query: 193 QDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++ +SP
Sbjct: 197 RDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQVSP 241


>gi|325291935|ref|YP_004277799.1| Flagellar basal body L-ring protein [Agrobacterium sp. H13-3]
 gi|325059788|gb|ADY63479.1| Flagellar basal body L-ring protein [Agrobacterium sp. H13-3]
          Length = 238

 Score =  208 bits (530), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 121/224 (54%), Positives = 156/224 (69%), Gaps = 4/224 (1%)

Query: 17  GCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKD 74
           GC +  ++ EI   P MSP+GS L + ++ P +G+  K        YSLW DS  ALFKD
Sbjct: 17  GCQNNQTLKEIGNAPAMSPIGSGL-QFSQTPQMGMYPKQPKHMASGYSLWSDSQGALFKD 75

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
            RALN+GDILTV+I+I+D+A FDN+T R+R NS          + G  TP+ + N+ Y  
Sbjct: 76  LRALNIGDILTVNIQINDKADFDNETERNRTNSSGLNWKAKAEILG-WTPEADSNIKYGS 134

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
              +  KG   R+EKL L++AA+VT ILENGNLIISGSQEVRVN EIR LNV GIVRPQD
Sbjct: 135 DTDTQAKGKTKRSEKLTLMVAAVVTGILENGNLIISGSQEVRVNHEIRILNVGGIVRPQD 194

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           VDA N +SY++IAEARISYGG+GR TE+ +PP+G Q+++  SPL
Sbjct: 195 VDAQNMISYERIAEARISYGGRGRLTEVQQPPVGQQVVDLFSPL 238


>gi|306846274|ref|ZP_07478835.1| flagellar basal body L-ring protein [Brucella sp. BO1]
 gi|306273269|gb|EFM55138.1| flagellar basal body L-ring protein [Brucella sp. BO1]
          Length = 238

 Score =  208 bits (530), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 100/225 (44%), Positives = 133/225 (59%), Gaps = 7/225 (3%)

Query: 17  GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSR 76
           GC     EI   P +SP+ + L   N   F G   +   ++    SLW       FKD R
Sbjct: 16  GCAIKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPARPGKASY---SLWDQRSTNFFKDPR 72

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL----FGQQTPQMNGNLNY 132
           A   GD+LTV I I+D+A  DN+T R R +       G F+            M+ ++N 
Sbjct: 73  AATPGDVLTVIISINDRANLDNKTDRERVSKGIYGGGGSFATSSITGAAAGGDMDASVNT 132

Query: 133 DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRP 192
                S GKG+I R+E + L IAAIVT  L NGNLII GSQEVRVN+E+R LNV G+VRP
Sbjct: 133 HSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVRVNNELRVLNVAGVVRP 192

Query: 193 QDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  SP
Sbjct: 193 RDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFSP 237


>gi|83647170|ref|YP_435605.1| flagellar basal body L-ring protein [Hahella chejuensis KCTC 2396]
 gi|110816531|sp|Q2SDU4|FLGH_HAHCH RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|83635213|gb|ABC31180.1| Flagellar basal body L-ring protein [Hahella chejuensis KCTC 2396]
          Length = 227

 Score =  208 bits (530), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 54/242 (22%), Positives = 97/242 (40%), Gaps = 19/242 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCH--SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
           M   + I L   +LL GC   S      G P  +P+                        
Sbjct: 1   MKTLTLISLIMVTLLSGCSPISREQVRPGDPAFAPV--------------PPQTLMQPAP 46

Query: 59  KSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
              S++  +   +LF D  A  VGD+LTV ++   Q+     T   +++      +    
Sbjct: 47  VDGSIYSSAQNFSLFGDRTAHQVGDVLTVVLQESTQSSKSTGTSMKKDSENSFNEATILG 106

Query: 118 LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                   ++   + +     SG+    ++  L+  I+  ++ +L NG L I G + + +
Sbjct: 107 TAISAHN-LSLLTDQNFERDFSGEADADQSNSLSGSISVTISDVLPNGVLRIRGEKWLTL 165

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS- 236
            +    L V+G+VRPQD+   N++   KIA+AR +Y G G   ++ R     +   +   
Sbjct: 166 TEGDEYLRVSGLVRPQDIGVDNTILSSKIADARFAYSGAGAFGDVNRAGWLQRFFNSEWF 225

Query: 237 PL 238
           PL
Sbjct: 226 PL 227


>gi|319409183|emb|CBI82827.1| Flagellar L-ring protein [Bartonella schoenbuchensis R1]
          Length = 247

 Score =  208 bits (530), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 89/231 (38%), Positives = 132/231 (57%), Gaps = 8/231 (3%)

Query: 8   VLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDS 67
           +      L  C  +  +    P  SP+ + L      P     F      +  YSL+R +
Sbjct: 23  ISLMLMPLAACSYNPKDFNSTPDFSPVRADL---GFAPSRAAHFYPPAPKESKYSLYRPN 79

Query: 68  H-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
                ++D RA+  GD+LTV I I+D+A F+N++   R++S    +   +S       ++
Sbjct: 80  VVNNFYRDPRAMKPGDVLTVQIFINDRASFNNKSDLKRDSSSKYTVGTEYSF----LEKL 135

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
            G +       S G G + R E + L IAA+VT +L NGNL+ISGSQEVRVN E+R LN+
Sbjct: 136 AGGVEASSSNQSKGDGKVERQENIRLSIAAVVTDVLPNGNLVISGSQEVRVNYEMRILNI 195

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            G+VRP+D+ A+N + YDKIAEARISYGG+GR +E+ +PP G QL+  ++P
Sbjct: 196 AGVVRPRDISANNMIDYDKIAEARISYGGRGRMSEIQQPPYGQQLLNQIAP 246


>gi|153831745|ref|ZP_01984412.1| flagellar L-ring protein FlgH [Vibrio harveyi HY01]
 gi|156976144|ref|YP_001447050.1| flagellar basal body L-ring protein [Vibrio harveyi ATCC BAA-1116]
 gi|148872255|gb|EDL71072.1| flagellar L-ring protein FlgH [Vibrio harveyi HY01]
 gi|156527738|gb|ABU72823.1| hypothetical protein VIBHAR_04915 [Vibrio harveyi ATCC BAA-1116]
          Length = 229

 Score =  208 bits (530), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 62/237 (26%), Positives = 95/237 (40%), Gaps = 18/237 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M   S        LL GC      I   P            N   +       +    KS
Sbjct: 7   MKWLSKSWAVAVVLLVGCAGRDEFIPPEP------------NTEEYAPPVLDYTLPETKS 54

Query: 61  YSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL+R  +   LF+D RA  VGD+LTV +  +  +     T   +++++        +  
Sbjct: 55  GSLYRHQYTMTLFQDRRAYRVGDVLTVQLSEETSSSKKAGTQFGKSSTVDFAAPTIGTKT 114

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
             +       ++ DG  +  G  S S+  KL   I   V  +L NG L ISG + +R+N 
Sbjct: 115 IDELG-----VSVDGSRSFDGSASSSQGNKLQGAITVTVHEVLPNGVLRISGEKWLRLNQ 169

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
               + +TGIVR  D+   N VS  +IA+ARI+Y G+G   +        Q   +  
Sbjct: 170 GDEFIRLTGIVRVDDISRSNQVSSQRIADARITYAGRGALADSNAAGWLTQFFNSPW 226


>gi|88858140|ref|ZP_01132782.1| flagellar biosynthesis; basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein
           [Pseudoalteromonas tunicata D2]
 gi|88819757|gb|EAR29570.1| flagellar biosynthesis; basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein
           [Pseudoalteromonas tunicata D2]
          Length = 227

 Score =  208 bits (530), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 98/240 (40%), Gaps = 18/240 (7%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISE--ITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
            + + I LC   L  GC S+ +   I   P  +P+                   ++   +
Sbjct: 1   MKNTLISLCAIFLSVGCVSTGNRNVIVDDPYFTPI--------------PAEAETEPMVQ 46

Query: 60  SYSLWRD-SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + SL+   +   L+ D +A+ VGDI+TV +    QA    +T   +   +      G   
Sbjct: 47  TGSLFDAYNSNDLYSDKKAVRVGDIITVMLNESTQASKSAKTESGKATDIALNPLVGLGG 106

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                   +  L      +  G    +++  L+  I+  V  +L NGNL+I G + + +N
Sbjct: 107 KNVNIGGQSIELGLKSDSSYKGDAKSNQSNSLSGNISVNVMRVLPNGNLMIRGEKWLTLN 166

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
                + + G+VR  DV A N+V  ++IA ARI Y GKG   +        +   + L P
Sbjct: 167 TGEEFIRLEGVVRASDVAADNTVESNRIANARIQYSGKGDLQDAQSSGWLSRFFMSALFP 226


>gi|241203110|ref|YP_002974206.1| flagellar basal body L-ring protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857000|gb|ACS54667.1| flagellar L-ring protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 238

 Score =  208 bits (530), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 124/224 (55%), Positives = 156/224 (69%), Gaps = 4/224 (1%)

Query: 17  GCH--SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKD 74
           GC   +++SEI   P MSP+GS L    + P + +  K   +  + YSLW DS AALFKD
Sbjct: 17  GCQSPTAVSEIGRAPAMSPIGSGL-AYGQTPQMALYPKQPRAVAQGYSLWSDSQAALFKD 75

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
           +RALNVGDILTVDI+I+D+  FDN+T RSR NS          +FG  TP+   +L Y  
Sbjct: 76  ARALNVGDILTVDIQINDKGSFDNETNRSRKNSSGMNWDVNAQIFG-WTPESKTDLTYGS 134

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
             ++ GKG I R +KL LL+AA+VT ILENGNL+ISGSQEVR+N E+R LNV GIVRPQD
Sbjct: 135 DTSTDGKGKIERTDKLTLLVAAVVTGILENGNLVISGSQEVRLNQELRILNVAGIVRPQD 194

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           V+A N +SYDKIAEARISYGG+GR  E+ +PP G Q ++  SPL
Sbjct: 195 VNAENQISYDKIAEARISYGGRGRLMEVQQPPRGQQAVDLFSPL 238


>gi|39998139|ref|NP_954090.1| flagellar L-ring protein FlgH [Geobacter sulfurreducens PCA]
 gi|39985085|gb|AAR36440.1| flagellar L-ring protein FlgH [Geobacter sulfurreducens PCA]
          Length = 221

 Score =  208 bits (530), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 61/235 (25%), Positives = 97/235 (41%), Gaps = 24/235 (10%)

Query: 10  CYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA 69
                L GC    +E+                 R P      + +  +  + S+W+ S  
Sbjct: 3   IICLALAGCAVEKTEV-----------------RTPTFDEQLRPAPPSYANGSIWQASTT 45

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ-------Q 122
            L  D +A + GDI+TV I     A  +  T   R   +   +     L           
Sbjct: 46  GLAVDHKARSRGDIITVLIVEQASASKEATTDTERKAEVSASVPYLMGLEKSSTLFSKLT 105

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
               N  L         G G+ +R E L   + A +T +L NGN +I G + V+VN+E +
Sbjct: 106 NANPNNLLGASTNSKYEGSGATTRKENLLATMTAKITDVLPNGNFLIEGRRNVKVNNEDQ 165

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            L + G +RP+DV   N++S   IA+ARISY G G  ++  RP     +++ + P
Sbjct: 166 ILVLQGTIRPRDVSPDNTISSTMIADARISYTGNGVISDRQRPGWLMNILDYIWP 220


>gi|119469953|ref|ZP_01612758.1| flagellar biosynthesis; basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein [Alteromonadales
           bacterium TW-7]
 gi|119446663|gb|EAW27936.1| flagellar biosynthesis; basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein [Alteromonadales
           bacterium TW-7]
          Length = 227

 Score =  208 bits (530), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 99/240 (41%), Gaps = 18/240 (7%)

Query: 2   YRYSFIVLCYSSLLFGCHSSI--SEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
            R+  +    +  L GC S+     +   P  +PM                  + +    
Sbjct: 1   MRHYMLFAVGTLFLSGCVSTQNSDVVQDDPYYAPMYPE--------------PSMEPVVA 46

Query: 60  SYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + SL+  +    L+ D +AL  GDI+TV+++   QA    +T   + +        G   
Sbjct: 47  TGSLFNTNVSNDLYADRKALRTGDIITVNLQESTQATKAAKTETDKQSDASLDPVIGLGG 106

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                   +         + +G    +++  L   I+  V  +L NGNL+I G + + +N
Sbjct: 107 LPVNIGGDSIQFGIGSDASFTGDSKSNQSNSLFGNISVNVMRVLPNGNLVIRGEKWLTLN 166

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI-ENLSP 237
                + + G+VRPQDV + N+V  ++IA ARI Y GKG+T E        +    ++ P
Sbjct: 167 TGEEFIRLEGLVRPQDVSSDNTVESNRIANARIQYSGKGQTQEAQSAGWLTRFFSSSIFP 226


>gi|269960119|ref|ZP_06174495.1| Flagellar L-ring protein precursor [Vibrio harveyi 1DA3]
 gi|269835090|gb|EEZ89173.1| Flagellar L-ring protein precursor [Vibrio harveyi 1DA3]
          Length = 223

 Score =  208 bits (530), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 62/237 (26%), Positives = 96/237 (40%), Gaps = 18/237 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M   S        LL GC      I   P            N   +       +    KS
Sbjct: 1   MKWLSKSWAVAVVLLVGCAGRQEFIPPEP------------NTEEYAPPVLDYTLPEAKS 48

Query: 61  YSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL+R  +   LF+D RA  VGD+LTV +  + ++     T   +++++        +  
Sbjct: 49  GSLYRHQYTMTLFQDRRAYRVGDVLTVQLSEETESSKKAGTQFGKSSTVDFATPTIGTKT 108

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
             +       ++ DG     G  S S+  KL   I   V  +L NG L ISG + +R+N 
Sbjct: 109 IDELG-----VSIDGSRNFDGSASSSQGNKLQGAITVTVHEVLPNGVLRISGEKWLRLNQ 163

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
               + +TGIVR  D++  N VS  +IA+ARI+Y G+G   +        Q   +  
Sbjct: 164 GDEFIRLTGIVRVDDINRSNQVSSQRIADARITYAGRGALADSNAAGWLTQFFNSPW 220


>gi|262396032|ref|YP_003287885.1| flagellar L-ring protein FlgH [Vibrio sp. Ex25]
 gi|262339626|gb|ACY53420.1| flagellar L-ring protein FlgH [Vibrio sp. Ex25]
          Length = 223

 Score =  208 bits (530), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 61/237 (25%), Positives = 97/237 (40%), Gaps = 18/237 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M   S      + LL GC      I   P            N   +       +    +S
Sbjct: 1   MKWLSKSWAVAAVLLVGCAGRQEFIPPEP------------NAEEYAPPTLDYTLPETQS 48

Query: 61  YSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL+R  +   LF+D RA  VGD+LTV +  +  +     T   ++++++       +  
Sbjct: 49  GSLYRHQYTMTLFQDRRAYRVGDVLTVQLSEETSSSKKAGTKFGKSSAVNFAAPTIGTKT 108

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
             +       ++ DG     G  S S+  KL   I   V  +L NG L ISG + +R+N 
Sbjct: 109 FDELG-----VSVDGSRNFDGSASSSQGNKLQGAITVTVHEVLPNGVLRISGEKWLRLNQ 163

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
               + +TGIVR  D++  N VS  +IA+ARI+Y G+G   +        Q   +  
Sbjct: 164 GDEFIRLTGIVRVDDINRSNQVSSQRIADARITYAGRGALADSNAAGWLTQFFNSPW 220


>gi|209547932|ref|YP_002279849.1| flagellar basal body L-ring protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533688|gb|ACI53623.1| flagellar L-ring protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 238

 Score =  208 bits (529), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 124/224 (55%), Positives = 156/224 (69%), Gaps = 4/224 (1%)

Query: 17  GCH--SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKD 74
           GC   +++SEI   P MSP+GS L    + P + +  K   +  + YSLW DS AALFKD
Sbjct: 17  GCQSPTAVSEIGRAPSMSPIGSGL-AYGQTPQMALYPKQPRAVAQGYSLWSDSQAALFKD 75

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
           +RALNVGDILTVDI+I+D+  FDN+T RSR NS          +FG  TP+   +L Y  
Sbjct: 76  ARALNVGDILTVDIQINDKGSFDNETNRSRKNSSGMNWDVNAQIFG-WTPESKTDLTYGS 134

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
             ++ GKG I R +KL LL+AA+VT ILENGNL+ISGSQEVR+N E+R LNV GIVRPQD
Sbjct: 135 DTSTDGKGKIERTDKLTLLVAAVVTGILENGNLVISGSQEVRLNQELRILNVAGIVRPQD 194

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           V+A N +SYDKIAEARISYGG+GR  E+ +PP G Q ++  SPL
Sbjct: 195 VNAENQISYDKIAEARISYGGRGRLMEVQQPPRGQQAVDLFSPL 238


>gi|15887894|ref|NP_353575.1| flagellar basal body L-ring protein [Agrobacterium tumefaciens str.
           C58]
 gi|2494535|sp|Q44342|FLGH_AGRT5 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|1086565|gb|AAB68972.1| FlgH [Agrobacterium tumefaciens]
 gi|2459718|gb|AAB71794.1| FlgH [Agrobacterium tumefaciens]
 gi|15155486|gb|AAK86360.1| flagellar L-ring protein precursor [Agrobacterium tumefaciens str.
           C58]
          Length = 239

 Score =  208 bits (529), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 120/224 (53%), Positives = 155/224 (69%), Gaps = 4/224 (1%)

Query: 17  GCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKD 74
           GC +  ++ EI   P MSP+GS L + ++ P +G+  K        YSLW DS  ALFKD
Sbjct: 18  GCQNNQTLKEIGNAPAMSPIGSGL-QFSQTPQMGMYPKQPKHMASGYSLWSDSQGALFKD 76

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
            RALN+GDILTV+I+I+D+A FDN+T R+R N+          + G  TP  + ++ Y  
Sbjct: 77  LRALNIGDILTVNIQINDKADFDNETERNRTNASGLNWKAKAQILG-WTPDADSSIKYGS 135

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
              +  KG   R+EKL LL+AA+VT ILENGNLIISGSQEVRVN EIR LNV GIVRPQD
Sbjct: 136 DTDTQAKGKTKRSEKLTLLVAAVVTGILENGNLIISGSQEVRVNHEIRILNVGGIVRPQD 195

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           VDA N +SY++IAEARISYGG+GR TE+ +PP+G Q+++  SPL
Sbjct: 196 VDAQNIISYERIAEARISYGGRGRLTEVQQPPVGQQVVDLFSPL 239


>gi|323492335|ref|ZP_08097488.1| flagellar basal body L-ring protein [Vibrio brasiliensis LMG 20546]
 gi|323313382|gb|EGA66493.1| flagellar basal body L-ring protein [Vibrio brasiliensis LMG 20546]
          Length = 223

 Score =  208 bits (529), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 58/237 (24%), Positives = 92/237 (38%), Gaps = 18/237 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M   S      + LL GC             +P      E +   +       S    + 
Sbjct: 1   MKALSKTWPLVAVLLVGCAGRQE-------FTP-----PEPDEEKYAPPALDYSLPAPQH 48

Query: 61  YSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL+R  +   LF+D RA  VGD+LTV +  + ++     T   ++ S+           
Sbjct: 49  GSLYRHQYTMTLFQDRRAYRVGDMLTVVLSEETESSKKADTQYGKSASVGFAAPSIAGKT 108

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
             +        + D   +  G  S S+  KL   I   V  +L NG L ISG + +R+N 
Sbjct: 109 IDELA-----ASIDADRSFDGSASSSQGNKLEGAITVTVHDVLPNGVLRISGEKWIRLNQ 163

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
               + +TGIVR  D+  +N V   +I +ARI+Y G+G   +        Q   +  
Sbjct: 164 GDEFIRLTGIVRVDDISRNNQVPSSRIGDARITYSGRGALADSNASGWLTQFFNSPW 220


>gi|114762166|ref|ZP_01441634.1| flagellar L-ring protein precursor H [Pelagibaca bermudensis
           HTCC2601]
 gi|114545190|gb|EAU48193.1| flagellar L-ring protein precursor H [Roseovarius sp. HTCC2601]
          Length = 242

 Score =  207 bits (527), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 76/224 (33%), Positives = 115/224 (51%), Gaps = 6/224 (2%)

Query: 20  SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALN 79
           S +  +   P  +P   S +                      SLW    ++L  D RA+ 
Sbjct: 18  SRLDHLGKAPSFTPQEQSPERVAMAYSGVPTVALPQRQTDQASLWSRERSSLLGDRRAMK 77

Query: 80  VGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN------LNYD 133
            GDILTV I IDD+A   N T RSR+ S    +     +  +    +         ++  
Sbjct: 78  QGDILTVVIEIDDEASISNSTSRSRSGSESLSVPQLLGIPQRIDEDLPLGATMADAVDLG 137

Query: 134 GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQ 193
              AS G G + R E+L L +AA +T ++ NG L I G+QEVRVN E+R L V+G VRP+
Sbjct: 138 SQAASGGDGQVQRREELTLRVAATITDVMPNGVLAIEGAQEVRVNFELRELLVSGFVRPE 197

Query: 194 DVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           D+   N ++YDKIA A+ISYGG+G+ +++ +P  G Q+++ + P
Sbjct: 198 DITRQNEITYDKIASAKISYGGRGQISDMQQPRYGQQVLDIVLP 241


>gi|91224196|ref|ZP_01259459.1| flagellar L-ring protein precursor H [Vibrio alginolyticus 12G01]
 gi|269965647|ref|ZP_06179760.1| Flagellar L-ring protein precursor [Vibrio alginolyticus 40B]
 gi|91191107|gb|EAS77373.1| flagellar L-ring protein precursor H [Vibrio alginolyticus 12G01]
 gi|269829715|gb|EEZ83951.1| Flagellar L-ring protein precursor [Vibrio alginolyticus 40B]
          Length = 233

 Score =  207 bits (527), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 61/237 (25%), Positives = 98/237 (41%), Gaps = 18/237 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M   S      + LL GC      I   P            N   +       +    +S
Sbjct: 11  MKWLSKSWAVAAVLLVGCAGRQEFIPPEP------------NAEEYAPPTLDYTLPETQS 58

Query: 61  YSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL+R  +   LF+D RA  VGD+LTV +  +  +  +  T   ++++++       +  
Sbjct: 59  GSLYRHQYTMTLFQDRRAYRVGDVLTVQLSEETSSSKNAGTKFGKSSAINFVAPTIGTKT 118

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
             +       ++ DG     G  S S+  KL   I   V  +L NG L ISG + +R+N 
Sbjct: 119 IDELG-----VSVDGKRNFDGSASSSQGNKLQGAITVTVHEVLPNGVLRISGEKWLRLNQ 173

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
               + +TGIVR  D++  N VS  +IA+ARI+Y G+G   +        Q   +  
Sbjct: 174 GDEFIRLTGIVRVDDINRSNQVSSQRIADARITYAGRGALADSNAAGWLTQFFNSPW 230


>gi|239995122|ref|ZP_04715646.1| flagellar basal body L-ring protein [Alteromonas macleodii ATCC
           27126]
          Length = 226

 Score =  207 bits (527), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 53/239 (22%), Positives = 94/239 (39%), Gaps = 18/239 (7%)

Query: 4   YSFIVLCYSSLLFGCHSSISEI--TGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
               +     +L GC S+         P  +P+                    ++  +  
Sbjct: 2   RILGLSAALLILGGCASTNEPPVQANDPSFAPVVPDY--------------PRETVVEDG 47

Query: 62  SLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           SL+R      L+ D  A  VGDI+TV +  + QA     T  +++++++     G +   
Sbjct: 48  SLFRSQLANNLYSDVTARRVGDIITVTLSENTQASKSADTSTAKDSNVNLNPITGLAGQA 107

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                 +  L        SG  + +++  LN  I+  V  +L N NL+I G + + +N  
Sbjct: 108 INIGGESVQLGISSSRDFSGDATANQSNSLNGAISVTVVDVLPNSNLVIRGEKWLTLNQG 167

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSPL 238
              + +TGI+RP D+   N +   K+A ARI Y G G            +  ++   PL
Sbjct: 168 DEYIRLTGIIRPADISPENEIVSTKVANARIQYSGTGSFARAQEKGWLTKFFDSAWWPL 226


>gi|89092139|ref|ZP_01165094.1| Flagellar basal body L-ring protein [Oceanospirillum sp. MED92]
 gi|89083874|gb|EAR63091.1| Flagellar basal body L-ring protein [Oceanospirillum sp. MED92]
          Length = 225

 Score =  207 bits (527), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 51/239 (21%), Positives = 93/239 (38%), Gaps = 17/239 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +     L  +  L GC     +    P+ +P+                   +     +
Sbjct: 1   MNKLVIGFLVSTLFLTGCVQKQVKPNN-PEYAPIVP--------------QALTQPAPVN 45

Query: 61  YSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            S++  + +  L+ D RA  VGDILT+ ++    +    +T   ++++L           
Sbjct: 46  GSIYNSATSINLYGDGRAHRVGDILTITLQESTSSQKSAKTELDKSSNLSLAQPTLLGQT 105

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                +              G+GS   +  L   I   V  +L NG L++ G + + +N 
Sbjct: 106 VDINGRPLSATLNGPTLDFDGEGSSDMSNNLTGNITVTVHDVLPNGVLLVKGEKWLTLNQ 165

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI-ENLSP 237
               + ++G+VRPQD+ + NSV   K+A+ARI+Y G G   +        +     L P
Sbjct: 166 GDEYIRISGMVRPQDIGSDNSVMSTKLADARITYSGTGAVNDTNVMGWVSKFFISALMP 224


>gi|16126305|ref|NP_420869.1| flagellar basal body L-ring protein [Caulobacter crescentus CB15]
 gi|221235082|ref|YP_002517518.1| flagellar basal body L-ring protein [Caulobacter crescentus NA1000]
 gi|13637801|sp|P22606|FLGH_CAUCR RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|13423545|gb|AAK24037.1| flagellar L-ring protein [Caulobacter crescentus CB15]
 gi|220964254|gb|ACL95610.1| flagellar L-ring protein flgH [Caulobacter crescentus NA1000]
          Length = 244

 Score =  207 bits (527), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 81/225 (36%), Positives = 121/225 (53%), Gaps = 6/225 (2%)

Query: 19  HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRAL 78
            S++ E    P ++P+G                + +     + SLWR    A F D RA 
Sbjct: 19  CSTVKEAVKGPDLAPVGYPAPLAPMQQQYVSAREPAPQAASANSLWRVGARAFFNDQRAS 78

Query: 79  NVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN------LNY 132
            VGDI+TV I IDD A   N T  SR  ++   +     +       + G       L  
Sbjct: 79  RVGDIVTVMIDIDDSASTKNATNSSRTANMKAGVPHLLGMESSLGKFLPGGFDPASALET 138

Query: 133 DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRP 192
           +    ++G G +SR+EK++L IAA+V+ +L NGN++I G+QEVR N E+R L V GIVRP
Sbjct: 139 NSTTTNAGSGGVSRSEKISLTIAAVVSQVLPNGNMVIQGTQEVRTNAELRQLTVAGIVRP 198

Query: 193 QDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +D+ + N++ + +IAEARISYGG+G  + + + P G  L+E  SP
Sbjct: 199 EDISSANTIRHTQIAEARISYGGRGDISRVQKTPAGQSLVEKFSP 243


>gi|46578930|ref|YP_009738.1| flagellar basal body L-ring protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120603469|ref|YP_967869.1| flagellar basal body L-ring protein [Desulfovibrio vulgaris DP4]
 gi|81567114|sp|Q72EQ4|FLGH_DESVH RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|166214820|sp|A1VG76|FLGH_DESVV RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|46448342|gb|AAS94997.1| flagellar L-ring protein FlgH [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120563698|gb|ABM29442.1| flagellar L-ring protein [Desulfovibrio vulgaris DP4]
 gi|311232788|gb|ADP85642.1| flagellar L-ring protein [Desulfovibrio vulgaris RCH1]
          Length = 238

 Score =  207 bits (527), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 68/250 (27%), Positives = 113/250 (45%), Gaps = 26/250 (10%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R +    C   L+ GC+++  + + +P ++P                  +   +    
Sbjct: 1   MIRKTLAASCAVLLMAGCNAARQQASPLPPVAP-------------PQTYVEPEQAAANP 47

Query: 61  YSLWRDSHAAL-FKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            S++ D+ A L F DSRA  VGDI+ V I  + +A     T   R+++ +  +   F   
Sbjct: 48  GSMFNDAEADLMFSDSRARRVGDIVLVKIVENAKAKNKADTTSERDSTNNYTVGAYFGQD 107

Query: 120 GQQTPQMNG------------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
                 MN              L         GKG   R   +   IAA V  ++  G L
Sbjct: 108 SASINPMNPVGAFGGKVGTNALLQTGSKSKLDGKGETKRENTVTATIAARVVRVMPGGLL 167

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
            + G++E RVNDE + + ++G+VR +DV + NSV   ++A++RI+Y GKG   +  RP  
Sbjct: 168 QVEGARETRVNDETQYIVLSGLVRSRDVASDNSVMSTQLADSRIAYYGKGVLADKQRPGW 227

Query: 228 GHQLIENLSP 237
             +L++NL P
Sbjct: 228 FSRLMDNLWP 237


>gi|146294547|ref|YP_001184971.1| flagellar basal body L-ring protein [Shewanella putrefaciens CN-32]
 gi|145566237|gb|ABP77172.1| flagellar L-ring protein [Shewanella putrefaciens CN-32]
          Length = 220

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 60/235 (25%), Positives = 98/235 (41%), Gaps = 19/235 (8%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
           ++ L   +LL GC S I +    P                +   +   S    K  SL+R
Sbjct: 3   WLWLLCFALLSGCMSHIPDQETKP------------GTKEWAPPEIDYSLPDAKDGSLYR 50

Query: 66  DSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP 124
             +   LFKD RA   GDILTV +     +     T  ++   +   L G          
Sbjct: 51  PGYMLTLFKDKRAFREGDILTVALDEKTYSSKKADTKTNKEQDIGMGLKGNVG-----EK 105

Query: 125 QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
             + +         +G GS ++  +L+  I   V+ +L NG L+I G + +R+N     L
Sbjct: 106 TADADGKTSFSRGFNGAGSSTQQNQLSGSITVTVSKVLPNGTLLIRGEKWLRLNQGDEYL 165

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS-PL 238
            + GI+R  D+  +N++S  +IA+ARI YGG+G   +        +   +   PL
Sbjct: 166 RLLGIIRTDDIGNNNTISSQRIADARIIYGGQGAIADSNAMGWASRYFNSPWFPL 220


>gi|224370758|ref|YP_002604922.1| FlgH [Desulfobacterium autotrophicum HRM2]
 gi|223693475|gb|ACN16758.1| FlgH [Desulfobacterium autotrophicum HRM2]
          Length = 234

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 70/240 (29%), Positives = 113/240 (47%), Gaps = 10/240 (4%)

Query: 1   MYRYSFIVLCYSSL-LFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M +     L  + L L GC  S +  +    + P G + D+    P   +          
Sbjct: 1   MMKQIMSALVLTVLALTGCMGSTTNRSSSGALLPQG-TSDQPVLQPKYAVVPP------S 53

Query: 60  SYSLW-RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
             SLW  DS A  F+D++A  VGD + VDI  +  +  D  T  SR   ++  +S  F +
Sbjct: 54  EGSLWTSDSRARFFEDTKASMVGDTVIVDIVENTSSQMDVNTETSRETGVNVGISNLFGV 113

Query: 119 FGQQTPQMNGNL-NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                    G L   D      G+    R+  +   IAA +T IL NGNL + G + ++V
Sbjct: 114 TRGFGATGAGKLVGADYSNDFKGEAKNDRSGSITASIAARITEILPNGNLSLFGRRAMKV 173

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N E++ ++V+G++RP D+ A N V    +A++RI Y GKG   +   P  G ++++N+ P
Sbjct: 174 NGEVQYISVSGVLRPGDIMADNRVKSTYLADSRIEYSGKGVLADKQNPGWGTRIMDNIWP 233


>gi|120597308|ref|YP_961882.1| flagellar basal body L-ring protein [Shewanella sp. W3-18-1]
 gi|120557401|gb|ABM23328.1| flagellar L-ring protein [Shewanella sp. W3-18-1]
          Length = 220

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 60/235 (25%), Positives = 98/235 (41%), Gaps = 19/235 (8%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
           ++ L   +LL GC S I +    P                +   +   S    K  SL+R
Sbjct: 3   WLWLLCFALLSGCMSHIPDQETKP------------GTKEWAPPEIDYSLPDAKDGSLYR 50

Query: 66  DSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP 124
             +   LFKD RA   GDILTV +     +     T  ++   +   L G          
Sbjct: 51  PGYMLTLFKDKRAFREGDILTVALDEKTYSSKKADTKTNKEQDIGMGLKGNIG-----EK 105

Query: 125 QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
             + +         +G GS ++  +L+  I   V+ +L NG L+I G + +R+N     L
Sbjct: 106 TADADGKTSFSRGFNGAGSSTQQNQLSGSITVTVSKVLPNGTLLIRGEKWLRLNQGDEYL 165

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS-PL 238
            + GI+R  D+  +N++S  +IA+ARI YGG+G   +        +   +   PL
Sbjct: 166 RLLGIIRTDDIGNNNTISSQRIADARIIYGGQGAIADSNAMGWASRYFNSPWFPL 220


>gi|85712257|ref|ZP_01043308.1| Flagellar basal body L-ring protein [Idiomarina baltica OS145]
 gi|85693884|gb|EAQ31831.1| Flagellar basal body L-ring protein [Idiomarina baltica OS145]
          Length = 224

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 95/239 (39%), Gaps = 19/239 (7%)

Query: 2   YRYSFIVLCYSSLLFGCHS-SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
            R   +       L  C S   + +   P  +P+                 + ++    +
Sbjct: 1   MRLIIMAGVL-VTLAACSSNQPAPMPNDPYYAPVLPE--------------ERAEPVVPT 45

Query: 61  YSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL++  ++  ++ D +A  +GDI+TV ++    A        ++ +++   +       
Sbjct: 46  GSLYQAQYSDNMYSDIKARRLGDIITVTLQERTTASKSANAQTTKESNVDLPVPTILGQA 105

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                    + N  G    +G  +  ++ +L+  I   V   L NGNLI+ G + +R+N 
Sbjct: 106 ATINGN-PISANLGGTRDFTGDATADQSNRLSGEITVTVIRTLANGNLIVRGEKWLRINT 164

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE-NLSP 237
               + +TGI+RPQDV A N++   ++A ARI Y G G            +    +  P
Sbjct: 165 GDEYIRLTGIIRPQDVSADNTIPSTRVANARIEYSGTGSLASTQEQGWLTRFFNSSYWP 223


>gi|332140549|ref|YP_004426287.1| flagellar basal body L-ring protein [Alteromonas macleodii str.
           'Deep ecotype']
 gi|226701911|sp|B4RV30|FLGH_ALTMD RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|327550571|gb|AEA97289.1| flagellar basal body L-ring protein [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 226

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 52/239 (21%), Positives = 92/239 (38%), Gaps = 18/239 (7%)

Query: 4   YSFIVLCYSSLLFGCHSSISEI--TGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
               +     +L GC S+         P  +P+                    ++  +  
Sbjct: 2   RILGLSAALLILGGCASTNEPPVQANDPSFAPVVPDY--------------PRETVVEDG 47

Query: 62  SLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           SL+R      L+ D  A  VGDI+TV +  + QA     T  +++ +++     G +   
Sbjct: 48  SLFRSQLANNLYSDVTARRVGDIITVTLSENTQASKSADTSTAKDTNVNLNPITGLAGQA 107

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                 +  L        SG  + +++  L   I+  V  +L N NL+I G + + +N  
Sbjct: 108 INIGGESIQLGVSSSRDFSGDAAANQSNSLIGAISVTVVDVLPNSNLVIRGEKWLTLNQG 167

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSPL 238
              + +TGI+RP D+   N +   K+A ARI Y G G            +  ++   PL
Sbjct: 168 DEYIRLTGIIRPADISPENEIVSTKVANARIQYSGTGSFARAQEKGWLTKFFDSTWWPL 226


>gi|254486395|ref|ZP_05099600.1| flagellar L-ring protein FlgH [Roseobacter sp. GAI101]
 gi|214043264|gb|EEB83902.1| flagellar L-ring protein FlgH [Roseobacter sp. GAI101]
          Length = 242

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 79/242 (32%), Positives = 120/242 (49%), Gaps = 7/242 (2%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            +   + L  ++    C      +   P  S    S + N  +                 
Sbjct: 1   MKKVMLSLTIAAFSAACA-RTDHMGSTPTFSEPMQSAEHNAMVYEALPIRLAPVRLVDRS 59

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLW  +  +L  D RA+  GDI+TV I I++ A   NQT RSR+ S    +     +  +
Sbjct: 60  SLWSGTRNSLLGDRRAMQRGDIMTVVIEINENAEISNQTDRSRSGSESLSVPNLLGIPQR 119

Query: 122 QTPQMNGNLNYDG------GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
              ++    +            SSG GS+ R E L L +AA V  +L NG L ISG+QE+
Sbjct: 120 LDEKLPDGASSADLVGLSSSSNSSGNGSVKRKENLTLRVAATVVDVLPNGVLSISGTQEL 179

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
           RVN E+R L VTG VR +D+   N ++YDKIA AR+SYGG+G+ +++ +P IG Q+++ +
Sbjct: 180 RVNFELRELLVTGFVRSEDISRQNEITYDKIASARVSYGGRGQISDMQQPRIGQQVLDAV 239

Query: 236 SP 237
            P
Sbjct: 240 LP 241


>gi|127512282|ref|YP_001093479.1| flagellar basal body L-ring protein [Shewanella loihica PV-4]
 gi|126637577|gb|ABO23220.1| flagellar L-ring protein [Shewanella loihica PV-4]
          Length = 234

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 56/243 (23%), Positives = 99/243 (40%), Gaps = 21/243 (8%)

Query: 1   MYRYSFI---VLCYSSLLFGCH-SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDS 56
           M ++      VL  +  L GC  ++   I   P  +P+                      
Sbjct: 6   MAKFVMAKSSVLVVALALVGCASTNQKPIADDPYYAPVYPE--------------APPTK 51

Query: 57  TKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG 115
              + S+++DS A +L+ D +AL VGDI+TV ++   +A         + + L       
Sbjct: 52  IAATGSMYQDSQASSLYSDIKALKVGDIITVILQESTKAKKSANNELKKGSDLTLD-PIY 110

Query: 116 FSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
                        +L Y     +  +    ++  L+  I+A V  +L NGNL+I G + +
Sbjct: 111 AGGGNVTISGSPIDLRYKDSMNTKRESDADQSNSLSGSISANVMQVLNNGNLVIRGEKWI 170

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN- 234
            +N+    + +TGIVR QD+   N++   ++A ARI Y G G   +  +     Q   + 
Sbjct: 171 TINNGDEFVRLTGIVRSQDIRPDNTIDSQRVANARIQYSGTGTFADAQKVGWLSQFFMSD 230

Query: 235 LSP 237
             P
Sbjct: 231 WWP 233


>gi|312884831|ref|ZP_07744523.1| flagellar basal body L-ring protein [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367483|gb|EFP95043.1| flagellar basal body L-ring protein [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 223

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 53/237 (22%), Positives = 92/237 (38%), Gaps = 18/237 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M       +  + ++ GC      +   P                +       S    K 
Sbjct: 1   MTCLRVASILLTLIITGCAGRSEFVPPSPD------------EDKYAPPPLDYSLPKAKH 48

Query: 61  YSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL+R ++  ALF+D RA  VGD+LTV +  + ++     T   +++++   +       
Sbjct: 49  GSLYRHNYSMALFQDRRAYRVGDMLTVMLAEETESTKKANTKYGKSSNVGFGIPSLGG-- 106

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                      + D      G  + S+  KL   I   V  +L NG L ISG + +R+N 
Sbjct: 107 ---NTIDELEASVDAKRGFDGSATSSQKNKLEGSITVTVHEVLPNGVLRISGEKWLRLNQ 163

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
               + +TG+VR  D+  +N V   +I +ARI+Y G+G   +        Q   +  
Sbjct: 164 GDEFIRLTGMVRVDDISRNNQVFSSRIGDARITYAGRGAVADSNASGWLSQFFNSPW 220


>gi|91792667|ref|YP_562318.1| flagellar basal body L-ring protein [Shewanella denitrificans
           OS217]
 gi|91714669|gb|ABE54595.1| flagellar L-ring protein [Shewanella denitrificans OS217]
          Length = 224

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 58/237 (24%), Positives = 94/237 (39%), Gaps = 17/237 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +Y    L   SLL  C S           +P     D+    P        +  T  +
Sbjct: 1   MNKYIM--LLMVSLLSACSS-----------TPRKPIPDDPFYAPVYP--DAPATQTAAT 45

Query: 61  YSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            S++ DS A+ L+ D RA  +GDI+TV +    QA         + + +           
Sbjct: 46  GSIFLDSQASSLYSDIRAHKIGDIITVVLMESTQAKKSATNDIKKGSDMSMD-PLFAGGG 104

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                 +  +L Y     +  +    ++  L   I+A V  +L NGNL+I G + + +N+
Sbjct: 105 NVTIKGVPLDLKYKDAYNTKRESDADQSNSLAGSISANVMQVLSNGNLVIRGEKWISINN 164

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
               + VTGIVR QD+   N++   ++A ARI Y G G   +  +     Q      
Sbjct: 165 GDEFIRVTGIVRSQDIKPDNTIESVRVANARIQYSGTGTFADAQKVGWLGQFFLGEW 221


>gi|116049012|ref|YP_792186.1| flagellar basal body L-ring protein [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|313106038|ref|ZP_07792297.1| flagellar L-ring protein precursor FlgH [Pseudomonas aeruginosa
           39016]
 gi|122258120|sp|Q02IQ0|FLGH_PSEAB RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|115584233|gb|ABJ10248.1| flagellar L-ring protein precursor FlgH [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|310878799|gb|EFQ37393.1| flagellar L-ring protein precursor FlgH [Pseudomonas aeruginosa
           39016]
          Length = 231

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 50/245 (20%), Positives = 96/245 (39%), Gaps = 23/245 (9%)

Query: 1   MYRYSFIVLC-YSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R   + L   ++ L GC S        P  +P+                     + + 
Sbjct: 1   MNRLMIVSLLGIATALGGCVS-PPPKPNDPYYAPVLP--------------RTPLPAAQN 45

Query: 60  SYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + ++++      L+ D +A  VGDI+T+ +    QA     +   +++     L+  F  
Sbjct: 46  NGAIYQAGFEQNLYDDRKAFRVGDIITITLNEKTQASKKANSDIQKDSKTKMGLTSLFGS 105

Query: 119 FGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                       ++ +  Y G   + G     ++  L   I   V  +L NG L + G +
Sbjct: 106 GMTTNNPIGGGDLSLSAEYGGSRDAKGDSQAGQSNSLTGSITVTVAEVLPNGILSVRGEK 165

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
            + +N     + + G+VR  D+   N+VS  ++A+ARI+Y G G   +  +P    +   
Sbjct: 166 WMTLNTGNELVRIAGLVRADDIATDNTVSSTRVADARITYSGTGAFADASQPGWLDRFFL 225

Query: 234 N-LSP 237
           + L P
Sbjct: 226 SPLWP 230


>gi|258622491|ref|ZP_05717513.1| Flagellar L-ring protein precursor [Vibrio mimicus VM573]
 gi|258625231|ref|ZP_05720143.1| Flagellar L-ring protein precursor [Vibrio mimicus VM603]
 gi|262173357|ref|ZP_06041034.1| flagellar L-ring protein FlgH [Vibrio mimicus MB-451]
 gi|258582478|gb|EEW07315.1| Flagellar L-ring protein precursor [Vibrio mimicus VM603]
 gi|258585191|gb|EEW09918.1| Flagellar L-ring protein precursor [Vibrio mimicus VM573]
 gi|261890715|gb|EEY36702.1| flagellar L-ring protein FlgH [Vibrio mimicus MB-451]
          Length = 225

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 61/237 (25%), Positives = 93/237 (39%), Gaps = 16/237 (6%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M            LL GC              P     +E             S    KS
Sbjct: 1   MKWLIKSWAVAVVLLAGCAWRQE-------FVPPEPGTEEYA-----PPKLDYSLPEAKS 48

Query: 61  YSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL+R  +   LF+D RA  VGDILTV +  + ++     T   +    +  ++      
Sbjct: 49  GSLYRHQYSMTLFQDRRAYRVGDILTVQLSEETESSKKAGTKYGKGTDTNLGIAA---PT 105

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                  + +L+ +G  +  G  S S+  KL   I   V  +L NG L ISG + + +N 
Sbjct: 106 LGSEKLRDFSLSLEGERSFDGNASSSQGNKLQGAITVTVREVLPNGVLRISGEKWLSLNQ 165

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
               + +TGIVR  D+  +N VS  +I +ARI+Y G+G   +   P    Q   +  
Sbjct: 166 GDEFIRLTGIVRVDDISRNNQVSSLRIGDARITYAGRGVLADSNTPGWLTQFFNSPW 222


>gi|251789171|ref|YP_003003892.1| flagellar basal body L-ring protein [Dickeya zeae Ech1591]
 gi|247537792|gb|ACT06413.1| flagellar L-ring protein [Dickeya zeae Ech1591]
          Length = 239

 Score =  206 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 50/235 (21%), Positives = 87/235 (37%), Gaps = 10/235 (4%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
           R   +       L GC     +                    P   +    + S  ++  
Sbjct: 14  RLRLLAYVMMLTLSGCAYVPHDKV----------VTGATTAQPAPPLQAIPNGSIFQTGQ 63

Query: 63  LWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ 122
                +  +F+D R  NVGD LT+ ++ +  A  ++    SR+ S    ++    L    
Sbjct: 64  AMNYGYQPMFEDRRPRNVGDTLTIVLQENVSASKNSSANASRDASGSFGMTATPRLLEGP 123

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
                   N  G    +GKG  +        I   V  +L NGNL + G +++ VN    
Sbjct: 124 LGNNRAAFNATGKDDFTGKGGANANNTFTGTITVTVDQVLTNGNLHVVGEKQIAVNQGTE 183

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            +  +G+V P+ +   N+V   ++A+AR+ Y G G   E        +   N+SP
Sbjct: 184 FIRFSGVVNPRTISGSNTVPSTQVADARMEYVGNGYINEAQTMGWLQRFFLNVSP 238


>gi|260767926|ref|ZP_05876860.1| flagellar L-ring protein FlgH [Vibrio furnissii CIP 102972]
 gi|260615956|gb|EEX41141.1| flagellar L-ring protein FlgH [Vibrio furnissii CIP 102972]
          Length = 223

 Score =  206 bits (523), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 60/237 (25%), Positives = 97/237 (40%), Gaps = 18/237 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M + S + L    +L GC             +P     ++             S    +S
Sbjct: 1   MAKLSKVGLLSVLILAGCAGRDE-------FTPPSPDEEKYG-----PPTLDYSLPAAQS 48

Query: 61  YSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL+R  +A  LF+D RA  VGD+LTV +  + Q+     T   + +S+           
Sbjct: 49  GSLYRHQYAMTLFQDRRAYRVGDVLTVLLAEETQSKKSADTQYGKTSSVGLSAPVVGGKT 108

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
             +        + DG  +  G  S S+  KL   I   V+ +L NG + I G + +R+N 
Sbjct: 109 VDKLA-----ASIDGDRSFDGSASSSQGNKLEGAITVTVSEVLPNGVIRIRGEKWIRLNQ 163

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
               + +TGIVR  D+  +N VS  +I +ARI+Y G+G   +        Q   +  
Sbjct: 164 GDEFIRLTGIVRVDDISRNNQVSSQRIGDARITYSGRGALADSNASGWLTQFFNSPW 220


>gi|114570499|ref|YP_757179.1| flagellar L-ring protein [Maricaulis maris MCS10]
 gi|123026895|sp|Q0AN96|FLGH_MARMM RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|114340961|gb|ABI66241.1| flagellar L-ring protein [Maricaulis maris MCS10]
          Length = 251

 Score =  205 bits (522), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 81/230 (35%), Positives = 124/230 (53%), Gaps = 11/230 (4%)

Query: 19  HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK-------KSYSLWRDSHAAL 71
              +S +   P M+P+ +  D     P            +        + SLW  +    
Sbjct: 21  SDRLSYVGQTPPMTPIQNPADLAGTGPSQLPMPMPRMPQQRYATNSTANNSLWTANSPTF 80

Query: 72  FKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN-- 129
           F D RA  VGDI+TV+I I D A  +N T RSR+++    L+             N +  
Sbjct: 81  FGDPRADQVGDIVTVNIAISDSAQLNNTTNRSRSSAEDSDLTSFLGADLTGFFNDNIDPT 140

Query: 130 --LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
              +     + +G GS++R E ++L +AA+VT +L NGNL+I+G QEVRVN+E+R L +T
Sbjct: 141 SMTSLGSTSSLAGSGSVNRTESISLTVAALVTQVLPNGNLVIAGRQEVRVNNEVRELLIT 200

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           GI RPQD+ + N++++ +IAEARISYGG+G  ++  RP  G +L + L P
Sbjct: 201 GIARPQDIGSDNTIAHTQIAEARISYGGRGHLSDAQRPRYGQELYDILMP 250


>gi|149189839|ref|ZP_01868119.1| flagellar L-ring protein precursor [Vibrio shilonii AK1]
 gi|148836325|gb|EDL53282.1| flagellar L-ring protein precursor [Vibrio shilonii AK1]
          Length = 224

 Score =  205 bits (522), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 56/233 (24%), Positives = 95/233 (40%), Gaps = 18/233 (7%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
            + V+    +L GC +        P+  P      E +   +   +   +       SL+
Sbjct: 6   RWGVVIGLLVLTGCAAR-------PEFVP-----PEPDEQKYAPPELNYALPQATGGSLY 53

Query: 65  RDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT 123
           R  +   LF+D RA  VGD+LT+ +  + Q+     T   + + +    +          
Sbjct: 54  RHQYNLTLFQDRRAYRVGDVLTILLVEETQSSKKADTKFGKTSKVDFGAATVGG-----N 108

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
                 +  +G  A  G  + S+  KL   I   V  ++ NG L ISG + +R+N     
Sbjct: 109 TFDETAVGLNGSRAFDGSAASSQGNKLEGAITVTVHEVMPNGVLKISGEKWIRLNQGDEF 168

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           + VTGI+R  DVD +N V   +I +ARI+Y G+G   +        Q   +  
Sbjct: 169 IRVTGIIRADDVDRYNQVFSHRIGDARITYSGRGALADSNSAGWLTQFFTSPW 221


>gi|15596280|ref|NP_249774.1| flagellar basal body L-ring protein [Pseudomonas aeruginosa PAO1]
 gi|107100528|ref|ZP_01364446.1| hypothetical protein PaerPA_01001553 [Pseudomonas aeruginosa PACS2]
 gi|218892953|ref|YP_002441822.1| flagellar basal body L-ring protein [Pseudomonas aeruginosa LESB58]
 gi|254234219|ref|ZP_04927542.1| flagellar L-ring protein precursor FlgH [Pseudomonas aeruginosa
           C3719]
 gi|254239441|ref|ZP_04932763.1| flagellar L-ring protein precursor FlgH [Pseudomonas aeruginosa
           2192]
 gi|296390553|ref|ZP_06880028.1| flagellar basal body L-ring protein [Pseudomonas aeruginosa PAb1]
 gi|14548041|sp|Q9I4P6|FLGH_PSEAE RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|226701927|sp|B7UXA6|FLGH_PSEA8 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|9946999|gb|AAG04472.1|AE004539_14 flagellar L-ring protein precursor FlgH [Pseudomonas aeruginosa
           PAO1]
 gi|126166150|gb|EAZ51661.1| flagellar L-ring protein precursor FlgH [Pseudomonas aeruginosa
           C3719]
 gi|126192819|gb|EAZ56882.1| flagellar L-ring protein precursor FlgH [Pseudomonas aeruginosa
           2192]
 gi|218773181|emb|CAW28993.1| flagellar L-ring protein precursor FlgH [Pseudomonas aeruginosa
           LESB58]
          Length = 231

 Score =  205 bits (522), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 49/245 (20%), Positives = 96/245 (39%), Gaps = 23/245 (9%)

Query: 1   MYRYSFIVLC-YSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R   + L   ++ L GC  +       P  +P+                     + + 
Sbjct: 1   MNRLMIVSLLGIATALGGCV-NPPPKPNDPYYAPVLP--------------RTPLPAAQN 45

Query: 60  SYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + ++++      L+ D +A  VGDI+T+ +    QA     +   +++     L+  F  
Sbjct: 46  NGAIYQAGFEQNLYDDRKAFRVGDIITITLNEKTQASKKANSDIQKDSKTKMGLTSLFGS 105

Query: 119 FGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                       ++ +  Y G   + G     ++  L   I   V  +L NG L + G +
Sbjct: 106 GMTTNNPIGGGDLSLSAEYGGSRDAKGDSQAGQSNSLTGSITVTVAEVLPNGILSVRGEK 165

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
            + +N     + + G+VR  D+   N+VS  ++A+ARI+Y G G   +  +P    +   
Sbjct: 166 WMTLNTGNELVRIAGLVRADDIATDNTVSSTRVADARITYSGTGAFADASQPGWLDRFFL 225

Query: 234 N-LSP 237
           + L P
Sbjct: 226 SPLWP 230


>gi|49082006|gb|AAT50403.1| PA1083 [synthetic construct]
          Length = 232

 Score =  205 bits (522), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 49/245 (20%), Positives = 96/245 (39%), Gaps = 23/245 (9%)

Query: 1   MYRYSFIVLC-YSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R   + L   ++ L GC  +       P  +P+                     + + 
Sbjct: 1   MNRLMIVSLLGIATALGGCV-NPPPKPNDPYYAPVLP--------------RTPLPAAQN 45

Query: 60  SYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + ++++      L+ D +A  VGDI+T+ +    QA     +   +++     L+  F  
Sbjct: 46  NGAIYQAGFEQNLYDDRKAFRVGDIITITLNEKTQASKKANSDIQKDSKTKMGLTSLFGS 105

Query: 119 FGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                       ++ +  Y G   + G     ++  L   I   V  +L NG L + G +
Sbjct: 106 GMTTNNPIGGGDLSLSAEYGGSRDAKGDSQAGQSNSLTGSITVTVAEVLPNGILSVRGEK 165

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
            + +N     + + G+VR  D+   N+VS  ++A+ARI+Y G G   +  +P    +   
Sbjct: 166 WMTLNTGNELVRIAGLVRADDIATDNTVSSTRVADARITYSGTGAFADASQPGWLDRFFL 225

Query: 234 N-LSP 237
           + L P
Sbjct: 226 SPLWP 230


>gi|152984579|ref|YP_001349647.1| flagellar basal body L-ring protein [Pseudomonas aeruginosa PA7]
 gi|166214823|sp|A6V9B2|FLGH_PSEA7 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|150959737|gb|ABR81762.1| flagellar L-ring protein precursor FlgH [Pseudomonas aeruginosa
           PA7]
          Length = 231

 Score =  205 bits (521), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 48/245 (19%), Positives = 96/245 (39%), Gaps = 23/245 (9%)

Query: 1   MYRYSFIVLC-YSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R   + L   +++L GC  +       P  +P+                     + + 
Sbjct: 1   MNRLMIVSLLGIATVLGGCV-NPPPKPNDPYYAPVLP--------------RTPLPAAQN 45

Query: 60  SYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + ++++      L+ D +A  VGDI+T+ +    QA     +   +++     L+  F  
Sbjct: 46  NGAIYQAGFEQNLYDDRKAFRVGDIITITLNEKTQASKKANSDIQKDSKTKMGLTSLFGS 105

Query: 119 FGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                       ++ +  Y G   + G     ++  L   I   V  +L NG L + G +
Sbjct: 106 GMTTNNPIGGGDLSLSAEYGGSRDAKGDSQAGQSNSLTGSITVTVAEVLPNGILSVRGEK 165

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
            + +N     + + G+VR  D+   N+V   ++A+ARI+Y G G   +  +P    +   
Sbjct: 166 WMTLNTGNELVRIAGLVRADDIATDNTVPSTRVADARITYSGTGAFADASQPGWLDRFFL 225

Query: 234 N-LSP 237
           + L P
Sbjct: 226 SPLWP 230


>gi|88704303|ref|ZP_01102017.1| flagellar L-ring protein FlgH [Congregibacter litoralis KT71]
 gi|88701354|gb|EAQ98459.1| flagellar L-ring protein FlgH [Congregibacter litoralis KT71]
          Length = 229

 Score =  205 bits (521), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 61/240 (25%), Positives = 101/240 (42%), Gaps = 16/240 (6%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +   ++    + L  C    S+    P+   +         +               +
Sbjct: 1   MDKLRILLCVPLASLVACAGVESD--SPPEYVKIEPIEYPEVVVSTAP----------TT 48

Query: 61  YSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL+ D+    LF+D RA  +GDI++V +     A     T  S++NS+       F   
Sbjct: 49  GSLYADNRSMFLFEDVRAHEIGDIVSVVLVESTSATKSADTDVSKDNSVSIVDPTIFGAP 108

Query: 120 GQ-QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                 + N         A   +GS +++ +LN  IA  V+ +L NGNL I G + +++N
Sbjct: 109 VTINNGRYNLGTELSSSSAFESEGSSNQSNRLNGSIAVQVSRVLPNGNLEIQGEKWIKIN 168

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
                + + GIVRP+D+   N++    +A+ARISYGG G   E   P    +     SPL
Sbjct: 169 QGDEYIRLRGIVRPEDLSPTNTIPSTLVADARISYGGTGILNESNTPGWLTRFFM--SPL 226


>gi|218528670|ref|YP_002419486.1| flagellar L-ring protein [Methylobacterium chloromethanicum CM4]
 gi|218520973|gb|ACK81558.1| flagellar L-ring protein [Methylobacterium chloromethanicum CM4]
          Length = 235

 Score =  205 bits (521), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 90/222 (40%), Positives = 134/222 (60%), Gaps = 3/222 (1%)

Query: 16  FGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDS 75
             C S +  +   P ++P+G+ L+       L   F         +S W  + AAL++D 
Sbjct: 16  GACQSDLDRLGRPPLLTPIGTGLNAP--REPLPTSFGALGPRHSYHSTWSPASAALYQDP 73

Query: 76  RALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGG 135
           RA +VGD++TV I I+D+A FDN + R R+         G+ + G +      +     G
Sbjct: 74  RARDVGDVITVSIAINDKAQFDNASERGRSQKSSLGFDFGYGISGLKD-TATADTGIRSG 132

Query: 136 GASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDV 195
             + G+GSI R E L+L +AA+VT +L NGN++ISGSQEVRVN+E+R L V GIVRP+D+
Sbjct: 133 TETKGQGSIDRKESLSLSVAAVVTEVLPNGNVLISGSQEVRVNNEVRVLEVAGIVRPRDI 192

Query: 196 DAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
              N++ YDKIAEARISYGG+GR T++  P +G ++ E ++P
Sbjct: 193 SRKNTIDYDKIAEARISYGGRGRITDVQGPSLGQRVFETVAP 234


>gi|188025865|ref|ZP_02960113.2| hypothetical protein PROSTU_02020 [Providencia stuartii ATCC 25827]
 gi|188020799|gb|EDU58839.1| hypothetical protein PROSTU_02020 [Providencia stuartii ATCC 25827]
          Length = 255

 Score =  205 bits (521), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 54/232 (23%), Positives = 93/232 (40%), Gaps = 10/232 (4%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
            +V+       GC            + P      + + +P        + +  +S     
Sbjct: 33  VLVIALVLATSGCA----------YVKPRPLVDTQTSALPTAPTAPAPNGAIFQSAQPAY 82

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
             +  LF+D R  NVGDILT++++ +  A  ++    +R+       +            
Sbjct: 83  YGYQPLFEDRRPRNVGDILTINLQENVSASKNSSANANRSGKTGFLAAILPGFMQGWLGG 142

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
            N  L+  G    SGKG  +        I   V  +L NGNL + G + + +N    S+ 
Sbjct: 143 SNTELDVKGSSDFSGKGGANANNTFRGTITVTVDQLLANGNLHVVGEKRIAINQGTESIR 202

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            +G+V P+ + A N+VS  ++A+ARI Y G G   E        +   N+SP
Sbjct: 203 FSGVVNPRTIGADNNVSSTQVADARIEYVGDGYINESQTMGWLQRFFLNVSP 254


>gi|295688782|ref|YP_003592475.1| flagellar L-ring protein [Caulobacter segnis ATCC 21756]
 gi|295430685|gb|ADG09857.1| flagellar L-ring protein [Caulobacter segnis ATCC 21756]
          Length = 244

 Score =  205 bits (521), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 84/225 (37%), Positives = 122/225 (54%), Gaps = 6/225 (2%)

Query: 19  HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRAL 78
            S++ E    P+++P+G                + +     + SLWR    A F D RA 
Sbjct: 19  CSTVKEAVKGPELAPVGYPAALAPIQQQYVSAREPAPQAASANSLWRVGARAFFNDQRAS 78

Query: 79  NVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN------LNY 132
            VGDILTV I IDD A   NQT  SR ++    +     L       + G       L  
Sbjct: 79  RVGDILTVMIDIDDSADTKNQTDSSRASTTKAGVPHLLGLESSLGKVLPGGFDPSNALET 138

Query: 133 DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRP 192
                ++G G+I R+EK++L IAA+V+ +L NGN++I G+QEVR N E+R L V GIVRP
Sbjct: 139 SSTTTNAGAGNIKRSEKISLTIAAVVSQVLPNGNMVIQGTQEVRTNAELRQLTVAGIVRP 198

Query: 193 QDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +D+ + N++ + +IAEARISYGG+G  + + + P G  L+E  SP
Sbjct: 199 EDISSANTIRHTQIAEARISYGGRGDISRVQKTPAGQSLVERFSP 243


>gi|119477950|ref|ZP_01618050.1| flagellar L-ring protein FlgH [marine gamma proteobacterium
           HTCC2143]
 gi|119448863|gb|EAW30105.1| flagellar L-ring protein FlgH [marine gamma proteobacterium
           HTCC2143]
          Length = 236

 Score =  204 bits (520), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 50/238 (21%), Positives = 94/238 (39%), Gaps = 18/238 (7%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
           +R  F+V+   S L  C      +   P  +P+                         S 
Sbjct: 14  FRMIFLVVSIGS-LTACTIGPDAMPNDPAYAPVYP--------------LSAEIPMANSG 58

Query: 62  SLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            ++R  + A LF+D +A  VGDI++V +    Q+     T   + NS+         +  
Sbjct: 59  GIYRPGYSAGLFEDLKARRVGDIISVILSERTQSSKTADTEIKKENSVSFDAGTVLGVSP 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                 N   +        G+    ++  L+  IA  +  IL NG +++ G + + +N  
Sbjct: 119 S-LGDYNMQTSVTQDRELKGEAGSDQSNSLSGSIAVTIAEILPNGLMMVRGEKWMTLNRG 177

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
              + + G++RP+DV   N++   ++A+ARI+Y G G      +   G +   +   P
Sbjct: 178 EEFIRIQGLIRPEDVQPDNTILSTRLADARITYSGTGDLANANKQGWGARFFNSEYWP 235


>gi|146278641|ref|YP_001168800.1| flagellar basal body L-ring protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556882|gb|ABP71495.1| flagellar L-ring protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 239

 Score =  204 bits (520), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 85/225 (37%), Positives = 115/225 (51%), Gaps = 6/225 (2%)

Query: 19  HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRAL 78
              ++E+   P  SP   +   +        +   +       SLW    A+L  D RA 
Sbjct: 14  CGRLAEVGKAPSFSPADETFQYHAMYALPIPESLGNSGPTAGSSLWAGDRASLLGDRRAS 73

Query: 79  NVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGG--- 135
             GDILTV I IDD+A   N TGRSR+      L   F +  +    +    + +     
Sbjct: 74  RRGDILTVAIEIDDRAEISNSTGRSRSGGESLGLPSFFGIPQRIDRHLPDGASMEDAVST 133

Query: 136 ---GASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRP 192
               + SG GS+ R EKL L +AA V   L NG L I G QEVRVN E+R L VTG VRP
Sbjct: 134 SSSSSYSGDGSVRRKEKLTLRVAATVVEELPNGVLRIQGQQEVRVNYELRELVVTGYVRP 193

Query: 193 QDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            D+   N ++YDKIAEARISYGG+G+ T++ +P  G Q+ + + P
Sbjct: 194 GDISRQNEITYDKIAEARISYGGRGQITDVQQPRYGQQVADIILP 238


>gi|121602817|ref|YP_989396.1| flagellar basal body L-ring protein [Bartonella bacilliformis
           KC583]
 gi|166214815|sp|A1UTU3|FLGH_BARBK RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|120614994|gb|ABM45595.1| flagellar L-ring protein FlgH [Bartonella bacilliformis KC583]
          Length = 230

 Score =  204 bits (519), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 92/236 (38%), Positives = 137/236 (58%), Gaps = 7/236 (2%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
               F ++  S ++  C  +  +   +P  SP+ + L      P            + +Y
Sbjct: 1   MYLVFGIIFTSVIVTSCSYNTKDFNSVPDFSPVRADL---GYAPSRTAQTYPLPPRESNY 57

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SL+R S  + F+D RA+  GD+LTV I I+D+A  +N++    ++S    +  G+S    
Sbjct: 58  SLYRASGNSFFRDPRAMQPGDVLTVQISINDRASLNNKSDLKSDSSSKYTIGTGYSFMD- 116

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
              ++ G+L  +    S G G I R E + L +AAIVT +L NGNLII GSQEVRVN E+
Sbjct: 117 ---RIAGSLEGESSNQSKGDGKIERQENIRLSVAAIVTDVLPNGNLIIRGSQEVRVNHEL 173

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           R LN+ G+VRP+D+  +N + YDKIAEARISYGG+GR +E+ +PP G QL+  +SP
Sbjct: 174 RILNIAGVVRPRDISGNNMIEYDKIAEARISYGGRGRISEIQQPPYGQQLLNQISP 229


>gi|149375031|ref|ZP_01892804.1| Flagellar basal body L-ring protein [Marinobacter algicola DG893]
 gi|149360920|gb|EDM49371.1| Flagellar basal body L-ring protein [Marinobacter algicola DG893]
          Length = 235

 Score =  204 bits (519), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 56/238 (23%), Positives = 107/238 (44%), Gaps = 23/238 (9%)

Query: 5   SFIVLCYSSLLFGCH--SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
           +F ++    +L GC   S    I   PQ +P+ +                      +S +
Sbjct: 17  TFALVAILVVLQGCTAMSRPRAIPDDPQYAPVRAE--------------AMMQRDPESGA 62

Query: 63  LWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           +++ S   +L+ D+ ALNVGDILTV +    +A  + ++  +++N +             
Sbjct: 63  IYQSSRNYSLYGDTVALNVGDILTVTLEESTRASKNAESSITKDNEVSMLDPQILGK--- 119

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
               +    +++      G+    ++  LN  I   VT +L NG L I G + + + +  
Sbjct: 120 --GNIGLATDFNLERDFEGQAEADQSNSLNGNITVTVTEVLPNGVLHIRGEKWLSLTNGD 177

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS-PL 238
             + +TG+VRP+D+   N+V+ ++IA+ARI+YGG G   +  +     +   +   PL
Sbjct: 178 EYIRLTGLVRPEDISPDNTVASNRIADARIAYGGTGDFDQANQMGWLARFFNSEWFPL 235


>gi|170722888|ref|YP_001750576.1| flagellar basal body L-ring protein [Pseudomonas putida W619]
 gi|226701928|sp|B1JCC5|FLGH_PSEPW RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|169760891|gb|ACA74207.1| flagellar L-ring protein [Pseudomonas putida W619]
          Length = 231

 Score =  204 bits (519), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 49/245 (20%), Positives = 98/245 (40%), Gaps = 23/245 (9%)

Query: 1   MYRYS-FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R      L  + LL GC +  ++    P  +P+                     +   
Sbjct: 1   MNRLLSLFALGGAVLLAGCVAPTAK-PNDPYYAPVLP--------------RTPLPAAAN 45

Query: 60  SYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + S+++      L+ D +A  VGDI+T+ +     A  +  +   +++S +  L+  F  
Sbjct: 46  NGSIYQAGFEQNLYSDRKAFRVGDIITITLNERTSASKNAGSQIQKDSSANIGLTSLFGA 105

Query: 119 FGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                    +  ++    Y G  A+ G    ++   L   I   V  +L NG + + G +
Sbjct: 106 TPSTNNPFGSGDLSLEAGYSGERATKGDSKATQGNTLTGSITVTVAEVLPNGIIAVRGEK 165

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
            + +N     + + G++R  D+   N+V   ++A+ARI+Y G G   +  +P    +   
Sbjct: 166 WMTLNTGEELVRIAGLIRADDIATDNTVPSTRVADARITYSGTGSFADASQPGWLDRFFL 225

Query: 234 N-LSP 237
           + L P
Sbjct: 226 SPLWP 230


>gi|259418147|ref|ZP_05742066.1| flagellar L-ring protein FlgH [Silicibacter sp. TrichCH4B]
 gi|259347053|gb|EEW58867.1| flagellar L-ring protein FlgH [Silicibacter sp. TrichCH4B]
          Length = 223

 Score =  204 bits (519), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 83/222 (37%), Positives = 122/222 (54%), Gaps = 6/222 (2%)

Query: 22  ISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVG 81
           +  I   P  +P   + +    +         +     + SLW  S A+L  D RA   G
Sbjct: 1   MDHIGKPPSFTPADETQEHVAMLYQGLPLTSQTQRAVDNASLWSGSRASLLGDRRATKKG 60

Query: 82  DILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN------LNYDGG 135
           DILTV I I+++A   N T RSRN+S   ++     L  +   ++         ++    
Sbjct: 61  DILTVVIEINEKASISNDTKRSRNSSESMQVPQLLGLPQRLDERLPDGASSADLIDLGSN 120

Query: 136 GASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDV 195
            +S G GS+SR+EKL L +AA V  +L NG L ISGSQE+RVN E+R L V+G VRP D+
Sbjct: 121 SSSGGSGSVSRSEKLELRVAATVVDVLPNGVLAISGSQELRVNFELRELLVSGYVRPDDI 180

Query: 196 DAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
              N V+YDKIA AR+SYGG+G+ T++ +P  G Q+++ + P
Sbjct: 181 SRQNEVTYDKIASARVSYGGRGQITDVQQPRYGQQVLDAVLP 222


>gi|271500069|ref|YP_003333094.1| flagellar L-ring protein [Dickeya dadantii Ech586]
 gi|270343624|gb|ACZ76389.1| flagellar L-ring protein [Dickeya dadantii Ech586]
          Length = 239

 Score =  204 bits (519), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 51/235 (21%), Positives = 89/235 (37%), Gaps = 10/235 (4%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
           R   +       L GC     +                    P   +    + S  ++  
Sbjct: 14  RPRLLAYVMMLTLSGCAYVPHDKV----------VTGPTTAQPASPLQAIPNGSIFQTGQ 63

Query: 63  LWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ 122
                +  +F+D R  NVGD LT+ ++ +  A  ++    SR+ S    ++    L    
Sbjct: 64  AMNYGYQPMFEDRRPRNVGDTLTIVLQENVSASKNSSANASRDASSSFGMTTTPRLLEGP 123

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
                  L+  G  A +GKG  +        I   V  +L NGNL + G +++ VN    
Sbjct: 124 LGNNRAALDATGKDAFTGKGGANANNTFTGTITVTVDQVLTNGNLHVVGEKQIAVNQGTE 183

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            +  +G+V P+ +   N+V   ++A+AR+ Y G G   E        +   N+SP
Sbjct: 184 FIRFSGVVNPRTISGSNTVPSTQVADARMEYVGNGYINETQTMGWLQRFFLNVSP 238


>gi|126176153|ref|YP_001052302.1| flagellar basal body L-ring protein [Shewanella baltica OS155]
 gi|304412505|ref|ZP_07394111.1| flagellar L-ring protein [Shewanella baltica OS183]
 gi|307307164|ref|ZP_07586902.1| flagellar L-ring protein [Shewanella baltica BA175]
 gi|125999358|gb|ABN63433.1| flagellar L-ring protein [Shewanella baltica OS155]
 gi|304349147|gb|EFM13559.1| flagellar L-ring protein [Shewanella baltica OS183]
 gi|306910403|gb|EFN40834.1| flagellar L-ring protein [Shewanella baltica BA175]
          Length = 220

 Score =  204 bits (519), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 61/239 (25%), Positives = 99/239 (41%), Gaps = 21/239 (8%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            R+ +      +LL GC S I +    P                +   +   S    K  
Sbjct: 1   MRWLW--FLCFALLSGCMSHIPDKETKP------------GTKEWAPPEIDYSLPDAKDG 46

Query: 62  SLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           SL+R      LFKD RA   GDILTV +     +     T  ++   +   L+G      
Sbjct: 47  SLYRPGFMLTLFKDKRAFREGDILTVALDEKTYSSKKADTKTNKEQDMGMGLTGNIG--- 103

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
             +   N +         +G GS ++  +L+  I   V+ +L NG L+I G + +R+N  
Sbjct: 104 --SQSANADGKTSFSRGFNGAGSSTQQNQLSGSITVTVSKVLPNGTLLIRGEKWLRLNQG 161

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS-PL 238
              L + GI+R  D+  +N++S  +IA+ARI YGG+G   +        +   +   PL
Sbjct: 162 DEYLRLLGIIRTDDIGNNNTISSQRIADARIIYGGQGAIADSNAMGWASRYFNSPWFPL 220


>gi|145297457|ref|YP_001140298.1| lateral flagellar L-ring protein, LfgH [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142850229|gb|ABO88550.1| lateral flagellar L-ring protein, LfgH [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 223

 Score =  204 bits (519), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 52/237 (21%), Positives = 94/237 (39%), Gaps = 18/237 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  +  L    LL GC +         ++       ++              +     
Sbjct: 1   MMKAMWRYLWVVLLLGGCATY--------ELKAPEPGDEKWAPSRPKLSVSARGED---- 48

Query: 61  YSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL+R  +   LF+D RA  +GDILTV +    Q+     T  S+N+S++          
Sbjct: 49  GSLYRGDYMMTLFQDRRAYRIGDILTVVLEERTQSSKKANTSMSKNSSMNVPAPSIGGKV 108

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                + +   +        G  + S+   L   I   V  ++ NG L I G + +R+N 
Sbjct: 109 -----RSDWGASLSADRDFDGGATSSQQNTLAGSITVTVAEVMPNGVLGIRGEKWIRLNQ 163

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
               + + G+VR +D+D  N +S  +IA+ARI+Y G+G   +  +     +   +  
Sbjct: 164 GDEYIRLGGMVRVEDIDQSNRISSQRIADARITYAGRGALADSNQMGWLGRFFSSAF 220


>gi|302343759|ref|YP_003808288.1| flagellar L-ring protein [Desulfarculus baarsii DSM 2075]
 gi|301640372|gb|ADK85694.1| flagellar L-ring protein [Desulfarculus baarsii DSM 2075]
          Length = 227

 Score =  204 bits (518), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 59/240 (24%), Positives = 103/240 (42%), Gaps = 17/240 (7%)

Query: 1   MYR--YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
           M +   +   +  +  L GC SS                  + +           +    
Sbjct: 1   MTKTTLTIAAVAMALCLAGCASS--------------PGQFQPSLPAAPKPTIDITHPKP 46

Query: 59  KSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
            + SL+  + + +F D RA NVGDI+ V+I  + +A   N T   R +     +S     
Sbjct: 47  TAGSLFVATRSDMFTDLRARNVGDIIVVEIVENSKAAKKNDTKAERKSDYDIGVSSFMGY 106

Query: 119 FGQQTPQMNGNL-NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                      L   +    S  K  +++ + +   I   V  +L NGN+I+ GS+E++V
Sbjct: 107 EQDLPGSDPSKLIGANFNSKSDAKAQLTKEDTMTSSIGCTVVEVLNNGNMIVKGSRELQV 166

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N E + + + G VRPQDV + N+V   ++A+A I Y G+G  T+   P    +L++ + P
Sbjct: 167 NGETQYIVLQGTVRPQDVTSENTVYSTQLADATIHYTGRGVLTDKQTPGWLARLLDQVWP 226


>gi|74101661|gb|AAZ99751.1| FlgHL [Aeromonas hydrophila]
          Length = 223

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 52/237 (21%), Positives = 94/237 (39%), Gaps = 18/237 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  +  L    LL GC +         ++       ++              +     
Sbjct: 1   MMKAMWRYLWVVLLLGGCATY--------ELKAPEPGDEKWAPSRPKLSVSARGED---- 48

Query: 61  YSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL+R  +   LF+D RA  +GDILTV +    Q+     T  S+N+S++          
Sbjct: 49  GSLYRGDYMMTLFQDRRAYRIGDILTVVLEERTQSSKKANTSMSKNSSMNVPAPSIGGKV 108

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                + +   +        G  + S+   L   I   V  ++ NG L I G + +R+N 
Sbjct: 109 -----RSDWGASLSADRDFDGGATSSQQNTLAGSITVTVAEVMPNGVLGIRGEKWIRLNQ 163

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
               + + G+VR +D+D  N +S  +IA+ARI+Y G+G   +  +     +   +  
Sbjct: 164 GDEYIRLGGMVRVEDIDQSNRISSQRIADARITYAGRGALADTNQMGWLGRFFSSAF 220


>gi|260574399|ref|ZP_05842403.1| flagellar L-ring protein [Rhodobacter sp. SW2]
 gi|259023295|gb|EEW26587.1| flagellar L-ring protein [Rhodobacter sp. SW2]
          Length = 239

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 86/229 (37%), Positives = 122/229 (53%), Gaps = 7/229 (3%)

Query: 15  LFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKD 74
           +  C   + ++   P  SP+  S   N        +    D+   + SLW    A+LF D
Sbjct: 11  VAAC-GRLDQVGRAPAFSPLEGSYQHNAMYSNPIPESTEPDAASDASSLWTGGRASLFGD 69

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN----- 129
            RA   GDILTV I IDD+A   N + RSR++S +  +     +  +    +        
Sbjct: 70  RRAGRRGDILTVVIEIDDKAEISNSSDRSRSSSENMGIPSLLGIPQRLNSALPAGASMAD 129

Query: 130 -LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
            ++  G  +  G GS++R EKL L +AA V   L NG L I G QEVRVN E+R L VTG
Sbjct: 130 AVSATGSSSFQGDGSVARKEKLTLRVAATVVEELPNGVLRIEGQQEVRVNFELRELIVTG 189

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            VRP D+   N ++YDKIA ARISYGG+G+ T++ +P +G Q+ + L P
Sbjct: 190 YVRPVDISRQNEITYDKIAGARISYGGRGQITDVQQPRLGQQVADILLP 238


>gi|304310888|ref|YP_003810486.1| Flagellar L-ring protein precursor [gamma proteobacterium HdN1]
 gi|301796621|emb|CBL44833.1| Flagellar L-ring protein precursor [gamma proteobacterium HdN1]
          Length = 237

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 50/243 (20%), Positives = 105/243 (43%), Gaps = 24/243 (9%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
              +    ++L GC S + +    P+ +P+     + +                 + S++
Sbjct: 10  LVSLFFAVAILSGCASQMPK-PDDPRYAPVFPQAPQTD--------------ISNTGSIY 54

Query: 65  -RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT 123
                 +L++D RA  VGDILTV ++    +   + T  S+++S + +++    L  +  
Sbjct: 55  GNSMGVSLYEDQRARRVGDILTVMLQERTSSSKTSGTDMSKDDSNNMQVNSILGLTPKTN 114

Query: 124 -------PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                    ++ N + D      G     ++ +L   I   VT ++ NG L + G + + 
Sbjct: 115 LPLGLSKSDLSLNSDTDSKRKFKGAAKSDQSNQLQGNITVTVTQVMPNGILYVRGEKWIT 174

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-L 235
           + +    + + G+VR  D++  N+V   KIA+ARI+YG  G   ++ +     +   + +
Sbjct: 175 LAEGDEYIRIHGLVRTADINPDNTVQSSKIADARIAYGATGDFADVNQKGWLSRFFSSKM 234

Query: 236 SPL 238
            PL
Sbjct: 235 WPL 237


>gi|292492366|ref|YP_003527805.1| flagellar L-ring protein [Nitrosococcus halophilus Nc4]
 gi|291580961|gb|ADE15418.1| flagellar L-ring protein [Nitrosococcus halophilus Nc4]
          Length = 265

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 51/247 (20%), Positives = 92/247 (37%), Gaps = 28/247 (11%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
           +   I +   +L+ GC +   +    P  +                           + +
Sbjct: 34  KNIIISVVGIALITGCAAQAPK--PDPNFAATRPGATPP--------------PQHHNGA 77

Query: 63  LWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS---- 117
           ++   +  +LF D RA   GD+LT+ +     A  ++ T   +  S              
Sbjct: 78  IYHAGYEISLFTDYRARQAGDVLTIVLEERTDAEKESDTAIDKETSYSLTNPTLLGSAVQ 137

Query: 118 ------LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
                          +  +     GA SG G  S+  +L+  I   V  +L NGNLI+ G
Sbjct: 138 FDTPKWFPLASNKNNSLEMAAAVEGAFSGSGDSSQNNRLDGHITVTVAEVLPNGNLIVQG 197

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ- 230
            + + +N     L ++GIV P+D+   N+VS  ++A+ R++Y G G T +  R     + 
Sbjct: 198 EKVITINQGNEYLRISGIVSPRDIQPDNTVSSLRLADVRLAYVGDGATQDANRMGWLTRL 257

Query: 231 LIENLSP 237
                 P
Sbjct: 258 FFSKFMP 264


>gi|117617995|ref|YP_857340.1| flagellar basal body L-ring protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117559402|gb|ABK36350.1| flagellar L-ring protein FlgH [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 223

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 53/240 (22%), Positives = 101/240 (42%), Gaps = 20/240 (8%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEI-TGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
            +  +++   +  L GC S+ +      P+ +P+    +  +  P              +
Sbjct: 1   MKAIWMLGLLA--LGGCSSTPNTAKPDDPEFAPVYGESEPVSVRP--------------T 44

Query: 61  YSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            ++++ D    ++ D +A  VGDI+T+++     A     T   ++N      +    + 
Sbjct: 45  GAIFQPDQVNGIYSDIKAHKVGDIITIELAESTSASKKANTQSGKDNKFTMNPAVLGGVP 104

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
               P  + + +    GA  G+    ++  L   I+  V  +L NGNL++ G + + +N+
Sbjct: 105 VTAGP-YDLSASLSQNGAFKGQAKADQSNSLQGNISVSVAKVLPNGNLLVRGEKWIMLNN 163

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSPL 238
               + +TG++RP+DV   NSVS  K+A ARI YGG G                    PL
Sbjct: 164 GNEYIRITGMIRPEDVTTDNSVSSQKVANARIHYGGTGDLANTQEQGWLTSFFNGPWWPL 223


>gi|146307866|ref|YP_001188331.1| flagellar basal body L-ring protein [Pseudomonas mendocina ymp]
 gi|145576067|gb|ABP85599.1| flagellar L-ring protein [Pseudomonas mendocina ymp]
          Length = 240

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 52/254 (20%), Positives = 104/254 (40%), Gaps = 32/254 (12%)

Query: 1   MYRYSFIVLCYSSLL--FGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
           M R  F     + LL   GC +  ++    P  +P+                     + +
Sbjct: 1   MNRQVFCFPLLAGLLLSTGCVAPTAK-PDDPYYAPVLP--------------RTPLPAAQ 45

Query: 59  KSYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
            + S+++      L+ D +A  VGDI+T+ +    QA  +  +   +++S        F 
Sbjct: 46  NNGSIYQAGFENGLYDDRKAFRVGDIITITLNERTQASKNANSNIQKDSSGAIGAPNLFG 105

Query: 118 L-------------FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN 164
           +              G   P ++   N++    +SG G   ++  L+  I   V  +L N
Sbjct: 106 MAVTPDNPLRSLGALGMNNPNLSLEANWNAQREASGSGQAGQSNSLSGSITVTVAEVLPN 165

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           G L + G + + +N     + ++G+VR  D+   N+V+  ++A+ARI+Y G G   +  +
Sbjct: 166 GILAVRGEKWMTLNTGDELVRISGLVRADDISTDNTVASTRVADARITYSGTGAFADASQ 225

Query: 225 PPIGHQLIEN-LSP 237
           P    +   + + P
Sbjct: 226 PGWLSRFFLSPMWP 239


>gi|308050021|ref|YP_003913587.1| flagellar L-ring protein [Ferrimonas balearica DSM 9799]
 gi|307632211|gb|ADN76513.1| flagellar L-ring protein [Ferrimonas balearica DSM 9799]
          Length = 232

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 72/233 (30%), Positives = 111/233 (47%), Gaps = 19/233 (8%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I L    +L GC ++                  + +   +     + S  T    SL+R 
Sbjct: 16  IALLSLMVLNGCSTT------------YIPEPVQPDAPEYAPPALEFSLPTPAHGSLYRK 63

Query: 67  SHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
            +  AL++D RA  VGDILTVD+    QA     T  S+++SL      G   +G  +  
Sbjct: 64  GYNLALYQDRRAYRVGDILTVDLEEKTQASKKADTSTSKDSSL-----QGSGSYGFGSST 118

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
            +G     GG   SG GS S+  +L   I   V+ +L NG L+I G + +R+N     + 
Sbjct: 119 GSGQAQLGGGRDFSGNGSSSQQNQLTGAITVTVSGVLPNGVLVIRGEKWLRLNQGDEYIR 178

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI-ENLSP 237
           + G+VRP+DVD  N +S  +IA+ARISYGG+G   ++  P  G +   + + P
Sbjct: 179 LVGLVRPEDVDQANRISSQRIADARISYGGRGTLADVNAPGWGMRFFNDPIFP 231


>gi|189426328|ref|YP_001953505.1| flagellar L-ring protein [Geobacter lovleyi SZ]
 gi|226701925|sp|B3EAV2|FLGH_GEOLS RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|189422587|gb|ACD96985.1| flagellar L-ring protein [Geobacter lovleyi SZ]
          Length = 224

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 62/241 (25%), Positives = 105/241 (43%), Gaps = 23/241 (9%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            ++  + L    LL GC    +E+                   P      K+      + 
Sbjct: 1   MKWYLVALS-GLLLSGCVVQQTEVVS-----------------PSFDQQLKSPAPNYSNG 42

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF-- 119
           S+W+ S   L +D +A  VGDI+T+ +     A     T   R++ +   +     L   
Sbjct: 43  SIWQASSIGLTEDGKARRVGDIVTIIVTETASASKQAATATGRSSQISAGIPNMLGLEES 102

Query: 120 ---GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                    ++  LN        G GS SR E L+  I+A V  +L N NL I G + VR
Sbjct: 103 KIITSNFADLSKLLNASASSKFDGSGSTSRKETLSATISAKVIDVLPNSNLKIEGRRNVR 162

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN+E + + V G +R +D+ A N+++   +A+A+ISY G+G  ++  +P     +++ L 
Sbjct: 163 VNNEDQIVTVKGTIRQRDITAENTINSIYVADAQISYAGEGIISDRQKPGWLMNVLDKLW 222

Query: 237 P 237
           P
Sbjct: 223 P 223


>gi|285018206|ref|YP_003375917.1| flagellar l-ring protein precursor (basal body l-ring protein)
           [Xanthomonas albilineans GPE PC73]
 gi|283473424|emb|CBA15929.1| probable flagellar l-ring protein precursor (basal body l-ring
           protein) [Xanthomonas albilineans]
          Length = 232

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 55/234 (23%), Positives = 97/234 (41%), Gaps = 13/234 (5%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
           F     S LL GC +       +   SPM   +                 +   + +++ 
Sbjct: 9   FSAALLSVLLGGCANLGVAAGDMRPYSPMAPIV-----------PVVAPQAQPSAGAIYA 57

Query: 66  DSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP 124
                +L+ D RA +VGD+LT+ +     A     T  S+ +S+                
Sbjct: 58  AGPGLSLYSDRRARDVGDLLTITLVESTNASSTAGTSISKKDSVKMATPTLLGTPFTING 117

Query: 125 QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
               N +  G  + +GKG+ +++  +   +   V   L NGNL+I G + +R+N     +
Sbjct: 118 TDVLNNSTSGDRSFAGKGNTAQSNTMQGSLTVTVMQRLPNGNLVIQGDKNLRLNQGDELV 177

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
            V GIVR  D+   N++   K+A+ARI+YGG+G   +        +   + +SP
Sbjct: 178 QVQGIVRAADIAPDNTIPSSKVADARIAYGGRGAVAQSNAMGWLSRFFNSRISP 231


>gi|167034940|ref|YP_001670171.1| flagellar basal body L-ring protein [Pseudomonas putida GB-1]
 gi|189044481|sp|B0KR09|FLGH_PSEPG RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|166861428|gb|ABY99835.1| flagellar L-ring protein [Pseudomonas putida GB-1]
          Length = 231

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 51/245 (20%), Positives = 96/245 (39%), Gaps = 24/245 (9%)

Query: 1   MYRYS-FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R      L  + LL GC +   +    P  +P+                     +   
Sbjct: 1   MNRLLSVFALGGAVLLAGCVAPTPK-PNDPYYAPVLP--------------RTPLPAAAN 45

Query: 60  SYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + S+++      L+ D +A  VGDI+T+ +     A  +  +   +N+     L+  F  
Sbjct: 46  NGSIYQAGFEQNLYSDRKAFRVGDIITITLNEKTSASKNAGSQIQKNSKADIGLTSLFGS 105

Query: 119 FGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                       ++    Y+G  A+ G    ++   L   I   V  +L NG + + G +
Sbjct: 106 TPNTNNPFGGGDLSLEAGYNGERATKGDSKATQGNTLTGSITVTVAEVLPNGIIAVRGEK 165

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
            + +N     + + G+VR  D+   N+V   ++A+ARI+Y G G   +  +P    +   
Sbjct: 166 WLTLNTGEELVRIAGMVRADDIATDNTVPSTRVADARITYSGTGSFADASQPGWLDRFF- 224

Query: 234 NLSPL 238
            +SPL
Sbjct: 225 -ISPL 228


>gi|104782839|ref|YP_609337.1| flagellar basal body L-ring protein [Pseudomonas entomophila L48]
 gi|122402466|sp|Q1I732|FLGH_PSEE4 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|95111826|emb|CAK16550.1| flagellar basal-body outer-membrane L ring protein [Pseudomonas
           entomophila L48]
          Length = 231

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 48/245 (19%), Positives = 95/245 (38%), Gaps = 25/245 (10%)

Query: 2   YRYSFIVLCY--SSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
            ++   V     + LL GC +   +    P  +P+                     +   
Sbjct: 1   MKHLLSVFALGGAVLLAGCVAPTPK-PNDPYYAPVLP--------------RTPLPAAAN 45

Query: 60  SYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + S+++     +L+ D +A  VGDI+T+ +     A  +  +   +N+     L+  F  
Sbjct: 46  NGSIYQAGFEQSLYTDRKAFRVGDIITITLNERTSASKNAGSQIQKNSKADIGLTSLFGS 105

Query: 119 FGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                       ++    Y G   + G    ++   L   I   V  +L NG + + G +
Sbjct: 106 SPNTNNPFGGGDLSLEAGYSGDRTTKGDSKATQGNTLTGSITVTVAEVLPNGIIAVRGEK 165

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
            + +N     + + G+VR  D+   N+V   ++A+ARI+Y G G   +  +P    +   
Sbjct: 166 WMTLNTGEELVRIAGLVRADDIATDNTVPSTRVADARITYSGTGSFADASQPGWLDRFF- 224

Query: 234 NLSPL 238
            +SPL
Sbjct: 225 -ISPL 228


>gi|163744351|ref|ZP_02151711.1| flagellar L-ring protein precursor H [Oceanibulbus indolifex
           HEL-45]
 gi|161381169|gb|EDQ05578.1| flagellar L-ring protein precursor H [Oceanibulbus indolifex
           HEL-45]
          Length = 256

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 80/250 (32%), Positives = 120/250 (48%), Gaps = 16/250 (6%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPM-----GSSLDENNRMPFLGIDFKNSDST 57
           R S ++   +  L GC +S       PQ SP+             ++P   +  +     
Sbjct: 7   RPSVLMFGAALALTGCDTS-PHFDRDPQPSPIVVSGETIPEVARVQVPMPAVALEPPRRG 65

Query: 58  KKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
               SL+     ALF D RA ++GDI+TV I IDD+A   N T R R  +        F 
Sbjct: 66  SAKASLFSARSEALFADQRADDIGDIVTVVISIDDRAQLRNSTDREREGASSIGFPTFFG 125

Query: 118 LFGQQTPQMNGN----------LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
              +    + G           +       +SG G+ISR E++ L +AA+V   L NG +
Sbjct: 126 YGAKIAAILPGISAADLPSGDVVEIGSASEASGSGAISRNERIELKVAALVIDKLPNGTV 185

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
           +++G QE+ VN E+R L + GIVRP D+   N++SYDKIAEARI+YGG+G  +       
Sbjct: 186 VVAGRQEIMVNQELRELRMAGIVRPADIRDDNTISYDKIAEARIAYGGRGTLSRAQERSY 245

Query: 228 GHQLIENLSP 237
           G   ++ + P
Sbjct: 246 GEDAMDVILP 255


>gi|197120121|ref|YP_002140548.1| flagellar L-ring lipoprotein FlgH [Geobacter bemidjiensis Bem]
 gi|197089481|gb|ACH40752.1| flagellar L-ring lipoprotein FlgH [Geobacter bemidjiensis Bem]
          Length = 230

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 63/201 (31%), Positives = 97/201 (48%), Gaps = 3/201 (1%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQ 99
              + P           +  S SLW+ S   L +D +A   GDI+TV I  +  A     
Sbjct: 29  AEVQTPTFDQQIPAPQVSYASGSLWQASSTGLAEDMKARRRGDIITVVISENASASKKAS 88

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTP---QMNGNLNYDGGGASSGKGSISRAEKLNLLIAA 156
           TG SR +S+   +     L          ++  LN        G GS SR E L   I+A
Sbjct: 89  TGTSRGSSISAGIPKLLGLETTAIKNWADLSDLLNASFSSKFDGSGSTSRQETLQATISA 148

Query: 157 IVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGK 216
            V  ++ NGNL+I G + V+VN+E + + +TG VR +DV A N++S   IA+A+I+Y GK
Sbjct: 149 KVVDVIPNGNLLIEGRRNVKVNNEDQIIILTGTVRGRDVSADNTISSALIADAKIAYSGK 208

Query: 217 GRTTELLRPPIGHQLIENLSP 237
           G  ++  +P      ++ + P
Sbjct: 209 GIISDRQKPGWLLNALDKIWP 229


>gi|254419064|ref|ZP_05032788.1| flagellar L-ring protein FlgH [Brevundimonas sp. BAL3]
 gi|196185241|gb|EDX80217.1| flagellar L-ring protein FlgH [Brevundimonas sp. BAL3]
          Length = 246

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 87/245 (35%), Positives = 131/245 (53%), Gaps = 8/245 (3%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSS--LDENNRMPFLGIDFKNSDSTK 58
           M +   +    ++   G  S+  E    P+++P+G    L    +        +   +  
Sbjct: 1   MRKILIVAAVSAAASLGACSTAIEAVRGPELAPIGYPAALVPAQQAYMADPSLRQEATPA 60

Query: 59  KSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
            + SLWR      F D RA ++GDILTV I IDD+A   N T R+R+N+    +S  F L
Sbjct: 61  SANSLWRVGARTFFGDQRARHIGDILTVRIDIDDRAQTQNSTQRARSNTSANGVSNFFGL 120

Query: 119 FGQQTPQMNGNLNYDG------GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
                    G  +            ++G GS++R+EK++L +AA+VT +L NGNL+I G 
Sbjct: 121 ESSLGRVFPGGFDPANMVGLEGKTNAAGSGSVNRSEKVSLTVAAVVTDVLANGNLVIQGR 180

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           QEVR N E+R L V GIVRP+D+ + NS+++ +IAEARISYGG+G  + +   P    L+
Sbjct: 181 QEVRTNREVRELTVAGIVRPEDISSANSINHTQIAEARISYGGRGDISRMQATPAAQSLV 240

Query: 233 ENLSP 237
           E  SP
Sbjct: 241 ERFSP 245


>gi|300816781|ref|ZP_07097001.1| flagellar L-ring protein FlgH [Escherichia coli MS 107-1]
 gi|300530555|gb|EFK51617.1| flagellar L-ring protein FlgH [Escherichia coli MS 107-1]
          Length = 235

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 53/232 (22%), Positives = 91/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I       L GC    S        +P+       +  P  G     + S  +S      
Sbjct: 14  ISSLLVLSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINY 63

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 64  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSYANASRDGKTNFGFDTVPRYLQGLFGNA 123

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   N  +   V  +L NGNL + G +++ +N     +  
Sbjct: 124 RADVEASGGNTFNGKGGANASNTFNGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 183

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 184 SGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|326796594|ref|YP_004314414.1| flagellar L-ring protein [Marinomonas mediterranea MMB-1]
 gi|326547358|gb|ADZ92578.1| Flagellar L-ring protein [Marinomonas mediterranea MMB-1]
          Length = 222

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 49/238 (20%), Positives = 89/238 (37%), Gaps = 21/238 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHS-SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M RY   +  +  LL GC +   +     P  +P+     +               S   
Sbjct: 1   MNRYRSFLFVFPILLAGCAAVDPAPKADDPFYTPVVQPTLQY--------------SKSA 46

Query: 60  SYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
              +++       F D +A +VGDILTV +     +   N    S+++S          +
Sbjct: 47  DGGIYQVGMGDVFFGDKKARSVGDILTVTLSESTSSTKSNAANLSKDSSATIGNPTILGV 106

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                  +            SG    +++  L   I   V  +  NG L I G + + +N
Sbjct: 107 PIGLDTTVP-----SVTSEFSGSADANQSNSLTGSITVTVYEVYPNGLLAIRGEKWITLN 161

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
                + ++G+VR +D+ A N+V  +++A+ARI+Y G G            + I +  
Sbjct: 162 QGEEYIRLSGLVREEDIGADNTVQSNRLADARIAYSGTGELAAGSEQGWLTRFINSKW 219


>gi|253702430|ref|YP_003023619.1| flagellar L-ring protein [Geobacter sp. M21]
 gi|251777280|gb|ACT19861.1| flagellar L-ring protein [Geobacter sp. M21]
          Length = 229

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 66/201 (32%), Positives = 99/201 (49%), Gaps = 3/201 (1%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQ 99
              + P           +  S SLW+DS   L +D +A   GDI+TV I  +  A     
Sbjct: 28  AEVQTPTFDQQIPAPQLSYASGSLWQDSSTGLAEDLKARRRGDIITVVISENASASKKAS 87

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQT---PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAA 156
           TG SR +S+   +     L          ++  LN   G    G GS SR E L   I+A
Sbjct: 88  TGTSRGSSISAGIPKLLGLETTGIRNWADLSDLLNASFGSKFDGSGSTSRQETLQATISA 147

Query: 157 IVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGK 216
            V  ++ NGNL+I G + V+VN+E + + +TG VR +DV A N++S   IA+ARI+Y GK
Sbjct: 148 KVVDVIPNGNLLIEGRRNVKVNNEDQIIVLTGTVRGRDVSADNTISSALIADARIAYSGK 207

Query: 217 GRTTELLRPPIGHQLIENLSP 237
           G  ++  +P      ++ + P
Sbjct: 208 GIISDRQKPGWLLNTLDKIWP 228


>gi|51597634|ref|YP_071825.1| flagellar basal body L-ring protein [Yersinia pseudotuberculosis IP
           32953]
 gi|153949468|ref|YP_001399637.1| flagellar basal body L-ring protein [Yersinia pseudotuberculosis IP
           31758]
 gi|81638506|sp|Q666C4|FLGH2_YERPS RecName: Full=Flagellar L-ring protein 2; AltName: Full=Basal body
           L-ring protein 2; Flags: Precursor
 gi|51590916|emb|CAH22572.1| putative flagellar L-ring protein [Yersinia pseudotuberculosis IP
           32953]
 gi|152960963|gb|ABS48424.1| flagellar L-ring protein FlgH [Yersinia pseudotuberculosis IP
           31758]
          Length = 221

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 54/239 (22%), Positives = 96/239 (40%), Gaps = 20/239 (8%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            +   I+      L GC S        P +      + +++       +     +  +  
Sbjct: 1   MKRFLILTPMVLALCGCES--------PALL-----VQKDDAEFAPPANLVQPATVTEGG 47

Query: 62  SLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            L++ ++  +L +D RA  +GDILTV +    Q+    +T   + N +   +        
Sbjct: 48  GLFQPAYNWSLLQDRRAYRIGDILTVILDESTQSSKQAKTNFGKKNDMSLGVPEVLGKKL 107

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
            +        +  G     G  + ++   L   I   V  +L NG L+I G + + +N  
Sbjct: 108 NKFGG-----SISGKRDFDGSATSAQQNMLRGSITVAVHQVLPNGVLVIRGEKWLTLNQG 162

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSPL 238
              + VTG+VR  DV   NSVS  +IA ARISY G+G  ++        +   + L P+
Sbjct: 163 DEYMRVTGLVRADDVARDNSVSSQRIANARISYAGRGALSDANSAGWLTRFFNHPLFPI 221


>gi|114562345|ref|YP_749858.1| flagellar basal body L-ring protein [Shewanella frigidimarina NCIMB
           400]
 gi|122941034|sp|Q085P5|FLGH_SHEFN RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|114333638|gb|ABI71020.1| flagellar L-ring protein [Shewanella frigidimarina NCIMB 400]
          Length = 224

 Score =  202 bits (514), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 55/238 (23%), Positives = 98/238 (41%), Gaps = 19/238 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSS-ISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M +Y  I L    LL GC S+    I   P  +P+                         
Sbjct: 1   MIKY--IALASVVLLVGCSSTAKKPIADDPFYAPVYPDTVPTQ--------------VAA 44

Query: 60  SYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + S++ DS A+ L+ D RA  VGDI+TV ++   QA         + + L  +       
Sbjct: 45  TGSIYLDSQASSLYSDIRAHRVGDIITVTLKESTQASKSANNEIKKGSDLSVE-PVYAGG 103

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                  +  +L Y     +  +    ++  L+  I+A +  +L NGNL+I G + + +N
Sbjct: 104 KNISISGVPIDLGYSDSMNTKRESDADQSNSLDGSISANIIQVLSNGNLVIRGEKWISIN 163

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +    + VTG++R +D++  N++   ++A ARI Y G G   +  +         +  
Sbjct: 164 NGDEFIRVTGMIRSEDINPDNTIDSTRVANARIQYSGTGTFADSQKVGWLSSFFMSDW 221


>gi|261341491|ref|ZP_05969349.1| flagellar L-ring protein FlgH [Enterobacter cancerogenus ATCC
           35316]
 gi|288316287|gb|EFC55225.1| flagellar L-ring protein FlgH [Enterobacter cancerogenus ATCC
           35316]
          Length = 221

 Score =  202 bits (514), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 59/239 (24%), Positives = 101/239 (42%), Gaps = 20/239 (8%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            +   ++   + LL GC S        P +      + +++       DF    +  +  
Sbjct: 1   MKKQLVIGFVALLLAGCES--------PALL-----VHKDDAAFAPPEDFSLPPTQVQGG 47

Query: 62  SLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            L+  ++  +L +D RA  VGDILTV +    QA    +T   + N +   +   F    
Sbjct: 48  GLYNANYNWSLTQDRRAYRVGDILTVKLDESTQASKQARTNFGKKNDVSIGVPEAFG--- 104

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   + + DG    +G  +  +   L   I   V  +L NG L I G + + +N  
Sbjct: 105 --HSVDKLSGSIDGNRNFNGNATSQQQNSLRGAITVAVYKVLPNGVLAIRGEKWLTLNQG 162

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSPL 238
              + VTG+VR +D++  NSVS  +IA ARISY G+G  ++        +   + L P+
Sbjct: 163 DEYMRVTGLVRAEDIERDNSVSSQRIANARISYAGRGALSDANSAGWLTRFFNHPLFPI 221


>gi|94987185|ref|YP_595118.1| flagellar basal body L-ring protein [Lawsonia intracellularis
           PHE/MN1-00]
 gi|94731434|emb|CAJ54797.1| Flagellar basal body L-ring protein [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 230

 Score =  202 bits (514), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 60/243 (24%), Positives = 105/243 (43%), Gaps = 20/243 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  F   C   +L GC +        P ++P                  +  DS    
Sbjct: 1   MKKLLFTSGCI-LILTGCSAPNKTPVVAPPITP-------------PPAYVEPEDSYSNP 46

Query: 61  YSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS-- 117
            SL+  +    LF D+RA  VGDI+ V I  ++ A     T   +  +    +   F   
Sbjct: 47  GSLYSSAESDGLFADTRARRVGDIVMVKIVENNTAKNKADTTADKKTANTYGIDAFFGRQ 106

Query: 118 ---LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
                  + P  +   +      ++  G   R   +N  IAA V  ++  G L I G +E
Sbjct: 107 YIGGGSTKIPVGSVAFDTTSESGTTSTGETKREGAINGTIAARVLRVMPGGLLEIEGVRE 166

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
            RVN+E + + +TG++RP D++  NS+  ++I++A+I+Y G+G  +E  +P    + ++ 
Sbjct: 167 TRVNNETQYIVITGLIRPMDIEPDNSIMSNRISDAKIAYYGQGVLSEKQKPGWFTRFMDT 226

Query: 235 LSP 237
           L P
Sbjct: 227 LWP 229


>gi|26991073|ref|NP_746498.1| flagellar basal body L-ring protein [Pseudomonas putida KT2440]
 gi|31076681|sp|Q88ER9|FLGH_PSEPK RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|24986107|gb|AAN69962.1|AE016634_11 flagellar L-ring protein precursor FlgH [Pseudomonas putida KT2440]
 gi|313497765|gb|ADR59131.1| FlgH [Pseudomonas putida BIRD-1]
          Length = 231

 Score =  202 bits (514), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 50/245 (20%), Positives = 95/245 (38%), Gaps = 24/245 (9%)

Query: 1   MYRYS-FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R      L  + LL GC +   +    P  +P+                     +   
Sbjct: 1   MNRLLSVFALGGAVLLAGCVAPTPK-PNDPYYAPVLP--------------RTPLPAAAN 45

Query: 60  SYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + S+++      L+ D +A  VGDI+T+ +     A  +  +  ++ +     L+  F  
Sbjct: 46  NGSIYQAGFEQNLYSDRKAFRVGDIITITLNERTSASKNAGSQIAKTSKTDIGLTSLFGS 105

Query: 119 FGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                       ++    Y G  A+ G    ++   L   I   V  +L NG + + G +
Sbjct: 106 TPNTNNPFGGGDLSLEAGYSGDRATKGDSKATQGNTLTGSITVTVAEVLPNGIIAVRGEK 165

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
            + +N     + + G+VR  D+   N+V   ++A+ARI+Y G G   +  +P    +   
Sbjct: 166 WLTLNTGEELVRIAGMVRADDIATDNTVPSTRVADARITYSGTGSFADASQPGWLDRFF- 224

Query: 234 NLSPL 238
            +SPL
Sbjct: 225 -ISPL 228


>gi|148546710|ref|YP_001266812.1| flagellar basal body L-ring protein [Pseudomonas putida F1]
 gi|166214824|sp|A5W0G8|FLGH_PSEP1 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|148510768|gb|ABQ77628.1| flagellar L-ring protein [Pseudomonas putida F1]
          Length = 231

 Score =  202 bits (514), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 49/245 (20%), Positives = 95/245 (38%), Gaps = 24/245 (9%)

Query: 1   MYRYS-FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R      L  + LL GC +   +    P  +P+                     +   
Sbjct: 1   MNRLLSVFALGGAVLLAGCVAPTPK-PNDPYYAPVLP--------------RTPLPAAAN 45

Query: 60  SYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + S+++      L+ D +A  VGDI+T+ +     A  +  +  ++ +     L+  F  
Sbjct: 46  NGSIYQAGFEQNLYSDRKAFRVGDIITITLNERTSASKNAGSQIAKTSKTDIGLTSLFGT 105

Query: 119 FGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                       ++    Y G  A+ G    ++   L   I   V  +L NG + + G +
Sbjct: 106 TPNTNNPFGGGDLSLEAGYSGDRATKGDSKATQGNTLTGSITVTVAEVLPNGIIAVRGEK 165

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
            + +N     + + G++R  D+   N+V   ++A+ARI+Y G G   +  +P    +   
Sbjct: 166 WLTLNTGEELVRIAGMIRADDIATDNTVPSTRVADARITYSGTGSFADASQPGWLDRFF- 224

Query: 234 NLSPL 238
            +SPL
Sbjct: 225 -ISPL 228


>gi|157147099|ref|YP_001454418.1| flagellar basal body L-ring protein [Citrobacter koseri ATCC
           BAA-895]
 gi|157084304|gb|ABV13982.1| hypothetical protein CKO_02876 [Citrobacter koseri ATCC BAA-895]
          Length = 221

 Score =  202 bits (513), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 57/239 (23%), Positives = 100/239 (41%), Gaps = 20/239 (8%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            +   ++   +  L GC S        P +      + +++       D    ++  +  
Sbjct: 1   MKKQLVISLLALFLSGCES--------PALL-----VKKDDAAYAPPEDIVVPETQVRGG 47

Query: 62  SLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            L+  ++  +L +D RA  VGDILTV +    QA    +T   + N +   +   F    
Sbjct: 48  GLYNGNYNWSLTQDRRAYRVGDILTVKLDESTQASKQARTNFGKKNDVSLGIPEAFG--- 104

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   + + DG    +G  +  +   L   I   V  +L NG L I G + + +N  
Sbjct: 105 --HSIDKLSGSIDGNRNFNGNATSQQQNSLRGAITVAVYKVLPNGVLAIRGEKWLTLNQG 162

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSPL 238
              + VTG+VR +D++  NSVS  +IA ARISY G+G  ++        +   + L P+
Sbjct: 163 DEYMRVTGLVRAEDIERDNSVSSQRIANARISYAGRGALSDANAAGWLTRFFNHPLFPI 221


>gi|163794154|ref|ZP_02188127.1| Flagellar L-ring protein [alpha proteobacterium BAL199]
 gi|159180768|gb|EDP65287.1| Flagellar L-ring protein [alpha proteobacterium BAL199]
          Length = 251

 Score =  202 bits (513), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 85/243 (34%), Positives = 138/243 (56%), Gaps = 8/243 (3%)

Query: 3   RYSFIVLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           R  F  +  ++ L GC +   ++ I   P+MS +          P          +T+++
Sbjct: 8   RPLFATIAVAAALSGCSAVDRLANIGQAPEMSRIEDPTRGAGYQPVSMPMPAPVVATRQA 67

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SLW++   A FKD RA ++GDI+TV + I D+A  DN T R+R NS   +L+G F   G
Sbjct: 68  NSLWQEGSRAFFKDQRASDIGDIITVVVTIADKAAVDNTTTRTRTNSDAAQLNGLFGYEG 127

Query: 121 QQTPQMNGN------LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
             T            L+     ++ G G + R E++NL +A ++T  L NGN+++ G QE
Sbjct: 128 SLTSVFPEAVTGGNFLDLGSSTSNVGAGKVDREEEINLRVAGVITQKLPNGNMVVYGRQE 187

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           VRVN E+R + V G++R  D+ + N++SYD++AEARISYGG+G+ T++ +P  G Q+++ 
Sbjct: 188 VRVNFEVREVVVGGVIRAADITSSNTISYDQMAEARISYGGRGQITDVQQPRFGSQVLDV 247

Query: 235 LSP 237
           + P
Sbjct: 248 IMP 250


>gi|212709495|ref|ZP_03317623.1| hypothetical protein PROVALCAL_00537 [Providencia alcalifaciens DSM
           30120]
 gi|212687833|gb|EEB47361.1| hypothetical protein PROVALCAL_00537 [Providencia alcalifaciens DSM
           30120]
          Length = 245

 Score =  202 bits (513), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 52/231 (22%), Positives = 94/231 (40%), Gaps = 10/231 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           ++   +  L GC            + P      + + +P        + +  +S      
Sbjct: 24  LIATVAVTLNGCA----------HIKPRPLVDTQTSAVPTAPTAPAPNGAIFQSAQPAYY 73

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  NVGDILT++++ +  A  ++    +R+       +             
Sbjct: 74  GYQPLFEDRRPRNVGDILTINLQENVSASKNSSANANRSGKTGFLAAILPGFMQGWLGGS 133

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
           N  ++  G    +GKG  +        I   V  +L NGNL + G + + +N    S+  
Sbjct: 134 NTEIDVKGNSDFNGKGGANANNTFKGTITVTVDQLLANGNLHVVGEKRIAINQGTESIRF 193

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +G+V P+ + A N+VS  ++A+ARI Y G G   E        +   N+SP
Sbjct: 194 SGVVNPRTIGADNNVSSTQVADARIEYVGDGYINESQTMGWLQRFFLNVSP 244


>gi|27381980|ref|NP_773509.1| flagellar basal body L-ring protein [Bradyrhizobium japonicum USDA
           110]
 gi|81735148|sp|Q89F32|FLGH2_BRAJA RecName: Full=Flagellar L-ring protein 2; AltName: Full=Basal body
           L-ring protein 2; Flags: Precursor
 gi|27355150|dbj|BAC52134.1| flagellar L-ring protein precursor [Bradyrhizobium japonicum USDA
           110]
          Length = 231

 Score =  202 bits (513), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 87/222 (39%), Positives = 127/222 (57%), Gaps = 5/222 (2%)

Query: 16  FGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDS 75
            GC    ++    P++SP+GS L        +    +   S +   S W D    L++D 
Sbjct: 14  TGCVGDPADALTGPRLSPVGSGLRTQADPIPVTPRMRTPVSYR---STWDDG-TDLYRDP 69

Query: 76  RALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGG 135
           RA   GD++TV I + D+A  DN+TGRSR++ +   L     + G          N    
Sbjct: 70  RARRTGDVVTVIISMQDKAKLDNKTGRSRDSQIKFGLDWLMDVAGWADKGQTT-ANLSTN 128

Query: 136 GASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDV 195
               G G I R E + L IAAIVT +L NGN++ISGSQE RVN E+R LNV GIVRP+D+
Sbjct: 129 TQIKGNGQIDRTEDIKLSIAAIVTDVLPNGNMMISGSQEFRVNTEMRVLNVGGIVRPRDI 188

Query: 196 DAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
              N++SY+KIAEAR+SYGG+G  +++ +P  GH++ + ++P
Sbjct: 189 SRTNTISYEKIAEARVSYGGQGNLSDVQQPGWGHRIYDAVAP 230


>gi|238788318|ref|ZP_04632112.1| Flagellar L-ring protein [Yersinia frederiksenii ATCC 33641]
 gi|238723564|gb|EEQ15210.1| Flagellar L-ring protein [Yersinia frederiksenii ATCC 33641]
          Length = 238

 Score =  202 bits (513), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 55/236 (23%), Positives = 92/236 (38%), Gaps = 12/236 (5%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLD-ENNRMPFLGIDFKNSDSTKKSY 61
           R+    L    LL GC              P    +D   +  P        + S  ++ 
Sbjct: 13  RWVGAPLMAVLLLNGCA-----------YIPHKPLVDGTTSAQPAPASAPLPNGSIFQAA 61

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
                 +  LF+D R  NVGD LT+ ++ +  A   +    SRN S    ++        
Sbjct: 62  QPMNYGYQPLFEDRRPRNVGDTLTITLQENVSASKSSSANASRNGSSKFGVATAPRYLEG 121

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
                  +++  G     GKG  +     N  I   V  +L NGNL + G +++ +N   
Sbjct: 122 LLGNARADMDISGDNTFGGKGGANANNTFNGTITVTVNQVLANGNLHVVGEKQIAINQGT 181

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
             +  +G+V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 182 EFIRFSGVVNPRTISGSNTVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNISP 237


>gi|149201612|ref|ZP_01878586.1| Flagellar L-ring protein [Roseovarius sp. TM1035]
 gi|149144660|gb|EDM32689.1| Flagellar L-ring protein [Roseovarius sp. TM1035]
          Length = 221

 Score =  201 bits (512), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 60/239 (25%), Positives = 95/239 (39%), Gaps = 19/239 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R           L GC + I E              +     P   ++         +
Sbjct: 1   MMRRFTCTAAALIALAGCSTKIEE-------------AESELYAPVYPVEEVQQSRLMPT 47

Query: 61  YSLWRDSHAALF-KDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            S++      LF  D RA  VGDILTV+      A      G S+ +S    L    S  
Sbjct: 48  GSIYAGYSNGLFVADRRARAVGDILTVEFSERFAASKSQAAGSSKTDSFELDLPDVLSF- 106

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                  +G L      + +G+G+ +++  L   ++  V  +L  GNL I G +++ +N+
Sbjct: 107 ----GFDDGRLTSGTTRSYAGRGNATQSNSLTGRVSVSVVRVLPGGNLEIIGQKQLTLNN 162

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
               + + G+VRP D+ A N V  D+IA A I Y G G   +  +     +  E +SPL
Sbjct: 163 GQEYIRLRGVVRPTDISADNVVRSDRIAHAEIKYVGAGDVADTAKQGWLRRAFETVSPL 221


>gi|167623364|ref|YP_001673658.1| flagellar basal body L-ring protein [Shewanella halifaxensis
           HAW-EB4]
 gi|167353386|gb|ABZ75999.1| flagellar L-ring protein [Shewanella halifaxensis HAW-EB4]
          Length = 224

 Score =  201 bits (512), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 56/235 (23%), Positives = 95/235 (40%), Gaps = 18/235 (7%)

Query: 6   FIVLCYSSLLFGC-HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
              L + + L GC  ++   I   P  +P+                         + S++
Sbjct: 4   LWALLFMAALSGCNSTNGKPIADDPYYAPVYPE--------------APPTKIAATGSMY 49

Query: 65  RDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT 123
           +DS A+ L+ D +AL VGDI+TV +    QA        S+   L               
Sbjct: 50  QDSQASSLYSDIKALKVGDIITVYLMEQTQAKKSANNEISKGTDLSLD-PIYAGGGNVTI 108

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
                +L Y     +  +    ++  L+  I+A V  +L NGNL+I G + + +N+    
Sbjct: 109 GGNPIDLRYKDSMNTKRESDADQSNSLSGSISANVMQVLNNGNLVIRGEKWISINNGDEF 168

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE-NLSP 237
           + +TGIVR QD+   N++   ++A ARI Y G G   E+ +          +  P
Sbjct: 169 VRITGIVRAQDIRPDNTIDSQRVANARIQYSGTGTFAEVQKVGWLASFFMGSWWP 223


>gi|254292903|ref|YP_003058926.1| flagellar L-ring protein [Hirschia baltica ATCC 49814]
 gi|254041434|gb|ACT58229.1| flagellar L-ring protein [Hirschia baltica ATCC 49814]
          Length = 249

 Score =  201 bits (512), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 85/237 (35%), Positives = 137/237 (57%), Gaps = 7/237 (2%)

Query: 8   VLCYSSLLFGCHSS-ISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
               +++L  C ++ IS+    P++SP+ +    N   P                SLWR 
Sbjct: 12  TFAVTAMLGACSTAGISDKMASPELSPIENPASVNGPYPVSMPQPAPITQDYAQNSLWRT 71

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF------G 120
              + F D RA ++GDILTV+I I DQA  +N T RSR  +   +++  F L        
Sbjct: 72  GARSFFDDQRAGDIGDILTVNIEISDQAQVNNTTSRSRTGNTSAEINAMFGLNELIDRNI 131

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                ++   ++    +S+G G+++RAE ++L IAA++T  L NGNL+I+GSQEV+VN+E
Sbjct: 132 PGGIGLSPGADFGSSSSSNGTGTVNRAETIDLTIAAVITQKLPNGNLVIAGSQEVKVNNE 191

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +R L V GI+RPQD+ A N++S+++IA+ARISYGG+G  + L R     + ++ ++P
Sbjct: 192 VRELVVGGIIRPQDISATNTISHEQIAQARISYGGRGDLSNLQRASTAARAVDAINP 248


>gi|83858808|ref|ZP_00952330.1| flagellar L-ring protein precursor [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853631|gb|EAP91483.1| flagellar L-ring protein precursor [Oceanicaulis alexandrii
           HTCC2633]
          Length = 266

 Score =  201 bits (512), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 90/262 (34%), Positives = 133/262 (50%), Gaps = 26/262 (9%)

Query: 2   YRYSF--IVLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDS- 56
            R      V+  +  L  C +   +S +   P M  + ++     +    G     +++ 
Sbjct: 4   KRILLGGAVILGAFSLTACATTDRLSYVGQTPPMHDIDNAAALTGQAGANGPTAGQAEAA 63

Query: 57  --------------TKKSYSLWRD-SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTG 101
                         +    SLWR  +    F D RA +VGDILTV+I I D A   NQT 
Sbjct: 64  RLARARAIAEARAQSNNPNSLWRAANSTTFFGDPRAAHVGDILTVNIDISDSAQVSNQTT 123

Query: 102 RSRNNSLHRKLSGGFSLFGQQTPQMNGNLN------YDGGGASSGKGSISRAEKLNLLIA 155
           RSR  S    L+  F          N  ++      +    ++ G G+I+R+E + L  A
Sbjct: 124 RSRTTSEDSNLTSFFGGEAALDQFFNDAVDPASLASFGSASSTQGAGNINRSESITLTAA 183

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
           AIV  +L NGNL+I G QEVR+N+E+R L ++GIVRPQD+ A N++ + +IAEARISYGG
Sbjct: 184 AIVVDVLWNGNLVIHGRQEVRINNEVRELLISGIVRPQDIAADNTIDHQQIAEARISYGG 243

Query: 216 KGRTTELLRPPIGHQLIENLSP 237
           +G  +E+ RPP+G +L   L P
Sbjct: 244 RGHISEMQRPPVGQELYNLLWP 265


>gi|319406980|emb|CBI80617.1| Flagellar L-ring protein [Bartonella sp. 1-1C]
          Length = 221

 Score =  201 bits (512), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 87/227 (38%), Positives = 136/227 (59%), Gaps = 7/227 (3%)

Query: 11  YSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA 70
            S +L  C  ++ +    P  SP+ + L   +           S+S     SL+R S ++
Sbjct: 1   MSIILASCSYNVKDFNSAPNFSPVRADLGYASSHAASIYPPAPSESRY---SLYRSSASS 57

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
            ++D RA+  GD+LTV I I+D+A  +N++   R+++    +  G+S   +    + G++
Sbjct: 58  FYRDPRAMKPGDVLTVQIFINDRASLNNKSDLKRDSNSKYTIGAGYSFMDK----LAGSI 113

Query: 131 NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIV 190
                  S G   + R E + L IAAIVT +L NGNL+I+GSQEVRVN+E+R LN+ G+V
Sbjct: 114 EGGSSSQSKGDTKVERQENIRLSIAAIVTDVLPNGNLVINGSQEVRVNNELRILNIAGLV 173

Query: 191 RPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           RP+D+  +N + YDKIAEARISYGG+GR +E+ +PP G QL+  ++P
Sbjct: 174 RPRDISGNNMIDYDKIAEARISYGGRGRMSEIQQPPYGQQLLNQIAP 220


>gi|332305618|ref|YP_004433469.1| flagellar L-ring protein [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172947|gb|AEE22201.1| flagellar L-ring protein [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 230

 Score =  201 bits (512), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 97/240 (40%), Gaps = 18/240 (7%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISE--ITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
              +  V+  S LL  C S+     +   P  +P+ + L                    +
Sbjct: 4   IMKALYVIGLSGLLSACQSTPEPDIMPNDPYYAPITAEL--------------PRQKIAE 49

Query: 60  SYSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
             S+++ D   +L+ D +A  VGDI+TV ++ +  A     T  S+ ++L      G   
Sbjct: 50  DGSIFQADMANSLYSDVKARRVGDIITVSLQENTSATKSAGTTTSKESALDVNPIIGLGG 109

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                   +  L  D     +G  S +++  L+  I+  V  +  N NL++ G + + +N
Sbjct: 110 NALNIGSQSVQLGVDSSNEFTGDASANQSNNLSGDISVTVMKVFPNQNLLVRGEKWLTLN 169

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
           +    + +TG+VRP D+   N V   KIA ARI Y G G      +     Q   +   P
Sbjct: 170 NGNEYIRLTGVVRPADISPTNEVISTKIANARIQYSGTGTFASAQKEGWLTQFFSSEYWP 229


>gi|291280518|ref|YP_003497353.1| flagellar L-ring protein FlgH [Deferribacter desulfuricans SSM1]
 gi|290755220|dbj|BAI81597.1| flagellar L-ring protein FlgH [Deferribacter desulfuricans SSM1]
          Length = 238

 Score =  201 bits (512), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 62/249 (24%), Positives = 116/249 (46%), Gaps = 24/249 (9%)

Query: 1   MYR--YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
           M +  ++  ++  S + +GC               + + +   +    +    K     K
Sbjct: 1   MMKKNFTISLIILSFMFYGCA------------KKVVTEVPSTDYKKEIEEYRKYQAQKK 48

Query: 59  KSYSLWRD--SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
            S SLW D  ++   F D +   VGDI+ V I     A   N T  S++ S    ++   
Sbjct: 49  PSPSLWTDMGNYGTFFLDYKGRKVGDIVIVKIVESSSATNSNTTKTSKSTSYKTGITNLL 108

Query: 117 SL--------FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLI 168
            L        F     Q + N++     + +GKG   +++++   IAA V  +L +GNL+
Sbjct: 109 GLPTNLGMKNFLNSGNQFDPNIDASTSNSFNGKGQKQKSDQVTATIAARVIDVLPSGNLV 168

Query: 169 ISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIG 228
           I G +E+ V+ E + ++V G++R +D+DA N+V    IA+A+I+Y GKG  +++ +    
Sbjct: 169 IEGHREIIVDQEKQIISVKGVIRQKDIDATNTVLSTAIADAQITYTGKGMLSDVNKKGWL 228

Query: 229 HQLIENLSP 237
             +I+ + P
Sbjct: 229 ANVIDWVWP 237


>gi|88813657|ref|ZP_01128886.1| Flagellar L-ring protein [Nitrococcus mobilis Nb-231]
 gi|88789075|gb|EAR20213.1| Flagellar L-ring protein [Nitrococcus mobilis Nb-231]
          Length = 221

 Score =  201 bits (512), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 54/239 (22%), Positives = 92/239 (38%), Gaps = 21/239 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M     IV   S LL GC S++S                       L            +
Sbjct: 1   MPTRILIVGLASLLLGGCASTLSRPPQA------------------LPEPTLEQPPKTVN 42

Query: 61  YSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            ++++  +   L++D  A  VGD +TV +     A  D      R  S            
Sbjct: 43  GAIYQSGYDVRLYEDRTARRVGDTVTVTLDEQTDASKDANAQIGRQYSYALPTPTLMGKQ 102

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                    + + D      G GS +++  L+ ++ A +  +  NGN++I G + + +N 
Sbjct: 103 LVYNGT-PVSFDIDSEQDFQGGGSATQSNALSGVLTATIVRVKPNGNMVIQGQKRLTLNR 161

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
               + ++G VRP D+   N+VS  ++A ARISY G G   +  R     +L  + + P
Sbjct: 162 GDEYVTLSGEVRPYDIGPGNTVSSSRVANARISYTGDGALADSSRMGWLSRLFMSIIWP 220


>gi|225849137|ref|YP_002729301.1| flagellar L-ring protein FlgH [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225644708|gb|ACN99758.1| flagellar L-ring protein FlgH [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 223

 Score =  201 bits (511), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 60/237 (25%), Positives = 107/237 (45%), Gaps = 16/237 (6%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            +   +VL  S+ + GC S   E       +P+               D      ++ + 
Sbjct: 1   MKLKKLVLILSAFVIGCASKKDEYAKP--YNPV-------------PPDIPQEKVSRTAG 45

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SL+  S+  LF DS+A NVGDI+T+ +         + T     + +   +     +  Q
Sbjct: 46  SLYTGSYNNLFTDSKAFNVGDIITIKVVETIAGQTASGTNTQEQSKMSLGVPSPTIMGKQ 105

Query: 122 QTPQMN-GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
              +     +  +   +  G  S +R+ KL   I+A VT +  NGNL I G + V+VND+
Sbjct: 106 VPNKTPIAGITENNSDSYKGTASTNRSSKLIATISARVTKVYPNGNLFIVGKKVVKVNDD 165

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            ++L ++GIV+P D+   NSV   +I++  + Y G+G   +  +P    Q ++ + P
Sbjct: 166 YQTLVISGIVKPTDILQDNSVDSSRISDMYVEYNGEGYIADSTKPGWLAQFLKKIWP 222


>gi|109899399|ref|YP_662654.1| flagellar basal body L-ring protein [Pseudoalteromonas atlantica
           T6c]
 gi|109701680|gb|ABG41600.1| flagellar L-ring protein [Pseudoalteromonas atlantica T6c]
          Length = 230

 Score =  201 bits (511), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 54/240 (22%), Positives = 96/240 (40%), Gaps = 18/240 (7%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISE--ITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
              +  V+  S LL  C S+     +   P  +P+ + L                    +
Sbjct: 4   IMKALYVIGLSGLLGACQSTPEPDIMPNDPYYAPITADL--------------PRQKIAE 49

Query: 60  SYSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
             S+++ D   +L+ D +A  VGDI+TV +  +  A     T  S+ ++L      G   
Sbjct: 50  DGSIFQADMANSLYSDVKARRVGDIITVSLEENTSATKSAGTTTSKESALDVNPIVGLGG 109

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                   +  L  D     +G  S +++  L+  I+  V  +  N NL++ G + + +N
Sbjct: 110 NAVNIGSQSIQLGVDSSNEFTGDASANQSNNLSGDISVTVMKVFPNQNLLVRGEKWLTLN 169

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
           +    + +TG+VRP D+   N +   KIA ARI Y G G      +     +   +   P
Sbjct: 170 NGNEYIRLTGVVRPADISPTNEIVSTKIANARIQYSGTGTFASAQKEGWLTKFFSSEYWP 229


>gi|212634351|ref|YP_002310876.1| flagellar basal body L-ring protein [Shewanella piezotolerans WP3]
 gi|212555835|gb|ACJ28289.1| Flagellar L-ring protein [Shewanella piezotolerans WP3]
          Length = 224

 Score =  201 bits (511), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 58/240 (24%), Positives = 97/240 (40%), Gaps = 20/240 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSIS-EITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M RY  +++     L GC S+    I   P  +P+                         
Sbjct: 1   MNRYWILLVIAV--LSGCSSTNEKPIADDPYYAPVYPE--------------APPTKIAA 44

Query: 60  SYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + S+++DS A+ L+ D +AL VGDI+TV +    QA         +   L          
Sbjct: 45  TGSMYQDSQASSLYSDIKALKVGDIITVMLMESTQAKKSANNEIKKGTDLSLD-PIYAGG 103

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                     +L Y     +  +    ++  L+  I+A V  +L NGNL+I G + + +N
Sbjct: 104 GNVTIGGNPIDLRYKDSMNTKRESDADQSNSLSGSISANVMQVLNNGNLVIRGEKWISIN 163

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE-NLSP 237
           +    + +TGIVR QD+   N++   ++A ARI Y G G   E+ +          +  P
Sbjct: 164 NGDEFVRITGIVRAQDIRPDNTIDSPRVANARIQYSGTGTFAEVQKVGWLSSFFMGSWWP 223


>gi|187731524|ref|YP_001880750.1| flagellar basal body L-ring protein [Shigella boydii CDC 3083-94]
 gi|226701933|sp|B2U541|FLGH_SHIB3 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|187428516|gb|ACD07790.1| flagellar L-ring protein FlgH [Shigella boydii CDC 3083-94]
          Length = 232

 Score =  201 bits (511), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 52/232 (22%), Positives = 91/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I       L GC    S        +P+       +  P  G     + S  +S      
Sbjct: 11  ISSLLVLSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINY 60

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 61  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSVNASRDGKTNFGFDTVPRYLQGLFGNA 120

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 121 RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 180

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+VS  ++ +ARI Y G G   E        +   NLSP+
Sbjct: 181 SGVVNPRTISGSNTVSSTQVVDARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|123442781|ref|YP_001006758.1| flagellar basal body L-ring protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122089742|emb|CAL12595.1| flagellar L-ring protein precursor [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 227

 Score =  201 bits (511), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 55/237 (23%), Positives = 94/237 (39%), Gaps = 12/237 (5%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLD-ENNRMPFLGIDFKNSDSTKKS 60
            R+    L  + LL GC              P  S +D   +  P        + S  ++
Sbjct: 1   MRWVGAPLMATLLLNGCA-----------YIPHKSLVDGSTSAQPAPASAPLPNGSIFQA 49

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
                  +  LF+D R  NVGD LT+ ++ +  A   +    SRN S    ++       
Sbjct: 50  AQPMNYGYQPLFEDRRPRNVGDTLTITLQENVSASKSSSANASRNGSSKFGVATAPRYLE 109

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   +++  G     GKG  +     +  I   V  +L NGNL + G +++ +N  
Sbjct: 110 GLLGNARADMDISGDNTFGGKGGANANNTFSGTITVTVDQVLANGNLHVVGEKQIAINQG 169

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
              +  +G+V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 170 TEFIRFSGVVNPRTISGSNTVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNVSP 226


>gi|83312592|ref|YP_422856.1| flagellar basal body L-ring protein [Magnetospirillum magneticum
           AMB-1]
 gi|82947433|dbj|BAE52297.1| Flagellar basal body L-ring protein [Magnetospirillum magneticum
           AMB-1]
          Length = 263

 Score =  201 bits (511), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 82/247 (33%), Positives = 126/247 (51%), Gaps = 13/247 (5%)

Query: 4   YSFIVLCYSSLLFGCH--SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            +  ++   S L  C+  + +SE+   PQ SP+ +   ++   P      + S   + + 
Sbjct: 16  RALALVAAMSELSACNMLTRMSEVGSGPQTSPIQNPTQKSGYQPVSMPMPQPSAPPQNAN 75

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLWR    A FKD RA +VGDILTV + I D A        SR  S         S    
Sbjct: 76  SLWRPGARAFFKDQRAKDVGDILTVAVSIADSATLTTGLTNSRTGSEKAGSGTTGSPISA 135

Query: 122 QTP-----------QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
                          +    +     A +  G+ +R E + + +AA++T +L NGNL+IS
Sbjct: 136 MGFEQQLSKLLPNINLASLADLSSTSAVTNSGNTTRTESITMSMAAVITQVLPNGNLVIS 195

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ 230
           G QE RVN E+R L++ GI+RP+D+ + NSVS +KIAEAR+ YGG+G  ++L +P  G Q
Sbjct: 196 GRQEFRVNYEMRELSIQGIIRPEDISSSNSVSSEKIAEARVYYGGRGMVSDLTQPRYGQQ 255

Query: 231 LIENLSP 237
           + + + P
Sbjct: 256 IFDIIFP 262


>gi|295097200|emb|CBK86290.1| Flagellar basal body L-ring protein [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 237

 Score =  201 bits (511), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 54/231 (23%), Positives = 90/231 (38%), Gaps = 10/231 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
            +L    LL GC   + +        P+       +  P          S  ++      
Sbjct: 16  ALLAGVLLLSGCAHILQK--------PLVDG--PTSAEPLPMAPVTTGGSLFQAGQAMNY 65

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  +F+D R  +VGD LT+ ++ +  A   +    +RN S    L              
Sbjct: 66  GYQPMFEDRRPRSVGDTLTILLQENVSASKSSSASANRNGSAGMGLLAMPGSSNSWLGNG 125

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             + N +G    SGKG  +        I   V  +L NGNL + G +++ +N     +  
Sbjct: 126 KADFNAEGKSDFSGKGGAAARNTFTGTITVTVNKLLPNGNLQVVGEKQIAINQGTEFIRF 185

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +L  NLSP
Sbjct: 186 SGVVNPRTISGANTVPSTQVADARIEYVGNGYINEAQTMGWLQRLFLNLSP 236


>gi|332161325|ref|YP_004297902.1| flagellar basal body L-ring protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318605245|emb|CBY26743.1| flagellar L-ring protein FlgH [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325665555|gb|ADZ42199.1| flagellar basal body L-ring protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 238

 Score =  201 bits (511), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 55/236 (23%), Positives = 94/236 (39%), Gaps = 12/236 (5%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLD-ENNRMPFLGIDFKNSDSTKKSY 61
           R+    L  + LL GC              P  S +D   +  P        + S  ++ 
Sbjct: 13  RWVGAPLMATLLLNGCA-----------YIPHKSLVDGSTSAQPAPASAPLPNGSIFQAA 61

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
                 +  LF+D R  NVGD LT+ ++ +  A   +    SRN S    ++        
Sbjct: 62  QPMNYGYQPLFEDRRPRNVGDTLTITLQENVSASKSSSANASRNGSSKFGVATAPRYLEG 121

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
                  +++  G     GKG  +     +  I   V  +L NGNL + G +++ +N   
Sbjct: 122 LLGNARADMDISGDNTFGGKGGANANNTFSGTITVTVDQVLANGNLHVVGEKQIAINQGT 181

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
             +  +G+V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 182 EFIRFSGVVNPRTISGSNTVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNVSP 237


>gi|71277863|ref|YP_268225.1| flagellar basal body L-ring protein [Colwellia psychrerythraea 34H]
 gi|110816527|sp|Q485P0|FLGH_COLP3 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|71143603|gb|AAZ24076.1| flagellar L-ring protein FlgH [Colwellia psychrerythraea 34H]
          Length = 236

 Score =  201 bits (510), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 96/237 (40%), Gaps = 18/237 (7%)

Query: 4   YSFIVLCYSSLLFGCHSSIS---EITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
               +    ++   C +++     +   P  +P+    +E   +P              S
Sbjct: 11  KLLSISLLIAVTTACSNTVELSKALPNDPDFAPIMPEEEEERIVP--------------S 56

Query: 61  YSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL++  +   ++ DS+A  VGDI++V +    QA  + +T   + N  +     G    
Sbjct: 57  GSLFKPHYVNNIYSDSKAHRVGDIISVILSEKTQAKKNAKTELKKANETNLDAVTGLGGV 116

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                  +            G     +   L+  I+  V  +L NGNL+I G + + +N+
Sbjct: 117 PVSINGESLQFGISQDSNFKGDAKADQGNSLSGNISVHVLRVLPNGNLMIRGEKWLTLNN 176

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
               + +TG++R +D++++N++  +K+A ARI Y G G   +        +   +  
Sbjct: 177 GDEYIRLTGVIRSKDINSNNTILSNKVANARIQYAGTGSFADSNEQGWLVKFFNSTW 233


>gi|70729007|ref|YP_258741.1| flagellar basal body L-ring protein [Pseudomonas fluorescens Pf-5]
 gi|110816536|sp|Q4KG92|FLGH_PSEF5 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|68343306|gb|AAY90912.1| flagellar L-ring protein FlgH [Pseudomonas fluorescens Pf-5]
          Length = 231

 Score =  201 bits (510), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 55/245 (22%), Positives = 99/245 (40%), Gaps = 24/245 (9%)

Query: 1   MYRYS-FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R+   + L  S++L GC +        P  +P+                     S   
Sbjct: 1   MNRFICVLALSGSAVLAGCVA-PPPKPNDPYYAPVLP--------------RTPLPSASN 45

Query: 60  SYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + S+++      L+ D +A  VGDI+T+ +     A     +  ++ +S    L+  F  
Sbjct: 46  NGSIYQAGFEQNLYSDRKAFRVGDIITITLNERTNASKGANSALTKTSSNSIGLTSLFGA 105

Query: 119 FGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                       +  N  Y G  A+ G    +++  L   I   V  +L NG + + G +
Sbjct: 106 VPNTNNPLGDGDLTLNAGYSGNRATKGDSKAAQSNSLTGSITVTVADVLPNGIIAVRGEK 165

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
            + +N     + + G+VR  D+   N+VS  ++A+ARI+Y G G   +  +P    +   
Sbjct: 166 WMTLNTGDELVRIAGLVRADDIATDNTVSSTRVADARITYSGTGSFADANQPGWFDRFF- 224

Query: 234 NLSPL 238
            LSPL
Sbjct: 225 -LSPL 228


>gi|163803172|ref|ZP_02197055.1| flagellar hook protein E [Vibrio sp. AND4]
 gi|159173072|gb|EDP57905.1| flagellar hook protein E [Vibrio sp. AND4]
          Length = 229

 Score =  201 bits (510), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 60/237 (25%), Positives = 95/237 (40%), Gaps = 18/237 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M   S        LL GC      I   P            N   +       +    + 
Sbjct: 7   MKWLSKSWAVAVVLLVGCAGRDEFIPPEP------------NTEEYAPPVLDYTLPETRF 54

Query: 61  YSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL+R  +   LF+D RA  VGD+LTV +  +  +     T   +++++   +    +  
Sbjct: 55  GSLYRHQYTMTLFQDRRAYRVGDVLTVQLFEETSSSKKAGTQFGKSSTVDFAVPTIGTKT 114

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
             +       ++ DG  +  G  S S+  KL   I   V  +L NG L ISG + +R+N 
Sbjct: 115 INELG-----VSVDGSRSFDGSSSSSQGNKLQGAITVTVHEVLPNGVLRISGEKWLRLNQ 169

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
               + +TGIVR  D+   N VS  +IA+ARI+Y G+G   +        Q   +  
Sbjct: 170 GDEFIRLTGIVRVDDISRSNQVSSQRIADARITYAGRGALADSNAAGWLTQFFNSPW 226


>gi|238764395|ref|ZP_04625345.1| Flagellar L-ring protein [Yersinia kristensenii ATCC 33638]
 gi|238697421|gb|EEP90188.1| Flagellar L-ring protein [Yersinia kristensenii ATCC 33638]
          Length = 238

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 54/236 (22%), Positives = 92/236 (38%), Gaps = 12/236 (5%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLD-ENNRMPFLGIDFKNSDSTKKSY 61
           R+    L    LL GC              P    +D   +  P        + S  ++ 
Sbjct: 13  RWMGTPLLAMLLLNGCA-----------YIPHKPLVDGSTSAQPAPASAPLPNGSIFQAA 61

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
                 +  LF+D R  N+GD LT+ ++ +  A   +    SRN S    ++        
Sbjct: 62  QPMNYGYQPLFEDRRPRNIGDTLTITLQENVSASKSSSANASRNGSSKFGVATAPRYLEG 121

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
                  +L+  G     GKG  +     +  I   V  +L NGNL + G +++ +N   
Sbjct: 122 PLGNARADLDISGDSTFGGKGGANANNTFSGTITVTVNQVLANGNLHVVGEKQIAINQGT 181

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
             +  +G+V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 182 EFIRFSGVVNPRTISGSNTVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNVSP 237


>gi|322421660|ref|YP_004200883.1| flagellar L-ring protein [Geobacter sp. M18]
 gi|320128047|gb|ADW15607.1| flagellar L-ring protein [Geobacter sp. M18]
          Length = 233

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 66/235 (28%), Positives = 103/235 (43%), Gaps = 21/235 (8%)

Query: 7   IVLCYSSL-LFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
             LC   L   GC    +E+                   P              S SLW+
Sbjct: 15  AALCLPLLWFPGCAHQSAEVA-----------------TPTFDEQIPAPQMNYASGSLWQ 57

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
            S   L +D +A   GDI+TV I  +  A     T  SR++S+   +     L       
Sbjct: 58  ASSTGLAEDLKARRRGDIVTVVISENASASKKAATATSRDSSISAGIPKLLGLETTGIKN 117

Query: 126 MNGN---LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
                  L+   G +  G GS SR E L   I+A V  ++ NGNL+I G + VRVN+E +
Sbjct: 118 WADLAKLLSASYGSSFDGAGSTSRQETLQATISAKVVDVVPNGNLLIEGRRNVRVNNEDQ 177

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            + +TG VR +D+ A N+++   +A+A+I+Y GKG  ++  +P     + + + P
Sbjct: 178 IIVLTGTVRGRDISADNTINSALVADAQIAYSGKGIISDRQKPGWLLNVFDKVWP 232


>gi|77457730|ref|YP_347235.1| flagellar basal body L-ring protein [Pseudomonas fluorescens Pf0-1]
 gi|110816538|sp|Q3KG60|FLGH_PSEPF RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|77381733|gb|ABA73246.1| flagellar L-ring protein [Pseudomonas fluorescens Pf0-1]
          Length = 231

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 55/245 (22%), Positives = 101/245 (41%), Gaps = 24/245 (9%)

Query: 1   MYRY-SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R+ S + L     L GC +  +     P  +P+                     S   
Sbjct: 1   MKRFVSVVALSGVVSLAGCVA-PTPKPNDPYYAPVLP--------------RTPLPSAAN 45

Query: 60  SYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + S+++      L+ D +A  VGDI+T+ +    QA  +  +  ++N+     L+  F  
Sbjct: 46  NGSIYQAGFEQNLYSDRKAFRVGDIITITLNERTQASKNANSQVAKNSKTGIGLTSLFGG 105

Query: 119 FGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                       ++ ++ Y G  A+ G    ++   L   I   V  +L NG + + G +
Sbjct: 106 SATTNNPLGGNDLSLDVGYSGDRATKGDSKAAQGNTLTGSITVTVADVLPNGIIAVRGEK 165

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
            + +N     + + G+VR  D+   N+VS  ++A+ARI+Y G G   +  +P    +   
Sbjct: 166 WMTLNTGDELVRIAGLVRADDIATDNTVSSTRVADARITYSGTGSFADASQPGWFDRFF- 224

Query: 234 NLSPL 238
            LSPL
Sbjct: 225 -LSPL 228


>gi|268589979|ref|ZP_06124200.1| flagellar L-ring protein FlgH [Providencia rettgeri DSM 1131]
 gi|291314697|gb|EFE55150.1| flagellar L-ring protein FlgH [Providencia rettgeri DSM 1131]
          Length = 260

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 53/231 (22%), Positives = 91/231 (39%), Gaps = 10/231 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           ++     +  GC           Q+        +   +P        + S  +S      
Sbjct: 39  LLAILVLVTSGCA----------QIKSRPLVDTQTTAIPTAPTAPAPNGSIFQSAQPAYY 88

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  NVGDILT++++ +  A  ++    +R+       +             
Sbjct: 89  GYQPLFEDRRPRNVGDILTINLQENVSASKNSSANANRSGKTGFLAAILPGFMQGWIGGK 148

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
           N  L+  G    SGKG  +        I   V  +L NGNL + G + + +N    S+  
Sbjct: 149 NTELDIKGNSDFSGKGGANANNTFKGTITVTVDQLLANGNLHVVGEKRIAINQGTESIRF 208

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +G+V P+ + + N VS  ++A+ARI Y G G   E        +   N+SP
Sbjct: 209 SGVVNPRTIGSDNHVSSTQVADARIEYVGDGYINESQNMGWLQRFFLNVSP 259


>gi|290474976|ref|YP_003467860.1| flagellar basal-body outer-membrane L (lipopolysaccharide layer)
           ring protein [Xenorhabdus bovienii SS-2004]
 gi|289174293|emb|CBJ81083.1| flagellar biosynthesis; basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein [Xenorhabdus
           bovienii SS-2004]
          Length = 250

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 48/242 (19%), Positives = 91/242 (37%), Gaps = 22/242 (9%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
           Y++   +      L GC                     +         +   + +   + 
Sbjct: 24  YKWRISMALAVLSLAGCA----------------YMPHKPLVKGATTANPAEAPAPTPNG 67

Query: 62  SLWR------DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG 115
           S+++        +  LF+D R  N+GD LT+ ++ +  A  ++    SR+       +  
Sbjct: 68  SIFQVSQPVYYGYQPLFEDRRPRNIGDTLTIILQENVSASKNSSANASRSGKTGFTAALT 127

Query: 116 FSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
                        +L+ +G     GKG  +        I   V  +L NGNL   G +++
Sbjct: 128 PRFLKGLMGGDKTDLSMEGDSEFGGKGGANANNTFRGTITVTVDRLLANGNLHAVGEKQI 187

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
            +N     +  +G+V P+ +   N+VS +++A+ARI Y G G   E        +   N+
Sbjct: 188 AINQGTEFIRFSGVVNPRTITGTNTVSSNQVADARIEYVGDGYINEAQTMGWLQRFFMNI 247

Query: 236 SP 237
           SP
Sbjct: 248 SP 249


>gi|319403965|emb|CBI77553.1| Flagellar L-ring protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 221

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 87/227 (38%), Positives = 136/227 (59%), Gaps = 7/227 (3%)

Query: 11  YSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA 70
            S +L  C  ++ +    P  SP+ + L   +           S+S     SL+R S ++
Sbjct: 1   MSIILASCSYNVKDFNSAPNFSPVRADLGYASSHAASIYPPAPSESRY---SLYRSSASS 57

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
            ++D RA+  GD+LTV I I+D+A  +N++   R+++    +  G+S   +    + G++
Sbjct: 58  FYRDPRAMKPGDVLTVQIFINDRASLNNKSDLKRDSNSKYTIGAGYSFMDK----LAGSI 113

Query: 131 NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIV 190
                  S G   + R E + L IAAIVT +L NGNL+I+GSQEVRVN+E+R LN+ G+V
Sbjct: 114 EGGSSSQSKGDTKVERQENIRLSIAAIVTDVLPNGNLVINGSQEVRVNNELRILNIVGLV 173

Query: 191 RPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           RP+D+  +N + YDKIAEARISYGG+GR +E+ +PP G QL+  ++P
Sbjct: 174 RPRDISGNNMIDYDKIAEARISYGGRGRMSEIQQPPYGQQLLNQIAP 220


>gi|330502737|ref|YP_004379606.1| flagellar basal body L-ring protein [Pseudomonas mendocina NK-01]
 gi|328917023|gb|AEB57854.1| flagellar basal body L-ring protein [Pseudomonas mendocina NK-01]
          Length = 228

 Score =  199 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 49/241 (20%), Positives = 99/241 (41%), Gaps = 21/241 (8%)

Query: 4   YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSL 63
             F  L    LL     + +     P  +P+                     + + + S+
Sbjct: 1   MIFSPLLAGVLLSSGCVAPTAKPDDPYYAPVLP--------------RTPLPAAQNNGSI 46

Query: 64  WRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ 122
           ++      L+ D +A  +GD++T+ +    QA  +  +   +++S +  ++  F      
Sbjct: 47  YQAGFENGLYDDRKAFRIGDVITITLNERTQASKNANSNIKKDSSANLGVTSLFGSTPSA 106

Query: 123 -----TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                   M+    +DG   +SG G   ++  L+  I   V  +L NG L + G + + +
Sbjct: 107 TNPLTGGNMSLGAQFDGQREASGSGQTGQSNSLSGSITVTVAEVLPNGILAVRGEKWMTL 166

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LS 236
           N     + ++G+VR  D+   N+V+  +IA+ARI+Y G G   +  +P    +   + L 
Sbjct: 167 NTGDELVRISGLVRADDIATDNTVASTRIADARITYSGTGAFADASQPGWLSRFFVSPLW 226

Query: 237 P 237
           P
Sbjct: 227 P 227


>gi|22127324|ref|NP_670747.1| flagellar basal body L-ring protein [Yersinia pestis KIM 10]
 gi|45442799|ref|NP_994338.1| flagellar basal body L-ring protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108809052|ref|YP_652968.1| flagellar basal body L-ring protein [Yersinia pestis Antiqua]
 gi|108810751|ref|YP_646518.1| flagellar basal body L-ring protein [Yersinia pestis Nepal516]
 gi|145597820|ref|YP_001161896.1| flagellar basal body L-ring protein [Yersinia pestis Pestoides F]
 gi|150260246|ref|ZP_01916974.1| lateral flagellar basal body L-ring protein [Yersinia pestis
           CA88-4125]
 gi|162420326|ref|YP_001604844.1| flagellar basal body L-ring protein [Yersinia pestis Angola]
 gi|165924849|ref|ZP_02220681.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165939042|ref|ZP_02227594.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166008703|ref|ZP_02229601.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166212115|ref|ZP_02238150.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167399084|ref|ZP_02304608.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167418950|ref|ZP_02310703.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167425067|ref|ZP_02316820.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|167466334|ref|ZP_02331038.1| flagellar L-ring protein FlgH [Yersinia pestis FV-1]
 gi|218927915|ref|YP_002345790.1| flagellar basal body L-ring protein [Yersinia pestis CO92]
 gi|229837411|ref|ZP_04457574.1| Flagellar L-ring protein flgH [Yersinia pestis Pestoides A]
 gi|229840626|ref|ZP_04460785.1| Flagellar L-ring protein flgH [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229842823|ref|ZP_04462975.1| Flagellar L-ring protein flgH [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229900948|ref|ZP_04516072.1| Flagellar L-ring protein flgH [Yersinia pestis Nepal516]
 gi|270487669|ref|ZP_06204743.1| flagellar L-ring protein FlgH [Yersinia pestis KIM D27]
 gi|294502792|ref|YP_003566854.1| flagellar L-ring protein precursor [Yersinia pestis Z176003]
 gi|81594556|sp|Q8ZHZ5|FLGH1_YERPE RecName: Full=Flagellar L-ring protein 1; AltName: Full=Basal body
           L-ring protein 1; Flags: Precursor
 gi|226701939|sp|A9R6X4|FLGH_YERPG RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|21960405|gb|AAM86998.1|AE013948_6 putative flagellar l-ring protein [Yersinia pestis KIM 10]
 gi|45437665|gb|AAS63215.1| putative flagellar L-ring protein [Yersinia pestis biovar Microtus
           str. 91001]
 gi|108774399|gb|ABG16918.1| flagellar L-ring protein [Yersinia pestis Nepal516]
 gi|108780965|gb|ABG15023.1| putative flagellar L-ring protein [Yersinia pestis Antiqua]
 gi|115346526|emb|CAL19403.1| putative flagellar L-ring protein [Yersinia pestis CO92]
 gi|145209516|gb|ABP38923.1| flagellar L-ring protein [Yersinia pestis Pestoides F]
 gi|149289654|gb|EDM39731.1| lateral flagellar basal body L-ring protein [Yersinia pestis
           CA88-4125]
 gi|162353141|gb|ABX87089.1| flagellar L-ring protein FlgH [Yersinia pestis Angola]
 gi|165912998|gb|EDR31623.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165923049|gb|EDR40200.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165992042|gb|EDR44343.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166206861|gb|EDR51341.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166962944|gb|EDR58965.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167051588|gb|EDR62996.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167055830|gb|EDR65611.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|229682287|gb|EEO78379.1| Flagellar L-ring protein flgH [Yersinia pestis Nepal516]
 gi|229690090|gb|EEO82147.1| Flagellar L-ring protein flgH [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229696992|gb|EEO87039.1| Flagellar L-ring protein flgH [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229705534|gb|EEO91544.1| Flagellar L-ring protein flgH [Yersinia pestis Pestoides A]
 gi|262360824|gb|ACY57545.1| flagellar L-ring protein precursor [Yersinia pestis D106004]
 gi|262364769|gb|ACY61326.1| flagellar L-ring protein precursor [Yersinia pestis D182038]
 gi|270336173|gb|EFA46950.1| flagellar L-ring protein FlgH [Yersinia pestis KIM D27]
 gi|294353251|gb|ADE63592.1| flagellar L-ring protein precursor [Yersinia pestis Z176003]
 gi|320016708|gb|ADW00280.1| Flagellar L-ring protein flgH [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 221

 Score =  199 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 54/239 (22%), Positives = 97/239 (40%), Gaps = 20/239 (8%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            +   I+      L GC S        P +      + +++       +     +  +  
Sbjct: 1   MKRFLILTPMVLALCGCES--------PALL-----VQKDDAEFAPPANLIQPATVTEGG 47

Query: 62  SLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            L++ +++ +L +D RA  +GDILTV +    Q+    +T   + N +   +        
Sbjct: 48  GLFQPANSWSLLQDRRAYRIGDILTVILDESTQSSKQAKTNFGKKNDMSLGVPEVLGKKL 107

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
            +        +  G     G  + ++   L   I   V  +L NG L+I G + + +N  
Sbjct: 108 NKFGG-----SISGKRDFDGSATSAQQNMLRGSITVAVHQVLPNGVLVIRGEKWLTLNQG 162

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSPL 238
              + VTG+VR  DV   NSVS  +IA ARISY G+G  ++        +   + L P+
Sbjct: 163 DEYMRVTGLVRADDVARDNSVSSQRIANARISYAGRGALSDANSAGWLTRFFNHPLFPI 221


>gi|237731010|ref|ZP_04561491.1| flagellar basal body L-ring protein [Citrobacter sp. 30_2]
 gi|226906549|gb|EEH92467.1| flagellar basal body L-ring protein [Citrobacter sp. 30_2]
          Length = 235

 Score =  199 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 54/242 (22%), Positives = 96/242 (39%), Gaps = 14/242 (5%)

Query: 1   MYRYSF----IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDS 56
           M +Y+     I+      L GC    +        +P+       +  P  G     + S
Sbjct: 4   MRKYALHPYPILALLVVSLTGCAWIPA--------TPLVQGA--TSAQPVPGPTPVANGS 53

Query: 57  TKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
             +S       +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +       
Sbjct: 54  IFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVP 113

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                       ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ 
Sbjct: 114 RYLQGLFGNERADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIA 173

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N     +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLS
Sbjct: 174 INQGTEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLS 233

Query: 237 PL 238
           P+
Sbjct: 234 PM 235


>gi|95929876|ref|ZP_01312617.1| flagellar L-ring protein [Desulfuromonas acetoxidans DSM 684]
 gi|95134172|gb|EAT15830.1| flagellar L-ring protein [Desulfuromonas acetoxidans DSM 684]
          Length = 233

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 62/242 (25%), Positives = 101/242 (41%), Gaps = 18/242 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M++    +L   + +  C              P+     E ++   +      +   K  
Sbjct: 4   MWQRIPYLLMLVAGVVACA-------------PVQPRDAEISKPVTMETPEIEAPQPKTP 50

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SLW   + +LF D+RA  VGDILTV I    +A     T   R  S    ++  F L  
Sbjct: 51  GSLWTTGNGSLFVDNRASRVGDILTVAIYEQAEASKQATTSTGRTTSASADITSLFGLES 110

Query: 121 QQTP-----QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
                         ++        G GS +R E L   +   V  +L NG L ISGS+ V
Sbjct: 111 NLANLNSNIDPANLVSAGYTNDFQGSGSTTRKEDLVATLTTRVVEVLPNGTLRISGSKSV 170

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
            VN E + ++++GIVR +D+   N +    + +A I Y GKG   +  +P    +L++ +
Sbjct: 171 TVNHERQLIHLSGIVRQEDITPENLIDSKYVLDANIVYTGKGVIDDKQKPGWLLRLLDTV 230

Query: 236 SP 237
           +P
Sbjct: 231 TP 232


>gi|307823534|ref|ZP_07653763.1| flagellar L-ring protein [Methylobacter tundripaludum SV96]
 gi|307735519|gb|EFO06367.1| flagellar L-ring protein [Methylobacter tundripaludum SV96]
          Length = 236

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 50/231 (21%), Positives = 95/231 (41%), Gaps = 18/231 (7%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I++   SLL  C          P  +P+                       + S S+++ 
Sbjct: 20  ILVVELSLLQACT---PIPQRDPAFAPVAP--------------ADLRPPVQNSGSIYQS 62

Query: 67  SH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
            +   LF+D  A  VGDILT+ +    QA   +     + N +  ++   F +       
Sbjct: 63  GYDTRLFEDQTAKRVGDILTITLLEKTQAKKADDLNTKKENKMTAEVPSMFGIAASALTG 122

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
            +   +        G G+  ++  L+  I+  V  +L NGNL + G + V +N     + 
Sbjct: 123 QSLQTSLQSSKEFKGTGAADQSNSLSGNISVTVVDVLPNGNLNVRGEKRVTLNQGDEFIR 182

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           ++GIVRP D+ + N ++ DK+A+  I Y G+G   +  +     +++ +  
Sbjct: 183 LSGIVRPVDITSSNIITSDKVADVTIMYVGEGAMADASKMGWLARILNSPW 233


>gi|261856357|ref|YP_003263640.1| flagellar L-ring protein [Halothiobacillus neapolitanus c2]
 gi|261836826|gb|ACX96593.1| flagellar L-ring protein [Halothiobacillus neapolitanus c2]
          Length = 230

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 57/244 (23%), Positives = 101/244 (41%), Gaps = 22/244 (9%)

Query: 1   MYRYSF-----IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSD 55
           M RY       I L   + L GC S        P M P      + +    +  +   ++
Sbjct: 1   MNRYRILGLGVIGLSIVASLSGCASQ-------PPMKP------DPSFAVVMPPEASTNN 47

Query: 56  STKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG 114
             + + S+++      +F DSR   VGDILTV ++          TG S+ +S+      
Sbjct: 48  PMQNNGSIYQSGQMDNMFVDSRPYRVGDILTVVLQESMNGSKSATTGTSKADSVAITPPA 107

Query: 115 GFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
              L      +   +++        G G+ ++   L   I+  V  +  NG+L + G + 
Sbjct: 108 IGGLSANLMNRFGASIST--ANQFKGDGTSAQTNSLRGQISVTVARVYANGSLFVQGQKY 165

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           + +N     + ++G+VRPQD+   N+V   +IA+A ISYGG G   +        +   +
Sbjct: 166 IGINQGTEYVRLSGLVRPQDIATDNTVLSTRIADAHISYGGTGTVNDANNMGWLARFFNS 225

Query: 235 -LSP 237
            + P
Sbjct: 226 PIFP 229


>gi|190574260|ref|YP_001972105.1| flagellar basal body L-ring protein [Stenotrophomonas maltophilia
           K279a]
 gi|226701935|sp|B2FQV2|FLGH_STRMK RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|190012182|emb|CAQ45805.1| putative flagellar L-ring protein [Stenotrophomonas maltophilia
           K279a]
          Length = 230

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 51/233 (21%), Positives = 97/233 (41%), Gaps = 17/233 (7%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
           R +      + LL GC  +  ++   P M+P+                     +   + +
Sbjct: 9   RIALACTVAA-LLGGCVIAG-DVRPYPAMAPIQP--------------IMPPQAEPTAGA 52

Query: 63  LWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           ++       L+ D RA +VGD+LT+ +  +  A     T  ++ ++L             
Sbjct: 53  IYAAGPTLQLYSDRRARDVGDLLTITLLENTTAQTSANTATNKESNLSLGTPSILGAPVT 112

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
              +   +    G    +GKG+ +++ +L   +   V   L NGNL++ G + +R+N   
Sbjct: 113 LGGKDILSATAKGARDFTGKGNSAQSNRLQGSVTVTVIQRLPNGNLVVQGQKNLRLNQGD 172

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
             + V GIVRP D+   N++   ++AEARI YGG+G   +        +   +
Sbjct: 173 ELVQVQGIVRPGDISQDNTIPSSRVAEARIVYGGRGPVAQSNAMGWLSRFFNS 225


>gi|157376213|ref|YP_001474813.1| flagellar basal body L-ring protein [Shewanella sediminis HAW-EB3]
 gi|157318587|gb|ABV37685.1| flagellar L-ring protein [Shewanella sediminis HAW-EB3]
          Length = 229

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 58/243 (23%), Positives = 100/243 (41%), Gaps = 21/243 (8%)

Query: 1   MYRYSFIV---LCYSSLLFGCHSSIS-EITGIPQMSPMGSSLDENNRMPFLGIDFKNSDS 56
           M + S ++   +  S +L GC S+    I   P  SP+                      
Sbjct: 1   MSKLSVLLAATIILSPVLTGCSSTGEKPIADDPYYSPVYPE--------------APPTK 46

Query: 57  TKKSYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG 115
              + S+++DS A+ L+ D +AL VGDI+TV ++   QA         +   L       
Sbjct: 47  IAATGSMYQDSQASSLYSDIKALKVGDIITVMLQESTQAKKSASNEIKKGTDLTLD-PIY 105

Query: 116 FSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
                        +L Y     +  +    ++  L+  I+A V  +L NGNL+I G + +
Sbjct: 106 AGGKNISIGGQPIDLRYKDSMNTKRESDADQSNSLSGSISANVMQVLNNGNLVIRGEKWI 165

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE-N 234
            +N+    + +TGIVR QD+   N++   ++A ARI Y G G   ++ +          +
Sbjct: 166 SINNGDEFVRITGIVRSQDIRPDNTIDSQRVANARIQYSGTGTFADVQKVGWLSSFFMGS 225

Query: 235 LSP 237
             P
Sbjct: 226 WWP 228


>gi|291085565|ref|ZP_06353368.2| flagellar L-ring protein FlgH [Citrobacter youngae ATCC 29220]
 gi|291071310|gb|EFE09419.1| flagellar L-ring protein FlgH [Citrobacter youngae ATCC 29220]
          Length = 235

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 54/242 (22%), Positives = 96/242 (39%), Gaps = 14/242 (5%)

Query: 1   MYRYSF----IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDS 56
           M +Y+     I+      L GC    +        +P+       +  P  G     + S
Sbjct: 4   MRKYALHPYPILALLVVSLTGCAWIPA--------TPLVQGA--TSAQPIPGPTPVANGS 53

Query: 57  TKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
             +S       +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +       
Sbjct: 54  IFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVP 113

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                       ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ 
Sbjct: 114 RYLQGLFGNERADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIA 173

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N     +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLS
Sbjct: 174 INQGTEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLS 233

Query: 237 PL 238
           P+
Sbjct: 234 PM 235


>gi|288940412|ref|YP_003442652.1| flagellar L-ring protein [Allochromatium vinosum DSM 180]
 gi|288895784|gb|ADC61620.1| flagellar L-ring protein [Allochromatium vinosum DSM 180]
          Length = 231

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 50/241 (20%), Positives = 99/241 (41%), Gaps = 17/241 (7%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
           Y  +   L  +  L GC +             +      ++         +   ++  + 
Sbjct: 4   YSKTLSSLLVAFALSGCAT-------------LNPPKPGDSAEYRPVAPLEPRPASANNG 50

Query: 62  SLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           ++++ +  AALF+D +AL VGD++TV +     A   + T  +++++    +        
Sbjct: 51  AIFQPALGAALFEDRKALRVGDLVTVMLNEKTNAKKSSATSTAKDSNATMDVGNVTIAGR 110

Query: 121 QQTPQMN--GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                      L+   G    G G  S++ + +  I   V  +L NGNL+I G + + +N
Sbjct: 111 TVLAADAQLLGLSSKAGRTFDGSGDSSQSNQFSGEITVTVAEVLPNGNLVIQGEKWLGIN 170

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
                + + GIVRP D+   N V+  +IA A++ YGG G   +        +   + + P
Sbjct: 171 QGNEFVRLRGIVRPVDITKDNKVNSTQIANAQLYYGGTGALQDSNAQGWLTRFFNSPILP 230

Query: 238 L 238
           +
Sbjct: 231 I 231


>gi|238758107|ref|ZP_04619287.1| Flagellar L-ring protein [Yersinia aldovae ATCC 35236]
 gi|238703645|gb|EEP96182.1| Flagellar L-ring protein [Yersinia aldovae ATCC 35236]
          Length = 237

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 50/233 (21%), Positives = 91/233 (39%), Gaps = 12/233 (5%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLD-ENNRMPFLGIDFKNSDSTKKSYSLW 64
             +   + LL GC              P    ++   +  P        + S  ++    
Sbjct: 15  ICMPLTAMLLNGCA-----------YIPHKPLVEGTTSAQPAPASAPLPNGSIFQAAQPM 63

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP 124
              +  LF+D R  N+GD LT+ ++ +  A   +    SRN S    ++           
Sbjct: 64  NYGYQPLFEDRRPRNIGDTLTITLQENVSASKSSSANASRNGSSKFGVATTPRYLEGLLG 123

Query: 125 QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
               +++  G     GKG  +     +  I   V  +L NGNL + G +++ +N     +
Sbjct: 124 NARADMDISGDNTFGGKGGANANNTFSGTITVTVDQVLANGNLHVVGEKQIAINQGTEFI 183

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
             +G+V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 184 RFSGVVNPRTISGSNTVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNISP 236


>gi|170725958|ref|YP_001759984.1| flagellar basal body L-ring protein [Shewanella woodyi ATCC 51908]
 gi|169811305|gb|ACA85889.1| flagellar L-ring protein [Shewanella woodyi ATCC 51908]
          Length = 229

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 57/243 (23%), Positives = 96/243 (39%), Gaps = 21/243 (8%)

Query: 1   MYRYSFIVLCYSSLL---FGCHSSI-SEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDS 56
           M +Y    +    LL    GC S+    I   P  +P+                      
Sbjct: 1   MNKYWLWTVSSLVLLPVLAGCASTGGKPIADDPYYAPVYPE--------------APPTK 46

Query: 57  TKKSYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG 115
              + S+++DS A+ L+ D +AL VGDI+TV +    QA         +   L       
Sbjct: 47  IAATGSMYQDSQASSLYSDIKALKVGDIITVILMEQTQAKKSANNEIKKGTDLSLD-PIY 105

Query: 116 FSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
                        +L Y     +  +    ++  L+  I+A V  +L NGNL+I G + +
Sbjct: 106 AGGGNISIGGQPIDLRYSDSMNTKRESGADQSNSLSGSISANVMQVLNNGNLVIRGEKWI 165

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE-N 234
            +N+    + +TGIVR QD+   N++   ++A ARI Y G G   ++ +          +
Sbjct: 166 SINNGDEFVRLTGIVRSQDIRPDNTIDSPRVANARIQYSGTGTFADVQKVGWLSSFFMGS 225

Query: 235 LSP 237
             P
Sbjct: 226 WWP 228


>gi|315179629|gb|ADT86543.1| flagellar L-ring protein FlgH [Vibrio furnissii NCTC 11218]
          Length = 212

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 57/226 (25%), Positives = 92/226 (40%), Gaps = 18/226 (7%)

Query: 12  SSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-A 70
             +L GC             +P     ++             S    +S SL+R  +A  
Sbjct: 1   MLILAGCAGRDE-------FTPPSPDEEKYG-----PPTLDYSLPAAQSGSLYRHQYAMT 48

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           LF+D RA  VGD+LTV +  + Q+     T   + +S+             +        
Sbjct: 49  LFQDRRAYRVGDVLTVLLAEETQSKKSADTQYGKTSSVGLSAPVVGGKTVDKLA-----A 103

Query: 131 NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIV 190
           + DG  +  G  S S+  KL   I   V+ +L NG + I G + +R+N     + +TGIV
Sbjct: 104 SIDGDRSFDGSASSSQGNKLEGAITVTVSEVLPNGVIRIRGEKWIRLNQGDEFIRLTGIV 163

Query: 191 RPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           R  D+  +N VS  +I +ARI+Y G+G   +        Q   +  
Sbjct: 164 RVDDISRNNQVSSQRIGDARITYSGRGALADSNASGWLTQFFNSPW 209


>gi|302383958|ref|YP_003819781.1| flagellar L-ring protein [Brevundimonas subvibrioides ATCC 15264]
 gi|302194586|gb|ADL02158.1| flagellar L-ring protein [Brevundimonas subvibrioides ATCC 15264]
          Length = 241

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 89/226 (39%), Positives = 125/226 (55%), Gaps = 9/226 (3%)

Query: 18  CHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRA 77
           C + +  +   PQ++P+G                +   ++    SLWR    A F D RA
Sbjct: 18  CSTVVETV-QGPQLAPIGYPAQLVPVTQAYTTVPEPRSASAN--SLWRTGARAFFGDQRA 74

Query: 78  LNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG--- 134
             +GDILTV+I IDDQA   N T RSR+N +   +S  F L         G  +      
Sbjct: 75  RQIGDILTVNIDIDDQAQTSNTTSRSRSNDITGGISNFFGLENSLGRAFPGGFDPQNLVG 134

Query: 135 ---GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVR 191
                 ++G GS+SR+EK++L IAA+VT IL NGNL+I G QEVR N E+R L V GIVR
Sbjct: 135 VEGQSNANGTGSVSRSEKVSLTIAAVVTDILSNGNLVIQGRQEVRTNREVRELTVAGIVR 194

Query: 192 PQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           P+D+ + N++++ +IAEARISYGG+G  + +   P    L+E  SP
Sbjct: 195 PEDISSANTIAHTQIAEARISYGGRGDISRVQSTPAAQSLVERFSP 240


>gi|330967094|gb|EGH67354.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 263

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 54/251 (21%), Positives = 101/251 (40%), Gaps = 30/251 (11%)

Query: 1   MYR-------YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKN 53
           M R            LC  +LL GC +  ++    P  +P+                   
Sbjct: 27  MNRSGFPRFSVLIASLCGITLLSGCVAPTAK-PNDPYYAPVLP--------------RTP 71

Query: 54  SDSTKKSYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL 112
             +   + ++++      L+ D +A  VGDI+T+ +     A     +  +++++    L
Sbjct: 72  MSAASNNGAIYQAGFEQNLYGDRKAFRVGDIITITLSERMAASKAATSAMTKDSTNSIGL 131

Query: 113 SGGFSLFGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
           +  F              ++ N  Y G   + G G  +++  L   +   V  +L NG L
Sbjct: 132 TSLFGSGLTTNNPIGGNDLSLNAGYTGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGIL 191

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
            + G + + +N     + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P  
Sbjct: 192 SVRGEKWMTLNTGDELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGW 251

Query: 228 GHQLIENLSPL 238
             +    LSPL
Sbjct: 252 FDRFF--LSPL 260


>gi|312962292|ref|ZP_07776783.1| Flagellar L-ring protein [Pseudomonas fluorescens WH6]
 gi|311283219|gb|EFQ61809.1| Flagellar L-ring protein [Pseudomonas fluorescens WH6]
          Length = 231

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 55/245 (22%), Positives = 103/245 (42%), Gaps = 24/245 (9%)

Query: 1   MYRY-SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M RY S + L   ++L GC +  +     P  +P+                     +   
Sbjct: 1   MNRYVSVLALSGIAVLAGCVA-PTPKPNDPYYAPVLP--------------RTPLPAAAN 45

Query: 60  SYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + S+++      L+ D +A  VGDI+T+ +    QA  +  +   + +     L+  F  
Sbjct: 46  NGSIYQAGFEQNLYSDRKAFRVGDIITITLNEKTQASKNANSQIGKTSKASLGLTSLFGG 105

Query: 119 FGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                    +  ++ +  Y G  A++GK + ++   L   I   V  +L NG + + G +
Sbjct: 106 VPNTNNPLGSGDLSLDAGYSGDRATNGKSAAAQGNTLTGSITVTVADVLPNGIIAVRGEK 165

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
            + +N     + + G+VR  D+   N+V   +IA+ARI+Y G G   +  +P    +   
Sbjct: 166 WMTLNTGDELVRIAGMVRADDIATDNTVPSTRIADARITYSGTGSFADASQPGWFDRFF- 224

Query: 234 NLSPL 238
            LSPL
Sbjct: 225 -LSPL 228


>gi|229591868|ref|YP_002873987.1| flagellar basal body L-ring protein [Pseudomonas fluorescens SBW25]
 gi|259645995|sp|C3K0W0|FLGH_PSEFS RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|229363734|emb|CAY51138.1| flagellar L-ring protein [Pseudomonas fluorescens SBW25]
          Length = 231

 Score =  199 bits (505), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 56/245 (22%), Positives = 101/245 (41%), Gaps = 24/245 (9%)

Query: 1   MYRY-SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M RY S + L   ++L GC +  +     P  +P+                     +   
Sbjct: 1   MNRYVSVLALSGIAVLAGCVA-PTPKPNDPYYAPVLP--------------RTPLPAAAN 45

Query: 60  SYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + S+++      L+ D +A  VGDI+T+ +    QA  +  +   + +     L+  F  
Sbjct: 46  NGSIYQAGFEQNLYSDRKAFRVGDIITITLNEKTQASKNANSQVGKTSKTGIGLTSLFGA 105

Query: 119 FGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                       ++ +  Y G  A++GK S  +   L   I   V  +L NG + + G +
Sbjct: 106 VPNTNNPLGDGDLSLSAGYSGDRATNGKSSAGQGNSLTGSITVTVADVLPNGIIAVRGEK 165

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
            + +N     + + G+VR  D+   N+V   +IA+ARI+Y G G   +  +P    +   
Sbjct: 166 WMTLNTGDELVRIAGMVRADDISTDNTVPSTRIADARITYSGTGSFADASQPGWFDRFF- 224

Query: 234 NLSPL 238
            LSPL
Sbjct: 225 -LSPL 228


>gi|37525844|ref|NP_929188.1| flagellar basal body L-ring protein [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|36785273|emb|CAE14214.1| Flagellar L-ring protein precursor (Basal body L-ring protein)
           [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|37681980|gb|AAQ97868.1| FlgH [Photorhabdus luminescens]
          Length = 250

 Score =  199 bits (505), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 46/242 (19%), Positives = 92/242 (38%), Gaps = 22/242 (9%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            ++   +      L GC                     +             + +   + 
Sbjct: 24  NKWRCSIALAVLSLTGCA----------------YIPQKPLVEGATTAAPSVATAPVPNG 67

Query: 62  SLWR------DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG 115
           ++++        +  LF+D R  N+GD LT+ ++ +  A  ++    SRN       +  
Sbjct: 68  AIFQVVQPVYYGYQPLFEDRRPRNIGDTLTITLQENVSASKNSSANASRNGKNTFSAALT 127

Query: 116 FSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
                        +L+ +      GKG  +        I   V  +L NGNL + G +++
Sbjct: 128 PRFLKGLIGGDKTDLDMEAENTFGGKGGANANNTFKGTITVTVDRLLANGNLHVVGEKQI 187

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
            +N     +  +G+V P+ ++A+N+VS +++A+ARI Y G G   E        +   N+
Sbjct: 188 AINQGTEFIRFSGVVNPRTINANNTVSSNQVADARIEYVGNGYINEAQNMGWLQRFFLNV 247

Query: 236 SP 237
           +P
Sbjct: 248 AP 249


>gi|167645394|ref|YP_001683057.1| flagellar basal body L-ring protein [Caulobacter sp. K31]
 gi|167347824|gb|ABZ70559.1| flagellar L-ring protein [Caulobacter sp. K31]
          Length = 238

 Score =  199 bits (505), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 86/225 (38%), Positives = 128/225 (56%), Gaps = 10/225 (4%)

Query: 19  HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRAL 78
            S+++E    P+++P+G                + +     S SLWR    A F D RA 
Sbjct: 17  CSTVAEAVKGPELAPVGYPAQLAPMTQQYAPQPQAA----SSNSLWRTGARAFFNDQRAS 72

Query: 79  NVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN------LNY 132
            VGDILTV+I IDD A   NQT  SR ++    +     L       + G       +N 
Sbjct: 73  KVGDILTVNIDIDDSATTKNQTQTSRASNSSLGVPNFLGLESSLGKVLPGGFDPANMINT 132

Query: 133 DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRP 192
             G +++G G+++R+EK++L IAA+V+ +L NGNL+I G+QEVR N E+R L V GIVRP
Sbjct: 133 KSGTSNAGAGAVNRSEKISLTIAAVVSGVLPNGNLVIQGTQEVRTNAEVRQLTVAGIVRP 192

Query: 193 QDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +D+ + N++ + +IAEARISYGG+G  + + + P G  L+E  SP
Sbjct: 193 EDISSANTIKHTQIAEARISYGGRGDISRVQKVPGGQALVEKFSP 237


>gi|300722679|ref|YP_003711969.1| flagellar basal-body outer-membrane L ring protein [Xenorhabdus
           nematophila ATCC 19061]
 gi|297629186|emb|CBJ89782.1| flagellar biosynthesis; basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein [Xenorhabdus
           nematophila ATCC 19061]
          Length = 263

 Score =  199 bits (505), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 54/238 (22%), Positives = 92/238 (38%), Gaps = 13/238 (5%)

Query: 2   YRYSFIVLCYSSL-LFGCHSSISEITGIPQMSPMGSSLD-ENNRMPFLGIDFKNSDSTKK 59
              S  VL  S L L GC              P    +  +    P        + S  +
Sbjct: 36  ISISMAVLTLSVLTLGGCA-----------YIPHKPLVQGQTTAKPTETPVPMPNGSIFQ 84

Query: 60  SYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
           +       +  LF+D R  N+GD LT+ ++ +  A  ++    SR+       +      
Sbjct: 85  TVQPVYYGYQPLFEDRRPRNIGDTLTIILQENVSASKNSSANASRSGKTGFAAALTPRFL 144

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                    +L  +G     GKG  +        I   V  +L NGNL + G +++ +N 
Sbjct: 145 QGLIGSDKTDLGMEGNNEFGGKGGANANNTFKGTITVTVDTLLANGNLHVVGEKQIAINQ 204

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
               +  +G+V P+ +  +N+VS +++A+ARI Y G G   E        +   N+SP
Sbjct: 205 GTEFIRFSGVVNPRTITGNNTVSSNQVADARIEYVGDGYINEAQHMGWLQRFFMNISP 262


>gi|188579871|ref|YP_001923316.1| flagellar L-ring protein [Methylobacterium populi BJ001]
 gi|179343369|gb|ACB78781.1| flagellar L-ring protein [Methylobacterium populi BJ001]
          Length = 236

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 92/220 (41%), Positives = 138/220 (62%), Gaps = 3/220 (1%)

Query: 18  CHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRA 77
           C S I++I+  P ++P+GS L+       L   F    +    +S W  + AAL++D RA
Sbjct: 19  CQSDIAQISRPPVLTPIGSGLNAP--REPLPTTFGALGARHSYHSTWSPASAALYQDPRA 76

Query: 78  LNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGA 137
            +VGD++TV I I+D+A FDN + R+R+         G+ +   +      +     G  
Sbjct: 77  RDVGDVITVSIAINDKAQFDNASERARSQKSSLGFDFGYGVSALKD-TATADTGIRSGTE 135

Query: 138 SSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDA 197
           + G+GSI R E L+L +AA+VT +L NGN++ISGSQEVRVN+E+R L V GIVRP+D+  
Sbjct: 136 TKGQGSIDRKESLSLSVAAVVTEVLPNGNVVISGSQEVRVNNEVRVLEVAGIVRPRDISR 195

Query: 198 HNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            N++ YDKIAEARISYGG+GR T++  P +G ++ E ++P
Sbjct: 196 KNTIDYDKIAEARISYGGRGRITDVQGPTLGQRVFETVAP 235


>gi|24374754|ref|NP_718797.1| flagellar basal body L-ring protein [Shewanella oneidensis MR-1]
 gi|31076704|sp|Q8ECA1|FLGH_SHEON RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|24349418|gb|AAN56241.1|AE015761_11 flagellar L-ring protein FlgH [Shewanella oneidensis MR-1]
          Length = 224

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 51/224 (22%), Positives = 90/224 (40%), Gaps = 16/224 (7%)

Query: 16  FGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALFKD 74
             C S           +P     D+    P              + S+++DS A +L+ D
Sbjct: 14  TACSS-----------TPKKPIADDPFYAPVYP--EAPPTKIAATGSIYQDSQAASLYSD 60

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
            RA  VGDI+T+ ++   QA         + + +                 +  +L Y  
Sbjct: 61  IRAHKVGDIITIVLKEATQAKKSAGNQIKKGSDMTLD-PVYAGGSNLSLGGIPLDLRYKD 119

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
              +  +    ++  L+  I+A +  +L NGNL++ G + + +N+    + VTGIVR QD
Sbjct: 120 SMNTKRESDADQSNSLDGSISANIMQVLNNGNLVVRGEKWISINNGDEFIRVTGIVRSQD 179

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
           +   N++   ++A ARI Y G G   E  +     Q   +   P
Sbjct: 180 IKPDNTIDSTRMANARIQYSGTGTFAEAQKVGWLSQFFMSDWWP 223


>gi|330961202|gb|EGH61462.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 261

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 56/251 (22%), Positives = 103/251 (41%), Gaps = 30/251 (11%)

Query: 1   MYRY-------SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKN 53
           M R            LC  +LL GC +  ++    P  +P+                   
Sbjct: 25  MKRLSVPRFSVLIASLCGITLLSGCVAPTAK-PNDPYYAPVLP--------------RTP 69

Query: 54  SDSTKKSYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL 112
             +   + ++++      L+ D +A  VGDI+T+ +     A     +  S+N++    L
Sbjct: 70  MSAASNNGAIYQAGFEQNLYGDRKAFRVGDIITITLSERMAASKAATSAMSKNSTNSIGL 129

Query: 113 SGGFSLFGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
           +  F              ++ N  Y+G   ++G G  +++  L   +   V  +L NG L
Sbjct: 130 TSLFGSGLTTNNPIGGNDLSLNAGYNGARTTNGDGKAAQSNSLTGSVTVTVADVLPNGIL 189

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
            + G + + +N     + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P  
Sbjct: 190 SVRGEKWMTLNTGDELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGW 249

Query: 228 GHQLIENLSPL 238
             +    LSPL
Sbjct: 250 FDRFF--LSPL 258


>gi|117919775|ref|YP_868967.1| flagellar basal body L-ring protein [Shewanella sp. ANA-3]
 gi|166214828|sp|A0KUU2|FLGH_SHESA RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|117612107|gb|ABK47561.1| flagellar L-ring protein FlgH [Shewanella sp. ANA-3]
          Length = 224

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 49/208 (23%), Positives = 88/208 (42%), Gaps = 5/208 (2%)

Query: 32  SPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRI 90
           +P     D+    P              + S+++DS A +L+ D RA  VGDI+T+ ++ 
Sbjct: 19  TPKKPIADDPFYAPVYP--EAPPTKIAATGSIYQDSQAASLYSDIRAHKVGDIITIVLKE 76

Query: 91  DDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKL 150
             QA         + + +                 +  +L Y     +  +    ++  L
Sbjct: 77  ATQAKKSAGNQIKKGSDMTLD-PIYAGGSNVSLGGIPLDLRYKDSMNTKRESDADQSNSL 135

Query: 151 NLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEAR 210
           +  I+A +  +L NGNL++ G + + +N+    + VTGIVR QD+   N++   ++A AR
Sbjct: 136 DGSISANIMQVLNNGNLVVRGEKWISINNGDEFIRVTGIVRSQDIKPDNTIDSTRMANAR 195

Query: 211 ISYGGKGRTTELLRPPIGHQLIEN-LSP 237
           I Y G G   E  +     Q   +   P
Sbjct: 196 IQYSGTGTFAEAQKVGWLSQFFMSDWWP 223


>gi|327480023|gb|AEA83333.1| flagellar basal body L-ring protein [Pseudomonas stutzeri DSM 4166]
          Length = 231

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 53/245 (21%), Positives = 102/245 (41%), Gaps = 23/245 (9%)

Query: 1   MYRYSFIV-LCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R   +V +  +  L GC +  +     P  +P+                     + + 
Sbjct: 1   MSRLLIVVSMSSALALVGCVA-PAPKPNDPYYAPVLP--------------RTPLPAAQN 45

Query: 60  SYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + ++++      L+ D +A  VGDI+T+ +    QA  +  +  S+++S +  L   F  
Sbjct: 46  NGAIYQAGFETNLYDDRKAHRVGDIITITLNERTQASKNATSKLSKDSSANIGLGSLFGG 105

Query: 119 FGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                       MN    Y+    +SG G   ++  L+  I   V+ +L NG L + G +
Sbjct: 106 AVSMANPLTGNSMNLGAEYEASRDTSGSGQAGQSNSLSGSITVTVSEVLPNGILAVRGEK 165

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
            + +N     + + G+VR  D+   N+V   +IA+ARI+Y G G   +  +P    +   
Sbjct: 166 WMTLNTGDELVRIAGLVRADDISTDNTVPSTRIADARITYSGTGAFADASQPGWLDRFFM 225

Query: 234 N-LSP 237
           + + P
Sbjct: 226 SPMWP 230


>gi|324113874|gb|EGC07848.1| flagellar L-ring protein [Escherichia fergusonii B253]
 gi|325497613|gb|EGC95472.1| flagellar basal body L-ring protein [Escherichia fergusonii ECD227]
          Length = 246

 Score =  198 bits (504), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 52/233 (22%), Positives = 92/233 (39%), Gaps = 10/233 (4%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
            I       L GC    S        +P+          P  G     + S  +S     
Sbjct: 24  VIASLLVFSLTGCAWIPS--------TPLVQGA--TTAQPVPGPTPVANGSIFQSAQPIN 73

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
             +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                
Sbjct: 74  YGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGN 133

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              +++  GG + +GKG  + +   +  +   V  +L NGNL + G +++ +N     + 
Sbjct: 134 ARADVDASGGNSFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIR 193

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 194 FSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 246


>gi|226327741|ref|ZP_03803259.1| hypothetical protein PROPEN_01614 [Proteus penneri ATCC 35198]
 gi|225203445|gb|EEG85799.1| hypothetical protein PROPEN_01614 [Proteus penneri ATCC 35198]
          Length = 247

 Score =  198 bits (504), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 47/239 (19%), Positives = 86/239 (35%), Gaps = 22/239 (9%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
                     L GC     +       + +                     +   + S++
Sbjct: 24  RLGTALLVLTLAGCAHIPKKPLVEGNTTAV----------------PTAPTAPAPNGSIF 67

Query: 65  RD------SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           +        +  LF+D R  N+GD LT+ ++ +  A  ++    SRN       S     
Sbjct: 68  QATQPVYFGYQPLFEDRRPRNIGDTLTITLQENVSASKNSSANASRNGKAGFLASITPRF 127

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                     ++  +G     GKG  +        I   V  +L NGNL + G +++ +N
Sbjct: 128 LEGLFGNNRADMGMEGNSDFGGKGGANANNTFKGTITVTVDQLLANGNLHVIGEKQIAIN 187

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
                +  +G+V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 188 QGTEFIRFSGVVNPRTISGSNTVNSTQVADARIEYIGDGYINEAQSMGWLQRFFLNVSP 246


>gi|157146223|ref|YP_001453542.1| flagellar basal body L-ring protein [Citrobacter koseri ATCC
           BAA-895]
 gi|157083428|gb|ABV13106.1| hypothetical protein CKO_01980 [Citrobacter koseri ATCC BAA-895]
          Length = 250

 Score =  198 bits (504), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 53/232 (22%), Positives = 92/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I+      L GC    S        +P+          P  G     + S  +S      
Sbjct: 29  IMALLVVSLTGCAWIPS--------TPLVQGA--TTAQPIPGPTPVANGSIFQSAQPINY 78

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 79  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNA 138

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG + +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 139 RADMEASGGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQGTEFIRF 198

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 199 SGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 250


>gi|319405405|emb|CBI79024.1| Flagellar L-ring protein [Bartonella sp. AR 15-3]
          Length = 217

 Score =  198 bits (504), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 86/223 (38%), Positives = 134/223 (60%), Gaps = 7/223 (3%)

Query: 15  LFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKD 74
           +  C  ++ +    P  SP+ + L   +           S+S     SL+R S  + ++D
Sbjct: 1   MTSCSYNVKDFNSAPSFSPVRADLGYASSHTASVYPPAPSESRY---SLYRSSANSFYRD 57

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
            RA+  GD+LTV I I+D+A  +N++   R++S    +  G+S   +    + G++  + 
Sbjct: 58  PRAMKPGDVLTVQIFINDRASLNNKSDLKRDSSSKYTIGAGYSFMDK----LAGSIEGES 113

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
              S G   + R E + L IAAIVT +L NGNL+I+GSQEVRVN+E+R LN+ G+VRP+D
Sbjct: 114 SSQSKGDTKVERQENIRLSIAAIVTNVLPNGNLVINGSQEVRVNNELRILNIAGLVRPRD 173

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +  +N + YDKIAEARISYGG+GR +E+ +PP G QL+  ++P
Sbjct: 174 ISGNNMIDYDKIAEARISYGGRGRMSEIQQPPYGQQLLNQIAP 216


>gi|329849716|ref|ZP_08264562.1| flagellar L-ring family protein [Asticcacaulis biprosthecum C19]
 gi|328841627|gb|EGF91197.1| flagellar L-ring family protein [Asticcacaulis biprosthecum C19]
          Length = 239

 Score =  198 bits (504), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 88/243 (36%), Positives = 126/243 (51%), Gaps = 11/243 (4%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M   +   L +S++  G   ++SE    PQ++ M   +                 +   S
Sbjct: 1   MKTIALTALAFSAVTLGACGTVSETVKGPQLTAMAYPV-----AVIPAQQAVIQPAPASS 55

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SLWR      F D RA NVGDILT+ + IDD A   N T RSR NS        F L  
Sbjct: 56  NSLWRAGARTFFNDQRARNVGDILTIQVDIDDSAQTQNSTDRSRTNSYEASTPSIFGLES 115

Query: 121 QQTPQMNGNLN------YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
                +    N       DG    SG GS+ R+EK+++ +AA VT ++ NGNL+I G QE
Sbjct: 116 SLGKLLPSEYNPTRALGADGSSTFSGNGSVQRSEKISVTLAATVTGVMRNGNLVIQGHQE 175

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           VR   E+R L+V GIVRP+D+ + N++ + ++AEARISYGGKG  T + + P+   +++ 
Sbjct: 176 VRTGREMRVLSVAGIVRPEDISSTNTIRHTQLAEARISYGGKGDITNMQQAPVTQNIMDK 235

Query: 235 LSP 237
            SP
Sbjct: 236 FSP 238


>gi|188997555|ref|YP_001931806.1| flagellar L-ring protein [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188932622|gb|ACD67252.1| flagellar L-ring protein [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 223

 Score =  198 bits (503), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 53/238 (22%), Positives = 94/238 (39%), Gaps = 17/238 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R   +      +  GC              P   +            + +     +  
Sbjct: 1   MKRLILLFGIIGFITAGCAKKTEYG------KPFNPN----------PPEIEQEKVVRTP 44

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SL+  S+  LF DS+A  VGD++T+ +  +      + T       +   +     +  
Sbjct: 45  GSLYTGSYNNLFSDSKAFTVGDVITIKVVENIAGQTASNTNTQEQQKMDLNVPSPKLMGK 104

Query: 121 QQTPQMN-GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
               +     +         G  S +R   L   I+A VT +  NGNL I G + V+VND
Sbjct: 105 DLINKTPIAGITEQNSDTHKGSASTNRKSTLIATISARVTKVYPNGNLFIVGKKVVKVND 164

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           + ++L ++GIV+P D+   NSV   +I++  + Y G+G   +  RP    Q ++ + P
Sbjct: 165 DYQTLVISGIVKPTDIMQDNSVDSSRISDMYVEYNGEGYMADSSRPGWLAQFLKRIWP 222


>gi|304392502|ref|ZP_07374442.1| flagellar L-ring protein FlgH [Ahrensia sp. R2A130]
 gi|303295132|gb|EFL89492.1| flagellar L-ring protein FlgH [Ahrensia sp. R2A130]
          Length = 224

 Score =  198 bits (503), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 79/231 (34%), Positives = 120/231 (51%), Gaps = 10/231 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           + L    L  GC   I ++     MS +   + ++      G             SL+R 
Sbjct: 3   LALILVLLASGCA-QIDKLDQPKPMSAVEHPVAQHAYARQPGS--------ATRSSLYRP 53

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
           + + LF D  AL+ GDI+TV + IDD+A   N++ R R          G    G      
Sbjct: 54  ARSGLFTDRIALDPGDIVTVLVSIDDRASLQNKSERQRTVGRTLS-GQGTIAAGSLVGTG 112

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
           +G+   +      G G+  RAE + + +AAI+     NGNL++ GSQEVRVN E+R L V
Sbjct: 113 SGSAGLESQTRFDGDGATVRAETIRVSVAAIIRQRYPNGNLLVEGSQEVRVNRELRRLTV 172

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           TGI+RP D+  +N++  ++IAEARISYGG+G   E+ +PP G +L++ + P
Sbjct: 173 TGIIRPSDIGPNNTIQSERIAEARISYGGRGPIAEVQKPPYGARLLDKVLP 223


>gi|51596014|ref|YP_070205.1| flagellar basal body L-ring protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108807176|ref|YP_651092.1| flagellar basal body L-ring protein [Yersinia pestis Antiqua]
 gi|108812480|ref|YP_648247.1| flagellar basal body L-ring protein [Yersinia pestis Nepal516]
 gi|145598607|ref|YP_001162683.1| flagellar basal body L-ring protein [Yersinia pestis Pestoides F]
 gi|149366248|ref|ZP_01888283.1| flagellar L-ring protein precursor [Yersinia pestis CA88-4125]
 gi|165938678|ref|ZP_02227233.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166010850|ref|ZP_02231748.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|167419992|ref|ZP_02311745.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167425807|ref|ZP_02317560.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|170024644|ref|YP_001721149.1| flagellar basal body L-ring protein [Yersinia pseudotuberculosis
           YPIII]
 gi|186895117|ref|YP_001872229.1| flagellar basal body L-ring protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|218928925|ref|YP_002346800.1| flagellar basal body L-ring protein [Yersinia pestis CO92]
 gi|229896245|ref|ZP_04511415.1| flagellar L-ring protein precursor [Yersinia pestis Pestoides A]
 gi|229897180|ref|ZP_04512336.1| flagellar L-ring protein precursor [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229902862|ref|ZP_04517979.1| flagellar L-ring protein precursor [Yersinia pestis Nepal516]
 gi|270486642|ref|ZP_06203716.1| flagellar L-ring protein FlgH [Yersinia pestis KIM D27]
 gi|294504027|ref|YP_003568089.1| flagellar L-ring protein precursor [Yersinia pestis Z176003]
 gi|81518689|sp|Q8ZFB2|FLGH2_YERPE RecName: Full=Flagellar L-ring protein 2; AltName: Full=Basal body
           L-ring protein 2; Flags: Precursor
 gi|81639723|sp|Q66BT9|FLGH1_YERPS RecName: Full=Flagellar L-ring protein 1; AltName: Full=Basal body
           L-ring protein 1; Flags: Precursor
 gi|51589296|emb|CAH20917.1| flagellar L-ring protein precursor [Yersinia pseudotuberculosis IP
           32953]
 gi|108776128|gb|ABG18647.1| flagellar L-ring protein precursor [Yersinia pestis Nepal516]
 gi|108779089|gb|ABG13147.1| flagellar L-ring protein precursor [Yersinia pestis Antiqua]
 gi|115347536|emb|CAL20445.1| flagellar L-ring protein precursor [Yersinia pestis CO92]
 gi|145210303|gb|ABP39710.1| flagellar L-ring protein precursor [Yersinia pestis Pestoides F]
 gi|149292661|gb|EDM42735.1| flagellar L-ring protein precursor [Yersinia pestis CA88-4125]
 gi|165913292|gb|EDR31914.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165990194|gb|EDR42495.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166961687|gb|EDR57708.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167055206|gb|EDR65003.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|169751178|gb|ACA68696.1| flagellar L-ring protein [Yersinia pseudotuberculosis YPIII]
 gi|186698143|gb|ACC88772.1| flagellar L-ring protein [Yersinia pseudotuberculosis PB1/+]
 gi|229680309|gb|EEO76408.1| flagellar L-ring protein precursor [Yersinia pestis Nepal516]
 gi|229693517|gb|EEO83566.1| flagellar L-ring protein precursor [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229701168|gb|EEO89197.1| flagellar L-ring protein precursor [Yersinia pestis Pestoides A]
 gi|262361787|gb|ACY58508.1| flagellar L-ring protein precursor [Yersinia pestis D106004]
 gi|262366077|gb|ACY62634.1| flagellar L-ring protein precursor [Yersinia pestis D182038]
 gi|270335146|gb|EFA45923.1| flagellar L-ring protein FlgH [Yersinia pestis KIM D27]
 gi|294354486|gb|ADE64827.1| flagellar L-ring protein precursor [Yersinia pestis Z176003]
 gi|320015464|gb|ADV99035.1| flagellar L-ring protein precursor [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 229

 Score =  198 bits (503), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 55/239 (23%), Positives = 92/239 (38%), Gaps = 13/239 (5%)

Query: 1   MY-RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLD-ENNRMPFLGIDFKNSDSTK 58
           MY R     L    LL GC              P    +D   +  P        + S  
Sbjct: 1   MYLRKISAPLMTMLLLNGCA-----------YIPHKPLVDGTTSAQPAPASAPLPNGSIF 49

Query: 59  KSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           ++       +  LF+D R  N+GD LT+ ++ +  A   +    SRN +    ++     
Sbjct: 50  QTVQPMNYGYQPLFEDRRPRNIGDTLTITLQENVSASKSSSANASRNGTSSFGVTTAPRY 109

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                     ++   G     GKG  +     +  I   V  +L NGNL + G +++ +N
Sbjct: 110 LDGLLGNGRADMEITGDNTFGGKGGANANNTFSGTITVTVDQVLANGNLHVVGEKQIAIN 169

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
                +  +G+V P+ +   NSV+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 170 QGTEFIRFSGVVNPRTISGSNSVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNVSP 228


>gi|330808198|ref|YP_004352660.1| flagellar L-ring protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376306|gb|AEA67656.1| flagellar L-ring protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 231

 Score =  198 bits (503), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 49/241 (20%), Positives = 98/241 (40%), Gaps = 22/241 (9%)

Query: 1   MYRY-SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R+ S + L   + L GC +  +     P  +P+                     +   
Sbjct: 1   MKRFVSVLALSGITALAGCVA-PTPRPNDPYYAPVLP--------------RTPLPAAAN 45

Query: 60  SYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + S+++      L+ D +A  VGDI+T+ +    QA  +  +   + ++    L+  F  
Sbjct: 46  NGSIYQAGFEQNLYSDRKAFRVGDIITITLNERTQASKNANSQMDKTSNTSVGLTSLFGS 105

Query: 119 FGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                       ++ N  Y+   A+ G     ++  L   I   V  +L NG +++ G +
Sbjct: 106 SLTTNNPIGGNDLSLNAGYNSDRATKGDSKSGQSNSLTGSITVTVADVLPNGIIVVRGEK 165

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
            + +N     + + G+VR  D+   N+VS  ++A+ARI+Y G G   +  +P    +   
Sbjct: 166 WLTLNTGDELVRIAGMVRADDIATDNTVSSTRVADARITYSGTGAFADASQPGWFDRFFL 225

Query: 234 N 234
           +
Sbjct: 226 S 226


>gi|218549193|ref|YP_002382984.1| flagellar basal body L-ring protein [Escherichia fergusonii ATCC
           35469]
 gi|226701924|sp|B7LT58|FLGH_ESCF3 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|218356734|emb|CAQ89362.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           fergusonii ATCC 35469]
          Length = 232

 Score =  198 bits (503), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 52/233 (22%), Positives = 92/233 (39%), Gaps = 10/233 (4%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
            I       L GC    S        +P+          P  G     + S  +S     
Sbjct: 10  VIASLLVFSLTGCAWIPS--------TPLVQGA--TTAQPVPGPTPVANGSIFQSAQPIN 59

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
             +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                
Sbjct: 60  YGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGN 119

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              +++  GG + +GKG  + +   +  +   V  +L NGNL + G +++ +N     + 
Sbjct: 120 ARADVDASGGNSFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIR 179

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 180 FSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|22126387|ref|NP_669810.1| flagellar basal body L-ring protein [Yersinia pestis KIM 10]
 gi|45441406|ref|NP_992945.1| flagellar basal body L-ring protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|153950284|ref|YP_001401287.1| flagellar basal body L-ring protein [Yersinia pseudotuberculosis IP
           31758]
 gi|165925895|ref|ZP_02221727.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|166210591|ref|ZP_02236626.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167401004|ref|ZP_02306507.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|21959373|gb|AAM86061.1|AE013853_9 basal-body outer-membrane L (lipopolysaccharide layer) ring protein
           [Yersinia pestis KIM 10]
 gi|45436266|gb|AAS61822.1| basal-body outer-membrane L (lipopolysaccharide layer) ring protein
           [Yersinia pestis biovar Microtus str. 91001]
 gi|152961779|gb|ABS49240.1| flagellar L-ring protein FlgH [Yersinia pseudotuberculosis IP
           31758]
 gi|165922099|gb|EDR39276.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|166207771|gb|EDR52251.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167049393|gb|EDR60801.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           UG05-0454]
          Length = 243

 Score =  198 bits (503), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 55/239 (23%), Positives = 92/239 (38%), Gaps = 13/239 (5%)

Query: 1   MY-RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLD-ENNRMPFLGIDFKNSDSTK 58
           MY R     L    LL GC              P    +D   +  P        + S  
Sbjct: 15  MYLRKISAPLMTMLLLNGCA-----------YIPHKPLVDGTTSAQPAPASAPLPNGSIF 63

Query: 59  KSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           ++       +  LF+D R  N+GD LT+ ++ +  A   +    SRN +    ++     
Sbjct: 64  QTVQPMNYGYQPLFEDRRPRNIGDTLTITLQENVSASKSSSANASRNGTSSFGVTTAPRY 123

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                     ++   G     GKG  +     +  I   V  +L NGNL + G +++ +N
Sbjct: 124 LDGLLGNGRADMEITGDNTFGGKGGANANNTFSGTITVTVDQVLANGNLHVVGEKQIAIN 183

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
                +  +G+V P+ +   NSV+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 184 QGTEFIRFSGVVNPRTISGSNSVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNVSP 242


>gi|297570289|ref|YP_003691633.1| flagellar L-ring protein [Desulfurivibrio alkaliphilus AHT2]
 gi|296926204|gb|ADH87014.1| flagellar L-ring protein [Desulfurivibrio alkaliphilus AHT2]
          Length = 235

 Score =  198 bits (503), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 71/238 (29%), Positives = 115/238 (48%), Gaps = 5/238 (2%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M  Y  ++   S  L GC ++ S  +G    +    S  E     F   D  +   T   
Sbjct: 1   MRNYILLIALLSLWLTGCATTGSSGSGGSDQAAAPPS--ERLPERFAMPDPGSPPETPAE 58

Query: 61  YSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            +++  +    L++D+RA  VGDIL V +        +  T   R++S++  +S  F L 
Sbjct: 59  GTIYNGNRGLDLYRDNRAREVGDILLVRVVETSSGRKNATTIAERDSSINAGISSFFGLD 118

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                +   ++N        G+G  SR   +   I+A V      GNL+I G QEVRVN+
Sbjct: 119 NFVGER--SSINAGINTDFEGRGRTSRDSDVTATISARVVDKTMEGNLVIRGYQEVRVNN 176

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           E + + ++G+VRP D++A NSV+ D+IA+ARI Y GKG   +  RP    + ++ + P
Sbjct: 177 ETQFIILSGLVRPDDINASNSVNSDRIADARIEYSGKGLLADKQRPGWLSRAVQAIWP 234


>gi|253990124|ref|YP_003041480.1| flagellar basal body L-ring protein [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253781574|emb|CAQ84737.1| flagellar l-ring protein precursor (basal body l-ring protein)
           [Photorhabdus asymbiotica]
          Length = 250

 Score =  198 bits (502), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 47/242 (19%), Positives = 93/242 (38%), Gaps = 22/242 (9%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            ++   +      L GC                     +             + +   + 
Sbjct: 24  NKWRCSIALAVLSLTGCA----------------YIPQKPLVEGATTAAPSATTAPVPNG 67

Query: 62  SLWR------DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG 115
           ++++        +  LF+D R  N+GD LT+ ++ +  A  ++    SRN       +  
Sbjct: 68  AIFQVVQPIYYGYQPLFEDRRPRNIGDTLTITLQENVSASKNSSANASRNGKTSFSATLT 127

Query: 116 FSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
                        +L+ +G     GKG  +        I   V  +L NGNL + G +++
Sbjct: 128 PRFLKGLIGGDKTDLDMEGENTFGGKGGANANNTFRGTITVTVDQLLANGNLHVVGEKQI 187

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
            +N     +  +G+V P+ ++A+N+VS +++A+ARI Y G G   E        +   N+
Sbjct: 188 AINQGTEFIRFSGVVNPRTINANNTVSSNQVADARIEYVGNGYINEAQNMGWLQRFFLNV 247

Query: 236 SP 237
           +P
Sbjct: 248 AP 249


>gi|327393474|dbj|BAK10896.1| flagellar L-ring protein precursor FlgH [Pantoea ananatis AJ13355]
          Length = 234

 Score =  198 bits (502), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 53/240 (22%), Positives = 91/240 (37%), Gaps = 24/240 (10%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
           ++V      L GC             +P+         +P              + S+++
Sbjct: 10  WLVASLLLTLNGCALVPR--------TPLVQGATTAQPLPSAPPVV--------NGSIFQ 53

Query: 66  D------SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
                   +  LF+D R  N+GD LT+ ++ +  A   + +  SRN S    ++   +  
Sbjct: 54  GVAPLNYGYQPLFEDRRPRNIGDTLTITLQENVSASKSSTSNASRNGSGSLGITAVPTGL 113

Query: 120 GQQTPQMN--GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                      N    G    +GKG  S        I   V  +L NGNL + G +++ +
Sbjct: 114 AGLAGASGEKANFAAGGKNDFAGKGGASANNTFTGTITVTVDQVLSNGNLHVVGEKQIEI 173

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N     +  +G+V P+ + A N+V    +A+ARI Y G G   E        +   N+SP
Sbjct: 174 NQGTEFIRFSGVVNPRTISASNAVLSTAVADARIEYVGNGYINEAQNMGWLQRFFLNISP 233


>gi|302185579|ref|ZP_07262252.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           syringae 642]
          Length = 237

 Score =  198 bits (502), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 54/251 (21%), Positives = 103/251 (41%), Gaps = 30/251 (11%)

Query: 1   MYRY-------SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKN 53
           M R            LC  +LL GC +  ++    P  +P+                   
Sbjct: 1   MNRLSVPRFSVLIASLCGITLLSGCVAPTAK-PNDPYYAPVLP--------------RTP 45

Query: 54  SDSTKKSYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL 112
             +   + ++++      L+ D +A  +GDI+T+ +     A     +  S++++    L
Sbjct: 46  MSAAANNGAIYQAGFEQNLYGDRKAFRIGDIITITLSERMAASKAATSAMSKDSTNSIGL 105

Query: 113 SGGFSLFGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
           +  F              ++ N  Y+G  ++ G G  +++  L   +   V  +L NG L
Sbjct: 106 TSLFGSGLTTNNPIGGNDLSLNAGYNGARSTKGDGKAAQSNSLTGSVTVTVADVLPNGIL 165

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
            + G + + +N     + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P  
Sbjct: 166 AVRGEKWMTLNTGDELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGW 225

Query: 228 GHQLIENLSPL 238
             +    LSPL
Sbjct: 226 FDRFF--LSPL 234


>gi|113969609|ref|YP_733402.1| flagellar basal body L-ring protein [Shewanella sp. MR-4]
 gi|123130593|sp|Q0HKS2|FLGH_SHESM RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|113884293|gb|ABI38345.1| flagellar L-ring protein [Shewanella sp. MR-4]
          Length = 224

 Score =  198 bits (502), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 49/208 (23%), Positives = 87/208 (41%), Gaps = 5/208 (2%)

Query: 32  SPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRI 90
           +      D+    P              + S+++DS A +L+ D RA  VGDI+T+ ++ 
Sbjct: 19  TSKKPIADDPFYAPVYP--EAPPTKIAATGSIYQDSQAASLYSDIRAHKVGDIITIVLKE 76

Query: 91  DDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKL 150
             QA         + + L                 +  +L Y     +  +    ++  L
Sbjct: 77  ATQAKKSAGNQIKKGSDLSLD-PIYAGGSNVSIGGVPLDLRYKDSMNTKRESDADQSNSL 135

Query: 151 NLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEAR 210
           +  I+A V  +L NGNL++ G + + +N+    + VTGIVR QD+   N++   ++A AR
Sbjct: 136 DGSISANVMQVLNNGNLVVRGEKWISINNGDEFIRVTGIVRSQDIKPDNTIDSTRMANAR 195

Query: 211 ISYGGKGRTTELLRPPIGHQLIEN-LSP 237
           I Y G G   +  +     Q   +   P
Sbjct: 196 IQYSGTGTFADAQKVGWLSQFFMSDWWP 223


>gi|289627767|ref|ZP_06460721.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289651642|ref|ZP_06482985.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|298487852|ref|ZP_07005892.1| Flagellar L-ring protein flgH [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298157577|gb|EFH98657.1| Flagellar L-ring protein flgH [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330866426|gb|EGH01135.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 237

 Score =  198 bits (502), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 53/251 (21%), Positives = 101/251 (40%), Gaps = 30/251 (11%)

Query: 1   MYRY-------SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKN 53
           M R            LC  +LL GC +  ++    P  +P+                   
Sbjct: 1   MNRLSVPRFSVLIASLCGITLLSGCVAPTAK-PNDPYYAPVLP--------------RTP 45

Query: 54  SDSTKKSYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL 112
             +   + ++++      L+ D +A  +GDI+T+ +     A     +  +++++    L
Sbjct: 46  MSAAANNGAIYQAGFEQNLYGDRKAFRIGDIITITLSERMAASKAATSAMTKDSTNSIGL 105

Query: 113 SGGFSLFGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
           +  F              ++ N  Y G   + G G  +++  L   +   V  +L NG L
Sbjct: 106 TSLFGSGLTTNNPIGGNDLSLNAGYTGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGIL 165

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
            + G + + +N     + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P  
Sbjct: 166 AVRGEKWMTLNTGDELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGW 225

Query: 228 GHQLIENLSPL 238
             +    LSPL
Sbjct: 226 FDRFF--LSPL 234


>gi|284920902|emb|CBG33965.1| flagellar L-ring protein [Escherichia coli 042]
          Length = 232

 Score =  198 bits (502), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 52/232 (22%), Positives = 91/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I       L GC    S        +P+       +  P  G     + S  +S      
Sbjct: 11  ISSLLVLSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINY 60

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 61  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNA 120

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 121 RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQGTEFIRF 180

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 181 SGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|195940719|ref|ZP_03086101.1| flagellar basal body L-ring protein [Escherichia coli O157:H7 str.
           EC4024]
          Length = 232

 Score =  198 bits (502), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 53/232 (22%), Positives = 92/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I+   +  L GC    S+        P+          P  G     + S  ++      
Sbjct: 11  ILTVLAVTLSGCAWIPSK--------PLVQGA--TTAQPVPGPAPVVNGSIFQTAQPINY 60

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  NVGD LT+ ++ +  A   +    SR+   +                 
Sbjct: 61  GYQPLFEDRRPRNVGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNA 120

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             +L   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 121 RADLEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 180

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 181 SGVVNPRTISGTNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|242238972|ref|YP_002987153.1| flagellar L-ring protein [Dickeya dadantii Ech703]
 gi|242131029|gb|ACS85331.1| flagellar L-ring protein [Dickeya dadantii Ech703]
          Length = 228

 Score =  198 bits (502), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 54/238 (22%), Positives = 100/238 (42%), Gaps = 12/238 (5%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLD-ENNRMPFLGIDFKNSDSTKK 59
           M   S +++  +  L GC              P  + ++ +    P   + +  + S  +
Sbjct: 1   MAGRSVLLVSAAIALAGCA-----------YMPHKNLVEGDTTAQPAPAVMYATNGSIFQ 49

Query: 60  SYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
           +       +  LF+D R  NVGDILT+ ++ +  A   +    SR+ S    ++    + 
Sbjct: 50  TVQPMNYGYQPLFEDRRPRNVGDILTITLQENVSASKSSTASASRDGSATSTVTTAPRML 109

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                    +L+  G    +GKG  + +      I   V  +L NGNL + G +++ +N 
Sbjct: 110 QGLFGNQRADLDAAGTNDFTGKGGATASNTFTGTITVTVREVLSNGNLKVVGEKQIAINQ 169

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
               +  +G+V P+ +   NSV   ++A+ARI Y GKG   E        +   N++P
Sbjct: 170 GAEYIRFSGVVNPRTITGTNSVVSTQVADARIEYVGKGYINEAQEMGWLQRFFLNVAP 227


>gi|330953728|gb|EGH53988.1| flagellar basal body L-ring protein [Pseudomonas syringae Cit 7]
          Length = 237

 Score =  198 bits (502), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 53/251 (21%), Positives = 102/251 (40%), Gaps = 30/251 (11%)

Query: 1   MYRY-------SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKN 53
           M R            LC  +LL GC +  ++    P  +P+                   
Sbjct: 1   MNRLSVPRFSVLIASLCGITLLSGCVAPTAK-PNDPYYAPVLP--------------RTP 45

Query: 54  SDSTKKSYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL 112
             +   + ++++      L+ D +A  +GDI+T+ +     A     +  +++++    L
Sbjct: 46  MSAAANNGAIYQAGFEQNLYGDRKAFRIGDIITITLSERMAASKAATSAMTKDSTNSIGL 105

Query: 113 SGGFSLFGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
           +  F              ++ N  Y+G   + G G  +++  L   +   V  +L NG L
Sbjct: 106 TSLFGSGLTTNNPIGGNDLSLNAGYNGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGIL 165

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
            + G + + +N     + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P  
Sbjct: 166 AVRGEKWMTLNTGDELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGW 225

Query: 228 GHQLIENLSPL 238
             +    LSPL
Sbjct: 226 FDRFF--LSPL 234


>gi|77165835|ref|YP_344360.1| flagellar L-ring protein [Nitrosococcus oceani ATCC 19707]
 gi|110816532|sp|Q3J8L6|FLGH_NITOC RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|76884149|gb|ABA58830.1| Flagellar L-ring protein [Nitrosococcus oceani ATCC 19707]
          Length = 234

 Score =  198 bits (502), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 55/249 (22%), Positives = 93/249 (37%), Gaps = 28/249 (11%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M     ++      + GC + +      P  +                           +
Sbjct: 1   MNIKKIVLGIAGFFITGCAAQLPP--PDPSFAATRP--------------VATPPPQPNN 44

Query: 61  YSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS-- 117
            +++   +  +LF D RA  +GD++TV +     A   + T   R+ S            
Sbjct: 45  GAIYHAGYEISLFTDYRARQIGDVITVVLEERTDAEKGSDTAIDRDTSYSLTNPTLLGSG 104

Query: 118 --------LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLII 169
                   L        +  +     GA SG G  S+  +LN  I   V  +L NGNL+I
Sbjct: 105 VQFNTPNWLPLASNQDNSLEMAVKAKGAFSGGGDSSQNNRLNGHITVTVAEVLPNGNLVI 164

Query: 170 SGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGH 229
            G + V +N     + ++GIV  +D+   N+VS  K+A+AR++Y G G T E  R     
Sbjct: 165 RGEKVVTINHGNEYIKISGIVNRRDIKPDNTVSSLKLADARLAYVGDGATHEANRMGWLS 224

Query: 230 QLIEN-LSP 237
           +   +   P
Sbjct: 225 RFFFSRFMP 233


>gi|66046703|ref|YP_236544.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           syringae B728a]
 gi|75501290|sp|Q4ZQR6|FLGH_PSEU2 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|63257410|gb|AAY38506.1| Flagellar L-ring protein [Pseudomonas syringae pv. syringae B728a]
          Length = 237

 Score =  198 bits (502), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 54/251 (21%), Positives = 102/251 (40%), Gaps = 30/251 (11%)

Query: 1   MYRY-------SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKN 53
           M R            LC  +LL GC +  ++    P  +P+                   
Sbjct: 1   MNRLSVPRFSVLIASLCGITLLSGCVAPTAK-PNDPYYAPVLP--------------RTP 45

Query: 54  SDSTKKSYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL 112
             +   + ++++      L+ D +A  +GDI+T+ +     A     +  S++++    L
Sbjct: 46  MSAAANNGAIYQAGFEQNLYGDRKAFRIGDIITITLSERMAASKAATSAMSKDSTNSIGL 105

Query: 113 SGGFSLFGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
           +  F              ++ N  Y+G   + G G  +++  L   +   V  +L NG L
Sbjct: 106 TSLFGSGLTTNNPIGGNDLSLNAGYNGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGIL 165

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
            + G + + +N     + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P  
Sbjct: 166 AVRGEKWMTLNTGDELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGW 225

Query: 228 GHQLIENLSPL 238
             +    LSPL
Sbjct: 226 FDRFF--LSPL 234


>gi|291617023|ref|YP_003519765.1| FlgH [Pantoea ananatis LMG 20103]
 gi|291152053|gb|ADD76637.1| FlgH [Pantoea ananatis LMG 20103]
          Length = 236

 Score =  198 bits (502), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 53/240 (22%), Positives = 91/240 (37%), Gaps = 24/240 (10%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
           ++V      L GC             +P+         +P              + S+++
Sbjct: 12  WLVASLLLTLNGCALVPR--------TPLVQGATTAQPLPSAPPVV--------NGSIFQ 55

Query: 66  D------SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
                   +  LF+D R  N+GD LT+ ++ +  A   + +  SRN S    ++   +  
Sbjct: 56  GVAPLNYGYQPLFEDRRPRNIGDTLTITLQENVSASKSSTSNASRNGSGSLGITAVPTGL 115

Query: 120 GQQTPQMN--GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                      N    G    +GKG  S        I   V  +L NGNL + G +++ +
Sbjct: 116 AGLAGASGEKANFAAGGKNDFAGKGGASANNTFTGTITVTVDQVLSNGNLHVVGEKQIEI 175

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N     +  +G+V P+ + A N+V    +A+ARI Y G G   E        +   N+SP
Sbjct: 176 NQGTEFIRFSGVVNPRTISASNAVLSTAVADARIEYVGNGYINEAQNMGWLQRFFLNISP 235


>gi|238751765|ref|ZP_04613253.1| Flagellar L-ring protein [Yersinia rohdei ATCC 43380]
 gi|238710036|gb|EEQ02266.1| Flagellar L-ring protein [Yersinia rohdei ATCC 43380]
          Length = 238

 Score =  197 bits (501), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 55/236 (23%), Positives = 93/236 (39%), Gaps = 12/236 (5%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLD-ENNRMPFLGIDFKNSDSTKKSY 61
           R+    L    LL GC              P  S +D + +  P        + S  ++ 
Sbjct: 13  RWVGAPLVAMLLLNGCA-----------YIPHKSLVDGKTSAQPAPASAPLPNGSIFQAA 61

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
                 +  LF+D R  NVGD LT+ ++ +  A   +    SRN +    ++        
Sbjct: 62  QPMNYGYQPLFEDRRPRNVGDTLTITLQENVSASKSSSANASRNGASKFGVATSPRYLDG 121

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
                  +++  G     GKG  +     +  I   V  +L NGNL + G +++ +N   
Sbjct: 122 LLGNARADMDISGDSTFGGKGGANANNTFSGTITVTVDQVLANGNLHVVGEKQIAINQGT 181

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
             +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +   N+SP
Sbjct: 182 EFIRFSGVVNPRTISGSNSVISTQVADARIEYVGNGYINEAQTMGWLQRFFLNVSP 237


>gi|332994159|gb|AEF04214.1| flagellar basal body L-ring protein [Alteromonas sp. SN2]
          Length = 214

 Score =  197 bits (501), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 50/228 (21%), Positives = 85/228 (37%), Gaps = 18/228 (7%)

Query: 15  LFGCHSSISEI--TGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDS-HAAL 71
           + GC S+         P  +P+                    +   +  SL+R     +L
Sbjct: 1   MAGCASTNQPPVQANDPSFAPVVPDY--------------PREKIVEDGSLFRSYMANSL 46

Query: 72  FKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLN 131
           + D  A  VGDI+T+ +  +  A     T  S++ ++      G           +  L 
Sbjct: 47  YSDMTARRVGDIITITLSENTNASKSAGTSTSKDTTVDLDTITGLGGQPLNIGGQSVQLG 106

Query: 132 YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVR 191
                   G  + +++  L+  I+  V  +L N NL+I G + + +N     + +TGI+R
Sbjct: 107 VSSSNEFEGDAATNQSNSLSGNISVTVVEVLPNDNLVIRGEKWLTLNHGDEYIRLTGIIR 166

Query: 192 PQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI-ENLSPL 238
             D+   N V   KIA ARI Y G G            +    +  PL
Sbjct: 167 LSDISPENEVLSTKIANARIQYSGTGSFASAQEKGWLTKFFTSSWWPL 214


>gi|167626158|ref|YP_001676452.1| flagellar basal body L-ring protein [Shewanella halifaxensis
           HAW-EB4]
 gi|167356180|gb|ABZ78793.1| flagellar L-ring protein [Shewanella halifaxensis HAW-EB4]
          Length = 224

 Score =  197 bits (501), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 60/232 (25%), Positives = 102/232 (43%), Gaps = 19/232 (8%)

Query: 9   LCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH 68
           +  + LL GC + I E    P             +  +   +   S    ++ S++R   
Sbjct: 10  IGLTLLLSGCVAHIPEPDTAP------------GKPEWAPPEIDYSLPDAENGSVYRPGF 57

Query: 69  A-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
              LFKD RA   GDILTV +     +     T  S++  +              T  + 
Sbjct: 58  MLTLFKDKRAYREGDILTVALDEKTYSSKRADTKTSKSGGVSID-----GQGTTGTSSIA 112

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
           G+   + G + +G GS ++  +L+  I   V  +L NG L+I G + +R+N     L + 
Sbjct: 113 GSGEANMGRSFNGTGSSTQQNQLSGSITVTVAKVLPNGALLIRGEKWLRLNQGDEYLRLL 172

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS-PL 238
           G++R  D+D  N++S  +IA+ARI YGG+G  ++  R     +   +   PL
Sbjct: 173 GLIRADDIDNDNTISSQRIADARIIYGGQGAISDSNRMGWAARYFNSPWFPL 224


>gi|237653580|ref|YP_002889894.1| flagellar L-ring protein [Thauera sp. MZ1T]
 gi|237624827|gb|ACR01517.1| flagellar L-ring protein [Thauera sp. MZ1T]
          Length = 225

 Score =  197 bits (501), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 48/232 (20%), Positives = 91/232 (39%), Gaps = 16/232 (6%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I +   +LL GC +             + ++       P        + +   + ++++ 
Sbjct: 8   IAVGLLALLSGCAA-------------IQTTPPSAVHQPMSVRPEAMATALPGNGAIYQT 54

Query: 67  -SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
                LF+D RA  +GD +T+++   + A        +RN ++   +     L       
Sbjct: 55  VQARPLFEDRRARRIGDTITINLVERNTAEKSANANATRNGNMSAGIGPINRLPLSGLNG 114

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
           +   L  D     +GKG+ +     N  I   V  +  NGNL++SG + V +N     + 
Sbjct: 115 L--ELEADAESDFNGKGAAAANNVFNGTITVTVIDVYPNGNLLVSGEKMVAINQGNEFIR 172

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            +G++ P  V   N+V   ++A+ARI Y G G   E        +    + P
Sbjct: 173 FSGVINPNTVTTANTVQSTQVADARIEYRGSGFIDESNTMGWLQRFFVAIMP 224


>gi|254433426|ref|ZP_05046934.1| flagellar L-ring protein FlgH [Nitrosococcus oceani AFC27]
 gi|207089759|gb|EDZ67030.1| flagellar L-ring protein FlgH [Nitrosococcus oceani AFC27]
          Length = 255

 Score =  197 bits (501), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 55/249 (22%), Positives = 93/249 (37%), Gaps = 28/249 (11%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M     ++      + GC + +      P  +                           +
Sbjct: 22  MNIKKIVLGIAGFFITGCAAQLPP--PDPSFAATRP--------------VATPPPQPNN 65

Query: 61  YSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS-- 117
            +++   +  +LF D RA  +GD++TV +     A   + T   R+ S            
Sbjct: 66  GAIYHAGYEISLFTDYRARQIGDVITVVLEERTDAEKGSDTAIDRDTSYSLTNPTLLGSG 125

Query: 118 --------LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLII 169
                   L        +  +     GA SG G  S+  +LN  I   V  +L NGNL+I
Sbjct: 126 VQFNTPNWLPLASNQDNSLEMAVKAKGAFSGGGDSSQNNRLNGHITVTVAEVLPNGNLVI 185

Query: 170 SGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGH 229
            G + V +N     + ++GIV  +D+   N+VS  K+A+AR++Y G G T E  R     
Sbjct: 186 RGEKVVTINHGNEYIKISGIVNRRDIKPDNTVSSLKLADARLAYVGDGATHEANRMGWLS 245

Query: 230 QLIEN-LSP 237
           +   +   P
Sbjct: 246 RFFFSRFMP 254


>gi|296102905|ref|YP_003613051.1| lagellar L-ring protein precursor FlgH [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295057364|gb|ADF62102.1| lagellar L-ring protein precursor FlgH [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295096222|emb|CBK85312.1| Flagellar basal body L-ring protein [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 235

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 52/232 (22%), Positives = 92/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I+   +  L GC    S+        P+          P  G     + S  ++      
Sbjct: 14  ILTVLAVTLSGCAWIPSK--------PLVQGA--TTAQPVPGPAPVVNGSIFQTAQPINY 63

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  NVGD LT+ ++ +  A   +    SR+   +                 
Sbjct: 64  GYQPLFEDRRPRNVGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNA 123

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 124 RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 183

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 184 SGVVNPRTISGTNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|161503732|ref|YP_001570844.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865079|gb|ABX21702.1| hypothetical protein SARI_01817 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 235

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 54/242 (22%), Positives = 96/242 (39%), Gaps = 14/242 (5%)

Query: 1   MYRYSF----IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDS 56
           M +Y+     ++    + L GC    S+        P+          P  G     + S
Sbjct: 4   MQKYALHAYPLMALVVATLTGCAWIPSK--------PLVQGA--TTAQPIPGPVPVANGS 53

Query: 57  TKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
             +S       +  LF+D R  N+GD LT+ ++ +  A   +    SR+           
Sbjct: 54  IFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVP 113

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                       ++   GG + +GKG  + +   +  +   V  +L NGNL + G +++ 
Sbjct: 114 RYLQGLFGNSRADMEASGGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIA 173

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N     +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLS
Sbjct: 174 INQGTEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLS 233

Query: 237 PL 238
           P+
Sbjct: 234 PM 235


>gi|330899407|gb|EGH30826.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330943211|gb|EGH45618.1| flagellar basal body L-ring protein [Pseudomonas syringae pv. pisi
           str. 1704B]
 gi|330975979|gb|EGH76045.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           aptata str. DSM 50252]
          Length = 237

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 55/251 (21%), Positives = 102/251 (40%), Gaps = 30/251 (11%)

Query: 1   MYRY-------SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKN 53
           M R            LC  +LL GC +  ++    P  +P+                   
Sbjct: 1   MNRLSVPRFSVLIASLCGITLLSGCVAPTAK-PNDPYYAPVLP--------------RTP 45

Query: 54  SDSTKKSYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL 112
             +   + ++++      L+ D +A  +GDI+T+ +     A     +  S+N++    L
Sbjct: 46  MSAAANNGAIYQAGFEQNLYGDRKAFRIGDIITITLSERMAASKAATSAMSKNSNNSIGL 105

Query: 113 SGGFSLFGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
           +  F              ++ N  Y+G   + G G  +++  L   +   V  +L NG L
Sbjct: 106 TSLFGSGLTTNNPIGGNDLSLNAGYNGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGIL 165

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
            + G + + +N     + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P  
Sbjct: 166 AVRGEKWMTLNTGDELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGW 225

Query: 228 GHQLIENLSPL 238
             +    LSPL
Sbjct: 226 FDRFF--LSPL 234


>gi|323136550|ref|ZP_08071631.1| flagellar L-ring protein [Methylocystis sp. ATCC 49242]
 gi|322397867|gb|EFY00388.1| flagellar L-ring protein [Methylocystis sp. ATCC 49242]
          Length = 242

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 84/230 (36%), Positives = 132/230 (57%), Gaps = 11/230 (4%)

Query: 16  FGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDS 75
            GC +   + T  P M+P+GS L+ ++            ++         ++   LF D 
Sbjct: 15  TGCATDPRDFTREPHMTPVGSGLNFHDDQI---PVGALQNAVLGPGMRIDENRVNLFHDI 71

Query: 76  RALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL----- 130
           RA+NVGD++TV I ++D+A+  N T RSR   +  K +    L        N        
Sbjct: 72  RAMNVGDVVTVVIEMNDRAILGNSTDRSREAKIKSKWTFLLDLVPMLGGPTNSQTKQTGA 131

Query: 131 ---NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
              + D    + G+G+I+R+E++   +AA+VTA+L NGNL++ GSQE+RVN E+R L++ 
Sbjct: 132 WQNDIDSSTETQGQGTINRSEQIRFTLAAVVTAVLPNGNLVLHGSQEIRVNQELRVLSIG 191

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           G+ RP+D++  NS++YDKIAEAR+SYGG+GR TE+ +P  G QL +   P
Sbjct: 192 GVARPRDINKDNSINYDKIAEARVSYGGRGRLTEVQQPAWGQQLYDTFVP 241


>gi|325923277|ref|ZP_08184950.1| flagellar basal body L-ring protein [Xanthomonas gardneri ATCC
           19865]
 gi|325546204|gb|EGD17385.1| flagellar basal body L-ring protein [Xanthomonas gardneri ATCC
           19865]
          Length = 230

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 53/233 (22%), Positives = 103/233 (44%), Gaps = 17/233 (7%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           + L  S+LL GC ++  ++    +++P+   +                 +   + +++  
Sbjct: 12  LALACSALLGGCVAAG-DVRPFAELAPIVPVV--------------APVAQPTAGAIYAA 56

Query: 67  SHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
                L+ D RA +VGD+LTV++  +  A     T  S+ +++         +       
Sbjct: 57  GPGLNLYGDRRARDVGDLLTVNLVENTTASSTANTSISKADTVDMSTPTLLGVPLTVNGT 116

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
                +  G  +  GKG+ +++ ++   +   V   L NGNL+I G + +R+      + 
Sbjct: 117 DVLRNSTSGDRSFDGKGNTAQSNRMQGSVTVTVMQRLPNGNLVIQGQKNLRLTQGDELVQ 176

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
           V GIVR  D+   N+V   K+A+ARI+YGG+G   +        +   + LSP
Sbjct: 177 VQGIVRAADISPDNTVPSSKVADARIAYGGRGAIAQSNAMGWLSRFFNSRLSP 229


>gi|320179220|gb|EFW54178.1| Flagellar L-ring protein FlgH [Shigella boydii ATCC 9905]
          Length = 232

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 52/232 (22%), Positives = 91/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I       L GC    S        +P+       +  P  G     + S  +S      
Sbjct: 11  ISSLLVLSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINY 60

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 61  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNA 120

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 121 RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 180

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 181 SGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|117926377|ref|YP_866994.1| flagellar L-ring protein [Magnetococcus sp. MC-1]
 gi|117610133|gb|ABK45588.1| flagellar L-ring protein [Magnetococcus sp. MC-1]
          Length = 232

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 62/242 (25%), Positives = 99/242 (40%), Gaps = 22/242 (9%)

Query: 1   MYRYSFIVLCYSS-LLFGCH-SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
           M   + +V   +  LL GC  +  S+    PQ                +           
Sbjct: 3   MNVQTMVVGVLALGLLSGCGMTRSSQRPPAPQ---------------AIIQAQPAEMLNP 47

Query: 59  KSYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
              SLW       LF D++A  VGD++TV++     A  +  T   R       L G F 
Sbjct: 48  NKGSLWNSGGRNTLFADAKARFVGDLITVNVSESSSAKKNAMTELKREADSEVALGGLFG 107

Query: 118 LF----GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
           L          ++  + +        G+G+ SR       I   VT +L NGNL I G +
Sbjct: 108 LTEALQKGGLSKLVDSNSTTSNQNHKGEGTTSRDSTFTATITCQVTEVLSNGNLRIEGRR 167

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           ++ VN E + + ++G++RP+D+   NSV+  +IA+ARI Y G+G   +  +P    Q   
Sbjct: 168 DITVNHENQFIILSGVIRPEDISNTNSVNSAQIADARIDYSGEGVLDDQQQPSWLQQFFT 227

Query: 234 NL 235
             
Sbjct: 228 TF 229


>gi|308273546|emb|CBX30148.1| hypothetical protein N47_D29570 [uncultured Desulfobacterium sp.]
          Length = 240

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 71/247 (28%), Positives = 110/247 (44%), Gaps = 18/247 (7%)

Query: 1   MYRYSFIVLCYSSLL-FGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M   +   LC   +L  GC +    I    +         E          +      K 
Sbjct: 1   MIPKNIAALCIIIVLISGCSAGSQYIKQAAK--------TEVKSTAGDQAPYAYQPPEKS 52

Query: 60  SYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF-- 116
             SLW +S  + LF D RA  VGD++ V I  D +A  +  T  +R++S + KL      
Sbjct: 53  EGSLWSESEGSFLFPDRRARRVGDLVIVRIVEDPEAELNANTSTNRSSSANAKLEFLGYM 112

Query: 117 ------SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
                 +    Q P  +  +    G    G+GS  R   +   ++A+V  +  NGN++IS
Sbjct: 113 KALAQKNPNLAQNPGTDDLITASLGTKFDGQGSSDRDGHVKAYVSAVVLQVFPNGNMLIS 172

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ 230
           G +EV+VN E   + ++GIVR +D+   N VS   +AEA+ISY GKG   +  RP     
Sbjct: 173 GRREVKVNSETEYITLSGIVRAEDISTANEVSSAYVAEAKISYSGKGPVADKQRPGWLMG 232

Query: 231 LIENLSP 237
           +I+ + P
Sbjct: 233 VIDYVWP 239


>gi|88911317|sp|Q7N5M7|FLGH_PHOLL RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
          Length = 229

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 46/242 (19%), Positives = 92/242 (38%), Gaps = 22/242 (9%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            ++   +      L GC                     +             + +   + 
Sbjct: 3   NKWRCSIALAVLSLTGCA----------------YIPQKPLVEGATTAAPSVATAPVPNG 46

Query: 62  SLWR------DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG 115
           ++++        +  LF+D R  N+GD LT+ ++ +  A  ++    SRN       +  
Sbjct: 47  AIFQVVQPVYYGYQPLFEDRRPRNIGDTLTITLQENVSASKNSSANASRNGKNTFSAALT 106

Query: 116 FSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
                        +L+ +      GKG  +        I   V  +L NGNL + G +++
Sbjct: 107 PRFLKGLIGGDKTDLDMEAENTFGGKGGANANNTFKGTITVTVDRLLANGNLHVVGEKQI 166

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
            +N     +  +G+V P+ ++A+N+VS +++A+ARI Y G G   E        +   N+
Sbjct: 167 AINQGTEFIRFSGVVNPRTINANNTVSSNQVADARIEYVGNGYINEAQNMGWLQRFFLNV 226

Query: 236 SP 237
           +P
Sbjct: 227 AP 228


>gi|71736849|ref|YP_275558.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257484943|ref|ZP_05638984.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|110816535|sp|Q48GC5|FLGH_PSE14 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|71557402|gb|AAZ36613.1| flagellar L-ring protein FlgH [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320325097|gb|EFW81166.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329356|gb|EFW85349.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330880530|gb|EGH14679.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330986472|gb|EGH84575.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011046|gb|EGH91102.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 237

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 53/251 (21%), Positives = 102/251 (40%), Gaps = 30/251 (11%)

Query: 1   MYRY-------SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKN 53
           M R            LC  +LL GC +  ++    P  +P+                   
Sbjct: 1   MNRISVPRFSVLIASLCGITLLSGCVAPTAK-PNDPYYAPVLP--------------RTP 45

Query: 54  SDSTKKSYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL 112
             +   + ++++      L+ D +A  +GDI+T+ +     A     +  +++++    L
Sbjct: 46  MSAAANNGAIYQAGFEQNLYGDRKAFRIGDIITITLSERMAASKAATSAMTKDSTNSIGL 105

Query: 113 SGGFSLFGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
           +  F              ++ N  Y+G   + G G  +++  L   +   V  +L NG L
Sbjct: 106 TSLFGSGLTTNNPIGGNDLSLNAGYNGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGIL 165

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
            + G + + +N     + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P  
Sbjct: 166 AVRGEKWMTLNTGDELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGW 225

Query: 228 GHQLIENLSPL 238
             +    LSPL
Sbjct: 226 FDRFF--LSPL 234


>gi|306814072|ref|ZP_07448245.1| flagellar basal body L-ring protein [Escherichia coli NC101]
 gi|305852709|gb|EFM53157.1| flagellar basal body L-ring protein [Escherichia coli NC101]
          Length = 232

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 53/232 (22%), Positives = 92/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I       L GC    S        +P+       +  P  G     + S  +S      
Sbjct: 11  ISSLLVLSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINY 60

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 61  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNA 120

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 121 RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 180

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+VS  ++A+ARI Y G G   E        +   NLSP+
Sbjct: 181 SGVVNPRTISGSNTVSSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|220934397|ref|YP_002513296.1| flagellar L-ring protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995707|gb|ACL72309.1| flagellar L-ring protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 229

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 53/223 (23%), Positives = 102/223 (45%), Gaps = 22/223 (9%)

Query: 18  CHS-SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALFKDS 75
           C S +  +    P+ S +   +                 +   + ++++ S+   LF+D 
Sbjct: 25  CASVNGVKPGDSPEFSAVNPPM--------------PVPAEYNNGAIFQASYGTGLFEDY 70

Query: 76  RALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGG 135
           +A  VGDILTV +    QA     T  S+ +S++       +    +      + + +G 
Sbjct: 71  KARRVGDILTVRLAERTQARKSANTSTSKESSVNMPTPTVLNRTIPEL-----STSIEGS 125

Query: 136 GASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDV 195
            +  G G  +++ +L+  I  +V  +L NGNL++ G + +R+N     + + GIVRP DV
Sbjct: 126 RSFDGAGDSAQSNQLDGSITVMVAEVLPNGNLVVQGEKWIRINQGQEFIRLRGIVRPVDV 185

Query: 196 DAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
            A N++   +IA A+++YGG G   +   P    +   + + P
Sbjct: 186 RADNTILSTQIANAQVAYGGSGTLADSNSPGWLTRFFNSPVWP 228


>gi|238752864|ref|ZP_04614329.1| Flagellar L-ring protein 1 [Yersinia rohdei ATCC 43380]
 gi|238708903|gb|EEQ01156.1| Flagellar L-ring protein 1 [Yersinia rohdei ATCC 43380]
          Length = 211

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 53/230 (23%), Positives = 95/230 (41%), Gaps = 22/230 (9%)

Query: 12  SSLLFGCHSSISEI-TGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA- 69
             +L GC + + ++       +P  + + +                  +   L++ ++  
Sbjct: 1   MLVLSGCETPVLQVHKDDAAFAPPANLVQQTTVK--------------EGGGLFQPAYNW 46

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN 129
           +L +D RA  VGDILTV +    Q+    +T   + N +   +         +       
Sbjct: 47  SLLQDRRAYRVGDILTVKLDESTQSSKQAKTNFGKKNEMSLGIPEILGKKLNKLGG---- 102

Query: 130 LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
            +  G     G  + ++   L   I   V  +L NG L+I G + + +N     + VTG+
Sbjct: 103 -SISGKRDFDGSATSAQQNMLRGSITVAVHQVLPNGVLVIRGEKWLTLNQGDEYMRVTGL 161

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSPL 238
           VR  DV+  NSVS  +IA ARISY G+G  ++        +   + L P+
Sbjct: 162 VRADDVERDNSVSSQRIANARISYAGRGALSDANSAGWLTRFFNHPLFPI 211


>gi|255021357|ref|ZP_05293405.1| Flagellar L-ring protein FlgH [Acidithiobacillus caldus ATCC 51756]
 gi|254969220|gb|EET26734.1| Flagellar L-ring protein FlgH [Acidithiobacillus caldus ATCC 51756]
          Length = 245

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 58/235 (24%), Positives = 103/235 (43%), Gaps = 16/235 (6%)

Query: 8   VLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDS 67
           +L     L  C        G   + P+            +  +  + ++   + ++W+D 
Sbjct: 21  LLLAVLYLSACA---EMGGGHRNLKPLQP--------LAIPAEPASLNAHPANGAIWQDG 69

Query: 68  HA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL----FGQQ 122
              +LF D+RA  VGD++TV I+ +  A  +  T  + ++SL   L+  F +        
Sbjct: 70  TNVSLFSDNRANRVGDLITVLIQENSSASNNTNTAINTSDSLSAALTNFFGITPAFGSVA 129

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
               + ++    G    G G+ +++      + A V  ++ NGNL+I GS+EV +N    
Sbjct: 130 GKAFSPSMGATSGQKYGGTGATTQSNTFTATLEATVVRVMGNGNLVIEGSKEVMLNGGHE 189

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            + V G+VR  DV   N+V   +IA+AR+ Y G G      R P   +   +L P
Sbjct: 190 FIRVAGVVRAADVTPQNTVYSTQIADARVEYSGDGTIYSAARMPWLARFFLSLWP 244


>gi|330875987|gb|EGH10136.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 237

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 54/251 (21%), Positives = 101/251 (40%), Gaps = 30/251 (11%)

Query: 1   MYR-------YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKN 53
           M R            LC  +LL GC +  ++    P  +P+                   
Sbjct: 1   MNRPGFPRFSVLIASLCGITLLSGCVAPTAK-PNDPYYAPVLP--------------RTP 45

Query: 54  SDSTKKSYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL 112
             +   + ++++      L+ D +A  VGDI+T+ +     A     +  +++++    L
Sbjct: 46  MSAASNNGAIYQAGFEQNLYGDRKAFRVGDIITITLSERMAASKAATSAMTKDSTNSIGL 105

Query: 113 SGGFSLFGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
           +  F              ++ N  Y G   + G G  +++  L   +   V  +L NG L
Sbjct: 106 TSLFGSGLTTNNPIGGNDLSLNAGYTGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGIL 165

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
            + G + + +N     + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P  
Sbjct: 166 SVRGEKWMTLNTGDELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGW 225

Query: 228 GHQLIENLSPL 238
             +    LSPL
Sbjct: 226 FDRFF--LSPL 234


>gi|114320060|ref|YP_741743.1| flagellar L-ring protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226454|gb|ABI56253.1| flagellar L-ring protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 224

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 107/240 (44%), Gaps = 22/240 (9%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           + ++ F+ L  ++ L GC         +P  +P    L E                 + +
Sbjct: 5   LIKWLFMALAVTA-LAGCAG-------MPDQAPKPLPLPEIA-----------EPERQNN 45

Query: 61  YSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            ++++      LF+D R+  VGD++TV    +  A   N +  ++++S            
Sbjct: 46  GAIYQAGGEQRLFEDRRSRRVGDVITVLFEENTDASKSNSSSMTKSSSAELPAPTVAG-R 104

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
           G     +    +     + SG G+  ++ +L   + AIVT  + NG L+I G +++ +N 
Sbjct: 105 GATRGGVPLEFDAQADRSFSGDGAADQSNQLTGTLTAIVTDTMPNGYLVIEGQKKLTLNQ 164

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSPL 238
               + ++GIVRP DV A N+VS  ++A A+I+Y G G   +  RP    ++  +   PL
Sbjct: 165 GAEYVTISGIVRPDDVGADNTVSSLRVANAQIAYTGTGALADSNRPGWLTRVFNSRWWPL 224


>gi|307131606|ref|YP_003883622.1| flagellar L-ring protein flgH [Dickeya dadantii 3937]
 gi|306529135|gb|ADM99065.1| Flagellar L-ring protein flgH [Dickeya dadantii 3937]
          Length = 240

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 50/235 (21%), Positives = 86/235 (36%), Gaps = 10/235 (4%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
           R   +       L GC     +                    P   +    + S  ++  
Sbjct: 15  RPRLLAYVMMLTLSGCAYIPHDKV----------VTGPTTAQPAPPLQAIPNGSIFQTGQ 64

Query: 63  LWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ 122
                +  +F+D R  NVGD LT+ ++ +  A   +    SR+ S    ++    L    
Sbjct: 65  AMNYGYQPMFEDRRPRNVGDTLTIVLQENVSASKSSSANASRDASGSFGMTTTPRLLEGP 124

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
                   N  G    +GKG  +        I   V  +L NGNL + G +++ VN    
Sbjct: 125 LGNNRAAFNATGKDDFTGKGGANANNTFTGTITVTVDQVLTNGNLHVVGEKQIAVNQGTE 184

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            +  +G+V P+ +   N+V   ++A+AR+ Y G G   E        +   N+SP
Sbjct: 185 FIRFSGVVNPRTISGSNTVPSTQVADARMEYVGNGYINETQTMGWLQRFFLNVSP 239


>gi|78047583|ref|YP_363758.1| flagellar basal body L-ring protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|110816547|sp|Q3BU05|FLGH_XANC5 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|78036013|emb|CAJ23704.1| flagellar basal body L-ring protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 230

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 52/233 (22%), Positives = 101/233 (43%), Gaps = 17/233 (7%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           + +  S+LL GC ++  ++    +++P+   +                 +   + +++  
Sbjct: 12  LAIACSALLGGCVAAG-DVRPFAELAPIVPVV--------------APVAQPTAGAIYAA 56

Query: 67  S-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
                L+ D RA +VGD+LTV++     A     T  S+ ++                  
Sbjct: 57  GPSLNLYGDRRARDVGDLLTVNLVESTTASSTANTSISKKDATTMGAPTLLGAPLTVGGL 116

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
                +  G  + +GKG+ +++ ++   +   V   L NGNL+I G + +R+      + 
Sbjct: 117 NVLENSTSGDRSFAGKGNTAQSNRMQGSVTVTVMQRLPNGNLVIQGQKNLRLTQGDELVQ 176

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
           V GIVR  D+   N+V   K+A+ARI+YGG+G   +        +   + LSP
Sbjct: 177 VQGIVRAADIAPDNTVPSSKVADARIAYGGRGAIAQSNAMGWLSRFFNSRLSP 229


>gi|281178188|dbj|BAI54518.1| flagellar basal-body L-ring protein FlgH [Escherichia coli SE15]
 gi|330910893|gb|EGH39403.1| flagellar L-ring protein FlgH [Escherichia coli AA86]
          Length = 232

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 52/232 (22%), Positives = 92/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I    +  L GC    S        +P+       +  P  G     + S  +S      
Sbjct: 11  ISSLLALSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINY 60

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 61  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNA 120

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 121 RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 180

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 181 SGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|238799110|ref|ZP_04642566.1| Flagellar L-ring protein [Yersinia mollaretii ATCC 43969]
 gi|238717057|gb|EEQ08917.1| Flagellar L-ring protein [Yersinia mollaretii ATCC 43969]
          Length = 237

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 53/229 (23%), Positives = 91/229 (39%), Gaps = 12/229 (5%)

Query: 10  CYSSLLFGCHSSISEITGIPQMSPMGSSLD-ENNRMPFLGIDFKNSDSTKKSYSLWRDSH 68
             + LL GC              P  S +D   +  P        + S  ++       +
Sbjct: 19  LTAMLLNGCA-----------YIPHKSLVDGTTSAQPAPASAPLPNGSIFQAAQPMNYGY 67

Query: 69  AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
             LF+D R  NVGD LT+ ++ +  A   +    SRN S    ++               
Sbjct: 68  QPLFEDRRPRNVGDTLTITLQENVSASKSSSANASRNGSSKFGVATAPRYLEGLLGNARA 127

Query: 129 NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
           +++  G     GKG  +     +  I   V  +L NGNL + G +++ +N     +  +G
Sbjct: 128 DMDISGDNTFGGKGGANANNTFSGTITVTVDRVLANGNLHVVGEKQIAINQGTEFIRFSG 187

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 188 VVNPRTISGSNTVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNISP 236


>gi|311280014|ref|YP_003942245.1| flagellar L-ring protein [Enterobacter cloacae SCF1]
 gi|308749209|gb|ADO48961.1| flagellar L-ring protein [Enterobacter cloacae SCF1]
          Length = 232

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 54/237 (22%), Positives = 97/237 (40%), Gaps = 11/237 (4%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
           +RY FI +  +    GC    S+        P+          P  G     + S  ++ 
Sbjct: 7   FRYPFI-VALALTQAGCAWIPSK--------PLVEGA--TTAQPIPGPMPTANGSIYQTA 55

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
                 +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +   S        
Sbjct: 56  QPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFSTVPRYLEG 115

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
                  +++  GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N   
Sbjct: 116 LFGNARADVDASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGT 175

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
             +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 176 EFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|146311249|ref|YP_001176323.1| flagellar basal body L-ring protein [Enterobacter sp. 638]
 gi|145318125|gb|ABP60272.1| flagellar L-ring protein [Enterobacter sp. 638]
          Length = 235

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 52/232 (22%), Positives = 93/232 (40%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           IV   +  L GC    S+        P+          P  G     + S  ++      
Sbjct: 14  IVTVLAVTLSGCALIPSK--------PLVQGA--TTAQPIPGPTPVVNGSIFQTAQPINY 63

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 64  GYQPLFEDRRPRNIGDTLTIQLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNA 123

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG + +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 124 RADVEASGGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQGTEFIRF 183

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 184 SGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|218700418|ref|YP_002408047.1| flagellar basal body L-ring protein [Escherichia coli IAI39]
 gi|226701920|sp|B7NL55|FLGH_ECO7I RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|218370404|emb|CAR18211.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli IAI39]
          Length = 232

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 52/232 (22%), Positives = 91/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I       L GC    S        +P+       +  P  G     + S  +S      
Sbjct: 11  ISSLLVLSLTGCAWIPS--------TPLVQGA--TSAQPVPGPAPVANGSIFQSAQPINY 60

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 61  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNA 120

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 121 RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 180

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 181 SGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|89072312|ref|ZP_01158891.1| flagellar L-ring protein precursor [Photobacterium sp. SKA34]
 gi|89051844|gb|EAR57296.1| flagellar L-ring protein precursor [Photobacterium sp. SKA34]
          Length = 222

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 59/225 (26%), Positives = 93/225 (41%), Gaps = 18/225 (8%)

Query: 13  SLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH-AAL 71
           S + GC      I   P            N   F   D   S    K  SL+R ++   L
Sbjct: 12  SFVSGCSVREEFIPPEP------------NDAAFAPPDLDYSLPEAKHGSLYRHNYSMTL 59

Query: 72  FKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLN 131
           F+D RA  VGD+LTV++    Q+     T   +++S+                  + + +
Sbjct: 60  FQDRRAYRVGDVLTVELDEQTQSSKKANTKFGKSSSIEFAAPTL-----GNKTFDDLSAS 114

Query: 132 YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVR 191
             G     G  + ++  KL   I   V  +L NG L+I G + +R+N     + +TG+VR
Sbjct: 115 VSGDRGFDGTAASTQGNKLQGAITVTVHKVLPNGVLMIRGEKWIRLNQGDEYIRLTGVVR 174

Query: 192 PQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
             DV+ HN VS  +I +ARI+Y G+G   +        Q   +  
Sbjct: 175 VDDVNRHNQVSSQRIGDARITYSGRGALADSNAAGWLTQFFTSPW 219


>gi|149191156|ref|ZP_01869414.1| flagellar L-ring protein precursor [Vibrio shilonii AK1]
 gi|148834994|gb|EDL51973.1| flagellar L-ring protein precursor [Vibrio shilonii AK1]
          Length = 247

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 53/234 (22%), Positives = 89/234 (38%), Gaps = 17/234 (7%)

Query: 4   YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSL 63
           Y  +V      + GC     E                 N   +   +     +     SL
Sbjct: 27  YIAVVALLVVNMIGCAGRQDEFIP-----------PSPNDEAYAPPELDYQVTRVSKGSL 75

Query: 64  WRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ 122
           +  + A  LF+D RA  VGDILTV +    ++     T   +++S               
Sbjct: 76  YTGTTAMTLFQDRRAYRVGDILTVMLDEKTESDKSASTQYGKDSSATIAAPTL-----GT 130

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
           T    G+   D      G  + ++   L+  I   V  +L NG L + G + +++N    
Sbjct: 131 TTYAEGSAAIDATRDFDGAAASTQGNSLSGSITVTVYDVLPNGVLRVRGEKWLKLNQGDE 190

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
            + +TG VR  D+ A N++S  +IA+ARI+Y G+G   +        Q   +  
Sbjct: 191 YIRLTGNVRVDDIQADNTLSSQRIADARITYAGRGTFADTNTAGWLTQFFNSPW 244


>gi|331017021|gb|EGH97077.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 237

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 54/251 (21%), Positives = 101/251 (40%), Gaps = 30/251 (11%)

Query: 1   MYR-------YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKN 53
           M R            LC  +LL GC +  +     P  +P+                   
Sbjct: 1   MNRPGFPRFSVLIASLCGITLLSGCVA-PAAKPNDPYYAPVLP--------------RTP 45

Query: 54  SDSTKKSYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL 112
             +   + ++++      L+ D +A  VGDI+T+ +     A     +  S++++    L
Sbjct: 46  MSAASNNGAIYQAGFEQNLYGDRKAFRVGDIITITLSERMAASKAATSAMSKDSTNSIGL 105

Query: 113 SGGFSLFGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
           +  F              ++ +  Y+G   + G G  +++  L   +   V  +L NG L
Sbjct: 106 TSLFGSGLTTNNPIGGNDLSLSAGYNGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGIL 165

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
            + G + + +N     + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P  
Sbjct: 166 SVRGEKWMTLNTGDELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGW 225

Query: 228 GHQLIENLSPL 238
             +    LSPL
Sbjct: 226 FDRFF--LSPL 234


>gi|209773348|gb|ACI84986.1| flagellar basal body L-ring protein FlgH [Escherichia coli]
 gi|320643091|gb|EFX12292.1| flagellar basal body L-ring protein [Escherichia coli O157:H- str.
           493-89]
 gi|320648549|gb|EFX17204.1| flagellar basal body L-ring protein [Escherichia coli O157:H- str.
           H 2687]
          Length = 232

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 52/232 (22%), Positives = 91/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I       L GC    S        +P+       +  P  G     + S  +S      
Sbjct: 11  ISSLLVLSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINY 60

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 61  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSASASRDGKTNFGFDTVPRYLQGLFGNA 120

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 121 RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 180

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 181 SGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|15801196|ref|NP_287213.1| flagellar basal body L-ring protein [Escherichia coli O157:H7
           EDL933]
 gi|15830711|ref|NP_309484.1| flagellar basal body L-ring protein [Escherichia coli O157:H7 str.
           Sakai]
 gi|16129042|ref|NP_415597.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli str. K-12 substr. MG1655]
 gi|30062615|ref|NP_836786.1| flagellar basal body L-ring protein [Shigella flexneri 2a str.
           2457T]
 gi|56479816|ref|NP_706997.2| flagellar basal body L-ring protein [Shigella flexneri 2a str. 301]
 gi|74311640|ref|YP_310059.1| flagellar basal body L-ring protein [Shigella sonnei Ss046]
 gi|89107925|ref|AP_001705.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli str. K-12 substr. W3110]
 gi|157155075|ref|YP_001462313.1| flagellar basal body L-ring protein [Escherichia coli E24377A]
 gi|157160606|ref|YP_001457924.1| flagellar basal body L-ring protein [Escherichia coli HS]
 gi|168747145|ref|ZP_02772167.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4113]
 gi|168758628|ref|ZP_02783635.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4401]
 gi|168764491|ref|ZP_02789498.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4501]
 gi|168767738|ref|ZP_02792745.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4486]
 gi|168773924|ref|ZP_02798931.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4196]
 gi|168783609|ref|ZP_02808616.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4076]
 gi|168790014|ref|ZP_02815021.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str. EC869]
 gi|168802024|ref|ZP_02827031.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str. EC508]
 gi|170080730|ref|YP_001730050.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli str. K-12 substr. DH10B]
 gi|188495438|ref|ZP_03002708.1| flagellar L-ring protein FlgH [Escherichia coli 53638]
 gi|191172379|ref|ZP_03033920.1| flagellar L-ring protein FlgH [Escherichia coli F11]
 gi|193064518|ref|ZP_03045598.1| flagellar L-ring protein FlgH [Escherichia coli E22]
 gi|193069519|ref|ZP_03050473.1| flagellar L-ring protein FlgH [Escherichia coli E110019]
 gi|194438092|ref|ZP_03070185.1| flagellar L-ring protein FlgH [Escherichia coli 101-1]
 gi|195935469|ref|ZP_03080851.1| flagellar basal body L-ring protein [Escherichia coli O157:H7 str.
           EC4024]
 gi|208807280|ref|ZP_03249617.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4206]
 gi|208816016|ref|ZP_03257195.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4045]
 gi|208822634|ref|ZP_03262953.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4042]
 gi|209398398|ref|YP_002269925.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4115]
 gi|209918333|ref|YP_002292417.1| flagellar basal body L-ring protein [Escherichia coli SE11]
 gi|217328301|ref|ZP_03444383.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           TW14588]
 gi|218553657|ref|YP_002386570.1| flagellar basal body L-ring protein [Escherichia coli IAI1]
 gi|218557961|ref|YP_002390874.1| flagellar basal body L-ring protein [Escherichia coli S88]
 gi|218689032|ref|YP_002397244.1| flagellar basal body L-ring protein [Escherichia coli ED1a]
 gi|218694613|ref|YP_002402280.1| flagellar basal body L-ring protein [Escherichia coli 55989]
 gi|218704487|ref|YP_002412006.1| flagellar basal body L-ring protein [Escherichia coli UMN026]
 gi|238900333|ref|YP_002926129.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli BW2952]
 gi|254161185|ref|YP_003044293.1| flagellar basal body L-ring protein [Escherichia coli B str.
           REL606]
 gi|254792461|ref|YP_003077298.1| flagellar basal body L-ring protein [Escherichia coli O157:H7 str.
           TW14359]
 gi|256018664|ref|ZP_05432529.1| flagellar basal body L-ring protein [Shigella sp. D9]
 gi|256023223|ref|ZP_05437088.1| flagellar basal body L-ring protein [Escherichia sp. 4_1_40B]
 gi|260843319|ref|YP_003221097.1| flagellar protein FlgH of basal-body outer-membrane L ring
           [Escherichia coli O103:H2 str. 12009]
 gi|260854562|ref|YP_003228453.1| flagellar protein FlgH of basal-body outer-membrane L ring
           [Escherichia coli O26:H11 str. 11368]
 gi|260867442|ref|YP_003233844.1| flagellar protein FlgH of basal-body outer-membrane L ring
           [Escherichia coli O111:H- str. 11128]
 gi|261227016|ref|ZP_05941297.1| flagellar L-ring protein [Escherichia coli O157:H7 str. FRIK2000]
 gi|261256250|ref|ZP_05948783.1| flagellar L-ring protein [Escherichia coli O157:H7 str. FRIK966]
 gi|291282099|ref|YP_003498917.1| Flagellar L-ring protein precursor [Escherichia coli O55:H7 str.
           CB9615]
 gi|293404363|ref|ZP_06648357.1| flagellar L-ring protein [Escherichia coli FVEC1412]
 gi|293414372|ref|ZP_06657021.1| flagellar L-ring protein FlgH [Escherichia coli B185]
 gi|293433369|ref|ZP_06661797.1| flagellar L-ring protein FlgH [Escherichia coli B088]
 gi|297516690|ref|ZP_06935076.1| flagellar basal body L-ring protein [Escherichia coli OP50]
 gi|298380143|ref|ZP_06989748.1| flagellar L-ring protein [Escherichia coli FVEC1302]
 gi|307137714|ref|ZP_07497070.1| flagellar basal body L-ring protein [Escherichia coli H736]
 gi|307310143|ref|ZP_07589793.1| flagellar L-ring protein [Escherichia coli W]
 gi|309788148|ref|ZP_07682754.1| flagellar L-ring family protein [Shigella dysenteriae 1617]
 gi|312968847|ref|ZP_07783054.1| flagellar L-ring family protein [Escherichia coli 2362-75]
 gi|312971216|ref|ZP_07785394.1| flagellar L-ring family protein [Escherichia coli 1827-70]
 gi|331657141|ref|ZP_08358103.1| flagellar L-ring protein FlgH [Escherichia coli TA206]
 gi|331667479|ref|ZP_08368343.1| flagellar L-ring protein FlgH [Escherichia coli TA271]
 gi|331682581|ref|ZP_08383200.1| flagellar L-ring protein FlgH [Escherichia coli H299]
 gi|62288091|sp|P0A6S0|FLGH_ECOLI RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|62288092|sp|P0A6S1|FLGH_ECO57 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|62288093|sp|P0A6S2|FLGH_SHIFL RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|110816543|sp|Q3Z338|FLGH_SHISS RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|166988327|sp|A7ZKI4|FLGH_ECO24 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|166988328|sp|A7ZZ37|FLGH_ECOHS RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|226701918|sp|B7MJ67|FLGH_ECO45 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|226701919|sp|B5YVU9|FLGH_ECO5E RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|226701921|sp|B7M955|FLGH_ECO8A RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|226701922|sp|B1X9J2|FLGH_ECODH RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|226701923|sp|B6I9F5|FLGH_ECOSE RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|254789281|sp|B7LG13|FLGH_ECO55 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|254789282|sp|B7MTL0|FLGH_ECO81 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|259645994|sp|C4ZS19|FLGH_ECOBW RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|12514620|gb|AAG55825.1|AE005318_2 flagellar biosynthesis, basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein [Escherichia
           coli O157:H7 str. EDL933]
 gi|1787319|gb|AAC74163.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli str. K-12 substr. MG1655]
 gi|13360921|dbj|BAB34880.1| flagellar basal body L-ring protein FlgH [Escherichia coli O157:H7
           str. Sakai]
 gi|30040861|gb|AAP16592.1| flagellar basal body L-ring protein FlgH [Shigella flexneri 2a str.
           2457T]
 gi|56383367|gb|AAN42704.2| flagellar basal body L-ring protein FlgH [Shigella flexneri 2a str.
           301]
 gi|73855117|gb|AAZ87824.1| flagellar protein for basal-body outer-membrane L ring [Shigella
           sonnei Ss046]
 gi|85674831|dbj|BAA35888.2| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli str. K12 substr. W3110]
 gi|157066286|gb|ABV05541.1| flagellar L-ring protein FlgH [Escherichia coli HS]
 gi|157077105|gb|ABV16813.1| flagellar L-ring protein FlgH [Escherichia coli E24377A]
 gi|169888565|gb|ACB02272.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli str. K-12 substr. DH10B]
 gi|187770494|gb|EDU34338.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4196]
 gi|188018204|gb|EDU56326.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4113]
 gi|188490637|gb|EDU65740.1| flagellar L-ring protein FlgH [Escherichia coli 53638]
 gi|188999115|gb|EDU68101.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4076]
 gi|189354588|gb|EDU73007.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4401]
 gi|189363176|gb|EDU81595.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4486]
 gi|189365530|gb|EDU83946.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4501]
 gi|189370490|gb|EDU88906.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str. EC869]
 gi|189375945|gb|EDU94361.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str. EC508]
 gi|190907263|gb|EDV66861.1| flagellar L-ring protein FlgH [Escherichia coli F11]
 gi|192927770|gb|EDV82384.1| flagellar L-ring protein FlgH [Escherichia coli E22]
 gi|192957267|gb|EDV87716.1| flagellar L-ring protein FlgH [Escherichia coli E110019]
 gi|194423028|gb|EDX39022.1| flagellar L-ring protein FlgH [Escherichia coli 101-1]
 gi|208727081|gb|EDZ76682.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4206]
 gi|208732664|gb|EDZ81352.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4045]
 gi|208738119|gb|EDZ85802.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4042]
 gi|209159798|gb|ACI37231.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4115]
 gi|209773350|gb|ACI84987.1| flagellar basal body L-ring protein FlgH [Escherichia coli]
 gi|209773352|gb|ACI84988.1| flagellar basal body L-ring protein FlgH [Escherichia coli]
 gi|209773354|gb|ACI84989.1| flagellar basal body L-ring protein FlgH [Escherichia coli]
 gi|209773356|gb|ACI84990.1| flagellar basal body L-ring protein FlgH [Escherichia coli]
 gi|209911592|dbj|BAG76666.1| flagellar basal-body L-ring protein FlgH [Escherichia coli SE11]
 gi|217318728|gb|EEC27154.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           TW14588]
 gi|218351345|emb|CAU97051.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli 55989]
 gi|218360425|emb|CAQ97979.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli IAI1]
 gi|218364730|emb|CAR02420.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli S88]
 gi|218426596|emb|CAR07424.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli ED1a]
 gi|218431584|emb|CAR12463.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli UMN026]
 gi|222032832|emb|CAP75571.1| flagellar L-ring protein [Escherichia coli LF82]
 gi|238861116|gb|ACR63114.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli BW2952]
 gi|242376883|emb|CAQ31600.1| flagellar L-ring protein FlgH; basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein, subunit of
           Flagellar Motor Complex and Flagellum [Escherichia coli
           BL21(DE3)]
 gi|253973086|gb|ACT38757.1| flagellar L-ring protein precursor H [Escherichia coli B str.
           REL606]
 gi|253977300|gb|ACT42970.1| flagellar L-ring protein precursor H [Escherichia coli BL21(DE3)]
 gi|254591861|gb|ACT71222.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli O157:H7 str. TW14359]
 gi|257753211|dbj|BAI24713.1| flagellar protein FlgH of basal-body outer-membrane L ring
           [Escherichia coli O26:H11 str. 11368]
 gi|257758466|dbj|BAI29963.1| flagellar protein FlgH of basal-body outer-membrane L ring
           [Escherichia coli O103:H2 str. 12009]
 gi|257763798|dbj|BAI35293.1| flagellar protein FlgH of basal-body outer-membrane L ring
           [Escherichia coli O111:H- str. 11128]
 gi|290761972|gb|ADD55933.1| Flagellar L-ring protein precursor [Escherichia coli O55:H7 str.
           CB9615]
 gi|291324188|gb|EFE63610.1| flagellar L-ring protein FlgH [Escherichia coli B088]
 gi|291428949|gb|EFF01974.1| flagellar L-ring protein [Escherichia coli FVEC1412]
 gi|291434430|gb|EFF07403.1| flagellar L-ring protein FlgH [Escherichia coli B185]
 gi|294491179|gb|ADE89935.1| flagellar L-ring protein FlgH [Escherichia coli IHE3034]
 gi|298279841|gb|EFI21349.1| flagellar L-ring protein [Escherichia coli FVEC1302]
 gi|306909861|gb|EFN40355.1| flagellar L-ring protein [Escherichia coli W]
 gi|307627451|gb|ADN71755.1| flagellar basal body L-ring protein [Escherichia coli UM146]
 gi|308924000|gb|EFP69501.1| flagellar L-ring family protein [Shigella dysenteriae 1617]
 gi|309701351|emb|CBJ00652.1| flagellar L-ring protein [Escherichia coli ETEC H10407]
 gi|310336418|gb|EFQ01604.1| flagellar L-ring family protein [Escherichia coli 1827-70]
 gi|312286249|gb|EFR14162.1| flagellar L-ring family protein [Escherichia coli 2362-75]
 gi|312945641|gb|ADR26468.1| flagellar basal body L-ring protein [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|313650469|gb|EFS14876.1| flagellar L-ring family protein [Shigella flexneri 2a str. 2457T]
 gi|315135711|dbj|BAJ42870.1| flagellar basal body L-ring protein [Escherichia coli DH1]
 gi|315618249|gb|EFU98839.1| flagellar L-ring family protein [Escherichia coli 3431]
 gi|320189762|gb|EFW64418.1| Flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC1212]
 gi|320196439|gb|EFW71062.1| Flagellar L-ring protein FlgH [Escherichia coli WV_060327]
 gi|320200975|gb|EFW75559.1| Flagellar L-ring protein FlgH [Escherichia coli EC4100B]
 gi|320637530|gb|EFX07330.1| flagellar basal body L-ring protein [Escherichia coli O157:H7 str.
           G5101]
 gi|320653863|gb|EFX21937.1| flagellar basal body L-ring protein [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320659343|gb|EFX26912.1| flagellar basal body L-ring protein [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320664478|gb|EFX31629.1| flagellar basal body L-ring protein [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323156886|gb|EFZ43020.1| flagellar L-ring family protein [Escherichia coli EPECa14]
 gi|323163704|gb|EFZ49524.1| flagellar L-ring family protein [Escherichia coli E128010]
 gi|323165589|gb|EFZ51376.1| flagellar L-ring family protein [Shigella sonnei 53G]
 gi|323175234|gb|EFZ60847.1| flagellar L-ring family protein [Escherichia coli LT-68]
 gi|323175690|gb|EFZ61284.1| flagellar L-ring family protein [Escherichia coli 1180]
 gi|323185798|gb|EFZ71159.1| flagellar L-ring family protein [Escherichia coli 1357]
 gi|323190591|gb|EFZ75863.1| flagellar L-ring family protein [Escherichia coli RN587/1]
 gi|323379082|gb|ADX51350.1| flagellar L-ring protein [Escherichia coli KO11]
 gi|323937819|gb|EGB34083.1| flagellar L-ring protein [Escherichia coli E1520]
 gi|323942548|gb|EGB38715.1| flagellar L-ring protein [Escherichia coli E482]
 gi|323947619|gb|EGB43623.1| flagellar L-ring protein [Escherichia coli H120]
 gi|323953235|gb|EGB49101.1| flagellar L-ring protein [Escherichia coli H252]
 gi|323957903|gb|EGB53615.1| flagellar L-ring protein [Escherichia coli H263]
 gi|323962678|gb|EGB58256.1| flagellar L-ring protein [Escherichia coli H489]
 gi|323967020|gb|EGB62446.1| flagellar L-ring protein [Escherichia coli M863]
 gi|323973332|gb|EGB68521.1| flagellar L-ring protein [Escherichia coli TA007]
 gi|323976548|gb|EGB71636.1| flagellar L-ring protein [Escherichia coli TW10509]
 gi|324117350|gb|EGC11257.1| flagellar L-ring protein [Escherichia coli E1167]
 gi|326339301|gb|EGD63115.1| Flagellar L-ring protein FlgH [Escherichia coli O157:H7 str. 1125]
 gi|326344738|gb|EGD68486.1| Flagellar L-ring protein FlgH [Escherichia coli O157:H7 str. 1044]
 gi|327253478|gb|EGE65116.1| flagellar L-ring family protein [Escherichia coli STEC_7v]
 gi|331055389|gb|EGI27398.1| flagellar L-ring protein FlgH [Escherichia coli TA206]
 gi|331065064|gb|EGI36959.1| flagellar L-ring protein FlgH [Escherichia coli TA271]
 gi|331080212|gb|EGI51391.1| flagellar L-ring protein FlgH [Escherichia coli H299]
 gi|332342625|gb|AEE55959.1| flagellar L-ring family protein FlgH [Escherichia coli UMNK88]
 gi|332758239|gb|EGJ88562.1| flagellar L-ring family protein [Shigella flexneri 4343-70]
 gi|332759652|gb|EGJ89957.1| flagellar L-ring family protein [Shigella flexneri 2747-71]
 gi|332761425|gb|EGJ91709.1| flagellar L-ring family protein [Shigella flexneri K-671]
 gi|332767687|gb|EGJ97880.1| flagellar L-ring protein [Shigella flexneri 2930-71]
 gi|333004889|gb|EGK24409.1| flagellar L-ring family protein [Shigella flexneri VA-6]
 gi|333005370|gb|EGK24888.1| flagellar L-ring family protein [Shigella flexneri K-218]
 gi|333019475|gb|EGK38758.1| flagellar L-ring family protein [Shigella flexneri K-304]
          Length = 232

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 52/232 (22%), Positives = 91/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I       L GC    S        +P+       +  P  G     + S  +S      
Sbjct: 11  ISSLLVLSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINY 60

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 61  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNA 120

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 121 RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 180

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 181 SGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|28869145|ref|NP_791764.1| flagellar L-ring protein FlgH [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213967578|ref|ZP_03395726.1| flagellar L-ring protein FlgH [Pseudomonas syringae pv. tomato T1]
 gi|301385717|ref|ZP_07234135.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           tomato Max13]
 gi|302060070|ref|ZP_07251611.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           tomato K40]
 gi|302134829|ref|ZP_07260819.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|31076678|sp|Q884Z5|FLGH_PSESM RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|28852385|gb|AAO55459.1| flagellar L-ring protein FlgH [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213927879|gb|EEB61426.1| flagellar L-ring protein FlgH [Pseudomonas syringae pv. tomato T1]
          Length = 237

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 54/251 (21%), Positives = 102/251 (40%), Gaps = 30/251 (11%)

Query: 1   MYR-------YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKN 53
           M R            LC  +LL GC +  ++    P  +P+                   
Sbjct: 1   MNRPGFPRFSVLIASLCGITLLSGCVAPTAK-PNDPYYAPVLP--------------RTP 45

Query: 54  SDSTKKSYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL 112
             +   + ++++      L+ D +A  VGDI+T+ +     A     +  S++++    L
Sbjct: 46  MSAASNNGAIYQAGFEQNLYGDRKAFRVGDIITITLSERMAASKAATSAMSKDSTNSIGL 105

Query: 113 SGGFSLFGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
           +  F              ++ +  Y+G   + G G  +++  L   +   V  +L NG L
Sbjct: 106 TSLFGSGLTTNNPIGGNDLSLSAGYNGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGIL 165

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
            + G + + +N     + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P  
Sbjct: 166 SVRGEKWMTLNTGDELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGW 225

Query: 228 GHQLIENLSPL 238
             +    LSPL
Sbjct: 226 FDRFF--LSPL 234


>gi|330972417|gb|EGH72483.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 237

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 55/251 (21%), Positives = 102/251 (40%), Gaps = 30/251 (11%)

Query: 1   MYRY-------SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKN 53
           M R            LC  +LL GC +  ++    P  +P+                   
Sbjct: 1   MNRLSVPRFSVLIASLCGITLLSGCVAPTAK-PNDPYYAPVLP--------------RTP 45

Query: 54  SDSTKKSYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL 112
             +   + ++++      L+ D +A  +GDI+T+ +     A     +  S+N++    L
Sbjct: 46  MSAAANNGAIYQAGFEQNLYGDRKAFRIGDIITITLSERMAASKAATSAMSKNSTNSIGL 105

Query: 113 SGGFSLFGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
           +  F              ++ N  Y G   ++G G  +++  L   +   V  +L NG L
Sbjct: 106 TSLFGSGLTTNNPIGGNDLSLNAGYTGARTTNGDGKAAQSNSLTGSVTVTVADVLPNGIL 165

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
            + G + + +N     + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P  
Sbjct: 166 AVRGEKWMTLNTGDELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGW 225

Query: 228 GHQLIENLSPL 238
             +    LSPL
Sbjct: 226 FDRFF--LSPL 234


>gi|326628162|gb|EGE34505.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 235

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 53/242 (21%), Positives = 96/242 (39%), Gaps = 14/242 (5%)

Query: 1   MYRYSF----IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDS 56
           M +Y+     ++    + L GC    ++        P+          P  G     + S
Sbjct: 4   MQKYALHAYPVMALMVATLTGCAWIPAK--------PLVQGA--TTAQPIPGPVPVANGS 53

Query: 57  TKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
             +S       +  LF+D R  N+GD LT+ ++ +  A   +    SR+           
Sbjct: 54  IFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVP 113

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                       ++   GG + +GKG  + +   +  +   V  +L NGNL + G +++ 
Sbjct: 114 RYLQGLFGNSRADMEASGGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIA 173

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N     +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLS
Sbjct: 174 INQGTEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYLNEAQNMGWLQRFFLNLS 233

Query: 237 PL 238
           P+
Sbjct: 234 PM 235


>gi|238785494|ref|ZP_04629477.1| Flagellar L-ring protein [Yersinia bercovieri ATCC 43970]
 gi|238713596|gb|EEQ05625.1| Flagellar L-ring protein [Yersinia bercovieri ATCC 43970]
          Length = 237

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 53/229 (23%), Positives = 91/229 (39%), Gaps = 12/229 (5%)

Query: 10  CYSSLLFGCHSSISEITGIPQMSPMGSSLD-ENNRMPFLGIDFKNSDSTKKSYSLWRDSH 68
             + LL GC              P  S +D   +  P        + S  ++       +
Sbjct: 19  LTAMLLNGCA-----------YIPHKSLVDGTTSAQPAPASAPLPNGSIFQAAQPMNYGY 67

Query: 69  AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
             LF+D R  NVGD LT+ ++ +  A   +    SRN S    ++               
Sbjct: 68  QPLFEDRRPRNVGDTLTITLQENVSASKSSSANASRNGSSKFGVATAPRYLEGLLGNARA 127

Query: 129 NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
           +++  G     GKG  +     +  I   V  +L NGNL + G +++ +N     +  +G
Sbjct: 128 DMDISGDNTFGGKGGANANNTFSGTITVTVDRVLANGNLHVVGEKQIAINQGTEFIRFSG 187

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 188 VVNPRTISGSNTVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNISP 236


>gi|170681726|ref|YP_001744101.1| flagellar basal body L-ring protein [Escherichia coli SMS-3-5]
 gi|331662485|ref|ZP_08363408.1| flagellar L-ring protein FlgH [Escherichia coli TA143]
 gi|170519444|gb|ACB17622.1| flagellar L-ring protein FlgH [Escherichia coli SMS-3-5]
 gi|331060907|gb|EGI32871.1| flagellar L-ring protein FlgH [Escherichia coli TA143]
          Length = 232

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 52/232 (22%), Positives = 91/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I       L GC    S        +P+       +  P  G     + S  +S      
Sbjct: 11  ISSLLVLSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINY 60

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 61  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKSNFGFDTVPRYLQGLFGNA 120

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 121 RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 180

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 181 SGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|91210231|ref|YP_540217.1| flagellar basal body L-ring protein [Escherichia coli UTI89]
 gi|91071805|gb|ABE06686.1| flagellar basal body L-ring protein precursor [Escherichia coli
           UTI89]
          Length = 237

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 52/232 (22%), Positives = 91/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I       L GC    S        +P+       +  P  G     + S  +S      
Sbjct: 16  ISSLLVLSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINY 65

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 66  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNA 125

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 126 RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 185

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 186 SGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 237


>gi|62179697|ref|YP_216114.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|200389737|ref|ZP_03216348.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205357317|ref|ZP_02346782.2| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|62127330|gb|AAX65033.1| flagellar biosynthesis, basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|199602182|gb|EDZ00728.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205322411|gb|EDZ10250.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|320086380|emb|CBY96153.1| Flagellar L-ring protein 2 Basal body L-ring protein 2; Flags:
           Precursor [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|322714167|gb|EFZ05738.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323129450|gb|ADX16880.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323252628|gb|EGA36466.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
          Length = 235

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 53/242 (21%), Positives = 96/242 (39%), Gaps = 14/242 (5%)

Query: 1   MYRYSF----IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDS 56
           M +Y+     ++    + L GC    ++        P+          P  G     + S
Sbjct: 4   MQKYALHAYPVMALMVATLTGCAWIPAK--------PLVQGA--TTAQPIPGPVPVANGS 53

Query: 57  TKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
             +S       +  LF+D R  N+GD LT+ ++ +  A   +    SR+           
Sbjct: 54  IFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVP 113

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                       ++   GG + +GKG  + +   +  +   V  +L NGNL + G +++ 
Sbjct: 114 RYLQGLFGNSRADMEASGGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIA 173

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N     +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLS
Sbjct: 174 INQGTEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLS 233

Query: 237 PL 238
           P+
Sbjct: 234 PM 235


>gi|331646337|ref|ZP_08347440.1| flagellar L-ring protein FlgH [Escherichia coli M605]
 gi|331045089|gb|EGI17216.1| flagellar L-ring protein FlgH [Escherichia coli M605]
          Length = 235

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 52/232 (22%), Positives = 92/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I    +  L GC    S        +P+       +  P  G     + S  +S      
Sbjct: 14  ISSLLALSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINY 63

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 64  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNA 123

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 124 RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 183

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 184 SGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|288549492|ref|ZP_05967237.2| flagellar L-ring protein FlgH [Enterobacter cancerogenus ATCC
           35316]
 gi|288318180|gb|EFC57118.1| flagellar L-ring protein FlgH [Enterobacter cancerogenus ATCC
           35316]
          Length = 235

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 51/232 (21%), Positives = 92/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I+   +  L GC    S+        P+          P  G     + S  ++      
Sbjct: 14  ILTVLAVTLSGCAWIPSK--------PLVQGA--TTAQPVPGPAPIVNGSIFQTAQPINY 63

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 64  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNA 123

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 124 RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 183

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 184 SGVVNPRTISGTNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|23092318|gb|AAN08643.1| FlgH [Aeromonas hydrophila]
          Length = 223

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 53/240 (22%), Positives = 100/240 (41%), Gaps = 20/240 (8%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEI-TGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
            +  +++   +  L GC S+ +      P+ SP+    +  +  P              +
Sbjct: 1   MKAIWMLGLLA--LGGCSSTPNTAKPDDPEFSPVYGESEPVSVRP--------------T 44

Query: 61  YSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            ++++      ++ D  A  VGDI+T+++     A     T  +++N L         + 
Sbjct: 45  GAIFQPDQVNCIYSDINAHRVGDIITIELAESTSASKKANTTAAQDNKLSLDQVSLGGVP 104

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
               P  + + +     A  G+    ++  L   I+  V  +L NGNLI+ G + + +N+
Sbjct: 105 VTAGP-YDLSASLGQNSAFKGQAKADQSNSLQGNISVSVAKVLPNGNLIVRGEKWIMLNN 163

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSPL 238
               + +TG++RP+DV + NSVS  ++A ARI YGG G                    PL
Sbjct: 164 GNEYIRITGMIRPEDVTSENSVSSQRVANARIHYGGTGDLANSQEHGWLTSFFNGPWWPL 223


>gi|282599764|ref|ZP_05971783.2| flagellar L-ring protein FlgH [Providencia rustigianii DSM 4541]
 gi|282567731|gb|EFB73266.1| flagellar L-ring protein FlgH [Providencia rustigianii DSM 4541]
          Length = 254

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 52/233 (22%), Positives = 92/233 (39%), Gaps = 10/233 (4%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
             + L    ++ GC            + P      +    P        + +  +S    
Sbjct: 31  RVVCLAAIVIISGCA----------HIKPRPLVDSQTTATPTAPTAPAPNGAIFQSAQPA 80

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP 124
              +  LF+D R  NVGDILT++++ +  A  ++    +R+       +           
Sbjct: 81  YYGYQPLFEDRRPRNVGDILTINLQENVSASKNSSANANRSGKTGFLAAILPGFMQGWLG 140

Query: 125 QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
             N  ++  G    +GKG  +        I   V  +L NGNL + G + + +N    S+
Sbjct: 141 GSNTEIDVKGNSDFTGKGGANANNTFKGTITVTVDQLLANGNLHVVGEKRIAINQGTESI 200

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
             +G+V P+ + A N+VS  ++A+ARI Y G G   E        +   N+SP
Sbjct: 201 RFSGVVNPRTIGADNNVSSTQVADARIEYVGDGYINESQTMGWLQRFFLNVSP 253


>gi|191168479|ref|ZP_03030267.1| flagellar L-ring protein FlgH [Escherichia coli B7A]
 gi|190901498|gb|EDV61259.1| flagellar L-ring protein FlgH [Escherichia coli B7A]
          Length = 232

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 53/232 (22%), Positives = 91/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I       L GC    S        +P+       +  P  G     + S  +S      
Sbjct: 11  ISSLLVLSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINY 60

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 61  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNA 120

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   N  +   V  +L NGNL + G +++ +N     +  
Sbjct: 121 RADVEASGGNTFNGKGGANASNTFNGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 180

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 181 SGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|332088745|gb|EGI93857.1| flagellar L-ring family protein [Shigella boydii 5216-82]
          Length = 232

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 52/232 (22%), Positives = 91/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I       L GC    S        +P+       +  P  G     + S  +S      
Sbjct: 11  ISSLLVLSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINY 60

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 61  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNT 120

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 121 RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 180

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 181 SGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|283850809|ref|ZP_06368095.1| flagellar L-ring protein [Desulfovibrio sp. FW1012B]
 gi|283573732|gb|EFC21706.1| flagellar L-ring protein [Desulfovibrio sp. FW1012B]
          Length = 241

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 53/255 (20%), Positives = 104/255 (40%), Gaps = 33/255 (12%)

Query: 1   MYR-YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R   F+++     L  C  +  +   +PQ++P  +        P              
Sbjct: 1   MKRNTLFLLVLAGCSLAACAPASKKAAPMPQVTPTVAKAPPPAENP-------------- 46

Query: 60  SYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS----- 113
             S++  +    LF D+RA  +GDILT++I    ++    +T   +  S    +      
Sbjct: 47  -GSVFSQNQPTFLFDDTRARRIGDILTINIVDTSKSDLKAETKNDKTASNVLGVGSYFGN 105

Query: 114 -----------GGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAIL 162
                      GG +   +     +  ++ +       KG   R   +   I   +  IL
Sbjct: 106 KDLAGNLSGQLGGPNFGMKGLVGSDPMVSTNTAEKFQSKGETKRESAVTAAIGCRIVNIL 165

Query: 163 ENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTEL 222
             G + + G+++ RVN+E + + V G+VRP DV   N+V   ++A+ +I Y G+G   + 
Sbjct: 166 PGGVMQVEGARQTRVNNENQIIVVRGLVRPIDVGPDNTVPSTQLADCQIEYYGEGDLADR 225

Query: 223 LRPPIGHQLIENLSP 237
            +     ++++N+ P
Sbjct: 226 QKSGWLTRILDNVWP 240


>gi|205353082|ref|YP_002226883.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|226701931|sp|B5RBC1|FLGH_SALG2 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|205272863|emb|CAR37792.1| Flagellar L-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
          Length = 232

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 53/242 (21%), Positives = 96/242 (39%), Gaps = 14/242 (5%)

Query: 1   MYRYSF----IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDS 56
           M +Y+     ++    + L GC    ++        P+          P  G     + S
Sbjct: 1   MQKYALHAYPVMALMVATLTGCAWIPAK--------PLVQGA--TTAQPIPGPVPVANGS 50

Query: 57  TKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
             +S       +  LF+D R  N+GD LT+ ++ +  A   +    SR+           
Sbjct: 51  IFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVP 110

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                       ++   GG + +GKG  + +   +  +   V  +L NGNL + G +++ 
Sbjct: 111 RYLQGLFGNSRADMEASGGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIA 170

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N     +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLS
Sbjct: 171 INQGTEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYLNEAQNMGWLQRFFLNLS 230

Query: 237 PL 238
           P+
Sbjct: 231 PM 232


>gi|110641255|ref|YP_668985.1| flagellar basal body L-ring protein [Escherichia coli 536]
 gi|110805096|ref|YP_688616.1| flagellar basal body L-ring protein [Shigella flexneri 5 str. 8401]
 gi|117623265|ref|YP_852178.1| flagellar basal body L-ring protein [Escherichia coli APEC O1]
 gi|170020525|ref|YP_001725479.1| flagellar basal body L-ring protein [Escherichia coli ATCC 8739]
 gi|237706935|ref|ZP_04537416.1| flagellar basal body L-ring protein [Escherichia sp. 3_2_53FAA]
 gi|253773897|ref|YP_003036728.1| flagellar basal body L-ring protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|300821140|ref|ZP_07101289.1| flagellar L-ring protein FlgH [Escherichia coli MS 119-7]
 gi|300899598|ref|ZP_07117837.1| flagellar L-ring protein FlgH [Escherichia coli MS 198-1]
 gi|300902470|ref|ZP_07120452.1| flagellar L-ring protein FlgH [Escherichia coli MS 84-1]
 gi|300918681|ref|ZP_07135262.1| flagellar L-ring protein FlgH [Escherichia coli MS 115-1]
 gi|300922605|ref|ZP_07138705.1| flagellar L-ring protein FlgH [Escherichia coli MS 182-1]
 gi|300928369|ref|ZP_07143903.1| flagellar L-ring protein FlgH [Escherichia coli MS 187-1]
 gi|300950174|ref|ZP_07164119.1| flagellar L-ring protein FlgH [Escherichia coli MS 116-1]
 gi|300954381|ref|ZP_07166835.1| flagellar L-ring protein FlgH [Escherichia coli MS 175-1]
 gi|301023266|ref|ZP_07187063.1| flagellar L-ring protein FlgH [Escherichia coli MS 69-1]
 gi|301304982|ref|ZP_07211084.1| flagellar L-ring protein FlgH [Escherichia coli MS 124-1]
 gi|301328551|ref|ZP_07221612.1| flagellar L-ring protein FlgH [Escherichia coli MS 78-1]
 gi|301644991|ref|ZP_07244957.1| flagellar L-ring protein FlgH [Escherichia coli MS 146-1]
 gi|331641623|ref|ZP_08342758.1| flagellar L-ring protein FlgH [Escherichia coli H736]
 gi|331652132|ref|ZP_08353151.1| flagellar L-ring protein FlgH [Escherichia coli M718]
 gi|331676870|ref|ZP_08377566.1| flagellar L-ring protein FlgH [Escherichia coli H591]
 gi|332279733|ref|ZP_08392146.1| flagellar basal body L-ring protein [Shigella sp. D9]
 gi|110342847|gb|ABG69084.1| flagellar L-ring protein precursor [Escherichia coli 536]
 gi|110614644|gb|ABF03311.1| flagellar L-ring protein precursor FlgH [Shigella flexneri 5 str.
           8401]
 gi|115512389|gb|ABJ00464.1| flagellar basal body L-ring protein precursor [Escherichia coli
           APEC O1]
 gi|169755453|gb|ACA78152.1| flagellar L-ring protein [Escherichia coli ATCC 8739]
 gi|226898145|gb|EEH84404.1| flagellar basal body L-ring protein [Escherichia sp. 3_2_53FAA]
 gi|253324941|gb|ACT29543.1| flagellar L-ring protein [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|260449781|gb|ACX40203.1| flagellar L-ring protein [Escherichia coli DH1]
 gi|281600497|gb|ADA73481.1| Flagellar L-ring protein precursor [Shigella flexneri 2002017]
 gi|300318617|gb|EFJ68401.1| flagellar L-ring protein FlgH [Escherichia coli MS 175-1]
 gi|300356869|gb|EFJ72739.1| flagellar L-ring protein FlgH [Escherichia coli MS 198-1]
 gi|300397111|gb|EFJ80649.1| flagellar L-ring protein FlgH [Escherichia coli MS 69-1]
 gi|300405502|gb|EFJ89040.1| flagellar L-ring protein FlgH [Escherichia coli MS 84-1]
 gi|300414175|gb|EFJ97485.1| flagellar L-ring protein FlgH [Escherichia coli MS 115-1]
 gi|300421082|gb|EFK04393.1| flagellar L-ring protein FlgH [Escherichia coli MS 182-1]
 gi|300450521|gb|EFK14141.1| flagellar L-ring protein FlgH [Escherichia coli MS 116-1]
 gi|300463627|gb|EFK27120.1| flagellar L-ring protein FlgH [Escherichia coli MS 187-1]
 gi|300526439|gb|EFK47508.1| flagellar L-ring protein FlgH [Escherichia coli MS 119-7]
 gi|300839700|gb|EFK67460.1| flagellar L-ring protein FlgH [Escherichia coli MS 124-1]
 gi|300844943|gb|EFK72703.1| flagellar L-ring protein FlgH [Escherichia coli MS 78-1]
 gi|301076720|gb|EFK91526.1| flagellar L-ring protein FlgH [Escherichia coli MS 146-1]
 gi|315060357|gb|ADT74684.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli W]
 gi|315253880|gb|EFU33848.1| flagellar L-ring protein FlgH [Escherichia coli MS 85-1]
 gi|315296710|gb|EFU56005.1| flagellar L-ring protein FlgH [Escherichia coli MS 16-3]
 gi|324007919|gb|EGB77138.1| flagellar L-ring protein FlgH [Escherichia coli MS 57-2]
 gi|324017417|gb|EGB86636.1| flagellar L-ring protein FlgH [Escherichia coli MS 117-3]
 gi|331038421|gb|EGI10641.1| flagellar L-ring protein FlgH [Escherichia coli H736]
 gi|331050410|gb|EGI22468.1| flagellar L-ring protein FlgH [Escherichia coli M718]
 gi|331075559|gb|EGI46857.1| flagellar L-ring protein FlgH [Escherichia coli H591]
 gi|332102085|gb|EGJ05431.1| flagellar basal body L-ring protein [Shigella sp. D9]
          Length = 235

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 52/232 (22%), Positives = 91/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I       L GC    S        +P+       +  P  G     + S  +S      
Sbjct: 14  ISSLLVLSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINY 63

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 64  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNA 123

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 124 RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 183

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 184 SGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|300938644|ref|ZP_07153373.1| flagellar L-ring protein FlgH [Escherichia coli MS 21-1]
 gi|300456429|gb|EFK19922.1| flagellar L-ring protein FlgH [Escherichia coli MS 21-1]
          Length = 235

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 52/232 (22%), Positives = 91/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I       L GC    S        +P+       +  P  G     + S  +S      
Sbjct: 14  ISSLLVLSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINY 63

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 64  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKSNFGFDTVPRYLQGLFGNA 123

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 124 RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 183

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 184 SGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|16760056|ref|NP_455673.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|16764536|ref|NP_460151.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|29142173|ref|NP_805515.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56413833|ref|YP_150908.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197362756|ref|YP_002142393.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|207857312|ref|YP_002243963.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|213051797|ref|ZP_03344675.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213582040|ref|ZP_03363866.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213865502|ref|ZP_03387621.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|238911000|ref|ZP_04654837.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|61224052|sp|P0A1N8|FLGH_SALTY RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|61224053|sp|P0A1N9|FLGH_SALTI RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|81360360|sp|Q5PGU6|FLGH_SALPA RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|88911319|sp|Q57QH8|FLGH_SALCH RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|226701930|sp|B5QXY5|FLGH_SALEP RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|226701932|sp|B5BBA9|FLGH_SALPK RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|25373428|pir||AE0640 flagellar L-ring protein precursor [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|153973|gb|AAA27068.1| flgH flagellar L-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Typhimurium]
 gi|16419697|gb|AAL20110.1| flagellar biosynthesis protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|16502350|emb|CAD08304.1| flagellar L-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29137803|gb|AAO69364.1| flagellar L-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56128090|gb|AAV77596.1| flagellar L-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197094233|emb|CAR59738.1| flagellar L-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|206709115|emb|CAR33448.1| flagellar L-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|261246391|emb|CBG24200.1| Basal body L-ring protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267992954|gb|ACY87839.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301157721|emb|CBW17213.1| Flagellar L-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312912167|dbj|BAJ36141.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|322616550|gb|EFY13459.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322620509|gb|EFY17373.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322622503|gb|EFY19348.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629654|gb|EFY26429.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322632626|gb|EFY29372.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322636879|gb|EFY33582.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322641583|gb|EFY38221.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322644073|gb|EFY40619.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322650027|gb|EFY46445.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322653952|gb|EFY50275.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322658484|gb|EFY54746.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322663342|gb|EFY59544.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322670076|gb|EFY66216.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674860|gb|EFY70951.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322676670|gb|EFY72737.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322682592|gb|EFY78611.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322686655|gb|EFY82634.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323195769|gb|EFZ80945.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323198339|gb|EFZ83443.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323204839|gb|EFZ89833.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323209180|gb|EFZ94117.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323217860|gb|EGA02575.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323222148|gb|EGA06532.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323224920|gb|EGA09178.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323229662|gb|EGA13785.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323232887|gb|EGA16983.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323240622|gb|EGA24664.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323242936|gb|EGA26957.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323250253|gb|EGA34142.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323258844|gb|EGA42497.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323261033|gb|EGA44626.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266942|gb|EGA50427.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323269983|gb|EGA53432.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326623705|gb|EGE30050.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|332988071|gb|AEF07054.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 232

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 53/242 (21%), Positives = 96/242 (39%), Gaps = 14/242 (5%)

Query: 1   MYRYSF----IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDS 56
           M +Y+     ++    + L GC    ++        P+          P  G     + S
Sbjct: 1   MQKYALHAYPVMALMVATLTGCAWIPAK--------PLVQGA--TTAQPIPGPVPVANGS 50

Query: 57  TKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
             +S       +  LF+D R  N+GD LT+ ++ +  A   +    SR+           
Sbjct: 51  IFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVP 110

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                       ++   GG + +GKG  + +   +  +   V  +L NGNL + G +++ 
Sbjct: 111 RYLQGLFGNSRADMEASGGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIA 170

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N     +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLS
Sbjct: 171 INQGTEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLS 230

Query: 237 PL 238
           P+
Sbjct: 231 PM 232


>gi|162219162|ref|YP_746586.2| flagellar basal body L-ring protein [Nitrosomonas eutropha C91]
          Length = 246

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 48/239 (20%), Positives = 96/239 (40%), Gaps = 23/239 (9%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           +++   S++ GC               +  +      M     +      ++ +  +++ 
Sbjct: 22  VLIVMVSMVTGCS-------------MITPAPKVQQPMTIRPPEPLIIPVSQSNGGIYQA 68

Query: 67  S--------HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           +        +  LF+D RA  +GD + V +     A   + +   R+  +   +     L
Sbjct: 69  AFNYQGSGRYTPLFEDRRARGIGDTIIVMLNEKTNASKKSGSNAQRDGGIDLSVPSFLGL 128

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
             +   Q + +L         GKG  S        I   V  IL NGNL++SG +++ +N
Sbjct: 129 PFKSIFQ-DLDLEAKSSNKFDGKGESSSNNNFTGTITVTVIDILPNGNLLVSGEKQIGIN 187

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
                + ++G++ P +V  +N+VS  ++A+ARI Y G G   E        +   ++SP
Sbjct: 188 QGHEFIRLSGVINPINVM-NNTVSSVQVADARIEYRGTGYLDEAQTMGWLSRFFLSISP 245


>gi|237799212|ref|ZP_04587673.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331022067|gb|EGI02124.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 237

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 55/251 (21%), Positives = 102/251 (40%), Gaps = 30/251 (11%)

Query: 1   MYRY-------SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKN 53
           M R            LC  +LL GC +  ++    P  +P+                   
Sbjct: 1   MNRLSVPRLSVLIASLCGITLLSGCVAPTAK-PNDPYYAPVLP--------------RTP 45

Query: 54  SDSTKKSYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL 112
             +   + ++++      L+ D +A  VGDI+T+ +     A     +  S+N++    L
Sbjct: 46  MSAASNNGAIYQAGFEQNLYGDRKAFRVGDIITITLSERMAASKAATSAMSKNSNNSIGL 105

Query: 113 SGGFSLFGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
           +  F              ++ N  Y+G   + G G  +++  L   +   V  +L NG L
Sbjct: 106 TSLFGSGLTTNNPIGGNDLSLNAGYNGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGIL 165

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
            + G + + +N     + + G++R  D+   N+VS  +IA+ARI+Y G G   +  +P  
Sbjct: 166 SVRGEKWMTLNTGDELVRIAGLIRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGW 225

Query: 228 GHQLIENLSPL 238
             +    LSPL
Sbjct: 226 FDRFF--LSPL 234


>gi|254230137|ref|ZP_04923532.1| flagellar L-ring protein FlgH [Vibrio sp. Ex25]
 gi|262394936|ref|YP_003286790.1| flagellar L-ring protein FlgH [Vibrio sp. Ex25]
 gi|151937330|gb|EDN56193.1| flagellar L-ring protein FlgH [Vibrio sp. Ex25]
 gi|262338530|gb|ACY52325.1| flagellar L-ring protein FlgH [Vibrio sp. Ex25]
          Length = 259

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 47/259 (18%), Positives = 93/259 (35%), Gaps = 27/259 (10%)

Query: 1   MYRYSFIVLCYSSLLFGCH------------------------SSISEITGIPQMSPMGS 36
           M R   + L  +  + GC                         S       +  +     
Sbjct: 1   MKRICLLALIAT--MSGCAMLEPIETDEVTQATTVVDAVEGDKSKEESSGIVDTLRGRSD 58

Query: 37  SLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAV 95
            +  +     +    K       + SL+   H   L+ DS+   +GDI+TV +     A 
Sbjct: 59  PVAGDPAWAPIHPKKKPEHYAAATGSLFSAEHITDLYDDSKPRGIGDIITVTLDETTSAT 118

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
                  S+ N              Q   + N + + +   + +G  S  ++  ++  I 
Sbjct: 119 KSANADLSKTNEAQMDPLQVGGEELQIGGKYNFSYDLNNSNSFAGDSSAKQSNSISGYIT 178

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             V  +L NGNL+I G + + +N     + ++G +RP D+   N+++ ++++ ARI Y G
Sbjct: 179 VEVIEVLANGNLVIRGEKWMTLNTGDEYIRLSGTIRPDDISFDNTIASNRVSNARIQYSG 238

Query: 216 KGRTTELLRPPIGHQLIEN 234
            G   ++  P    +    
Sbjct: 239 TGVQQDMQEPGFLARFFNV 257


>gi|309798073|ref|ZP_07692448.1| flagellar L-ring protein FlgH [Escherichia coli MS 145-7]
 gi|308118356|gb|EFO55618.1| flagellar L-ring protein FlgH [Escherichia coli MS 145-7]
          Length = 235

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 53/232 (22%), Positives = 91/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I       L GC    S        +P+       +  P  G     + S  +S      
Sbjct: 14  ISSLLVLSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINY 63

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 64  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNA 123

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   N  +   V  +L NGNL + G +++ +N     +  
Sbjct: 124 RADVEASGGNTFNGKGGANASNTFNGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 183

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 184 SGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|292487942|ref|YP_003530817.1| flagellar L-ring protein [Erwinia amylovora CFBP1430]
 gi|292899161|ref|YP_003538530.1| flagellar L-ring protein [Erwinia amylovora ATCC 49946]
 gi|291199009|emb|CBJ46120.1| flagellar L-ring protein [Erwinia amylovora ATCC 49946]
 gi|291553364|emb|CBA20409.1| Flagellar L-ring protein precursor [Erwinia amylovora CFBP1430]
 gi|312172063|emb|CBX80320.1| Flagellar L-ring protein precursor [Erwinia amylovora ATCC
           BAA-2158]
          Length = 233

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 53/235 (22%), Positives = 88/235 (37%), Gaps = 12/235 (5%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLD-ENNRMPFLGIDFKNSDSTKKSYSL 63
            ++V      L GC            + P    ++      P        + S  +    
Sbjct: 10  RWLVATLLLTLNGCA-----------LVPRKPLVEGSTTAQPLPASPAMVNGSIFQGVMP 58

Query: 64  WRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT 123
               +  LF+D R  N+GD LT+ ++ +  A   +     R+ S    L+          
Sbjct: 59  MNYGYQPLFEDRRPRNIGDTLTITLQENVSASKSSSANAGRDGSAEFGLTATPRALVGLL 118

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
                NL   G     GKG  +        I   V  +L NGNL + G +++ +N     
Sbjct: 119 GGDKANLGGSGKNDFEGKGGATAKNTFTGTITVTVNQVLPNGNLNVVGEKQIEINQGTEF 178

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +  +G+V P+ + A NSV   ++A+ARI Y G G   E        +   N+SP+
Sbjct: 179 IRFSGVVNPRTISASNSVVSSQVADARIEYVGNGYINEAQTMGWLQRFFLNISPM 233


>gi|308050369|ref|YP_003913935.1| flagellar L-ring protein [Ferrimonas balearica DSM 9799]
 gi|307632559|gb|ADN76861.1| flagellar L-ring protein [Ferrimonas balearica DSM 9799]
          Length = 228

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 52/222 (23%), Positives = 91/222 (40%), Gaps = 17/222 (7%)

Query: 18  CHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA-LFKDSR 76
           C    S I   P  +P+   L                     + S++ D +A  L+ D +
Sbjct: 21  CVHPNSPIPDDPYYAPVYPDL--------------PPSQVVTTGSIFNDGYANELYSDIK 66

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGG 136
           AL VGD++TV +    +A        +++N +                    +L+Y    
Sbjct: 67  ALKVGDVITVMLSEQTKAKKSASNEITKDNKMQLD-PISAGGGPITVNGQTIDLSYKEKF 125

Query: 137 ASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVD 196
             S +    ++  L   I+  V  +L NGNL+I G + + +ND    + +TGIVRP+D+ 
Sbjct: 126 DMSRESDADQSNSLAGSISVNVLQVLANGNLVIRGEKWITINDGDEFIRITGIVRPRDIS 185

Query: 197 AHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
            +N++   ++A ARI Y G G   +  +     +     L P
Sbjct: 186 PNNTIESTRVANARIQYSGTGTFADSQKSGWLSKFFSGPLWP 227


>gi|215486288|ref|YP_002328719.1| flagellar basal body L-ring protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|31076692|sp|Q8CW55|FLGH_ECOL6 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|254789280|sp|B7UP93|FLGH_ECO27 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|215264360|emb|CAS08717.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli O127:H6 str. E2348/69]
 gi|307553081|gb|ADN45856.1| flagellar L-ring protein FlgH [Escherichia coli ABU 83972]
          Length = 232

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 52/232 (22%), Positives = 91/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I       L GC    S        +P+       +  P  G     + S  +S      
Sbjct: 11  ISSLLVLSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINY 60

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 61  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGVFGNA 120

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 121 RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 180

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 181 SGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|21242724|ref|NP_642306.1| flagellar basal body L-ring protein [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|31076714|sp|Q8PL26|FLGH_XANAC RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|21108200|gb|AAM36842.1| flagellar L-ring protein [Xanthomonas axonopodis pv. citri str.
           306]
          Length = 230

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 53/233 (22%), Positives = 101/233 (43%), Gaps = 17/233 (7%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           + +  S+LL GC ++  ++    +M+P+   +                 +   + +++  
Sbjct: 12  LAIACSALLGGCVAAG-DVRPFAEMAPIVPVV--------------APVAQPTAGAIYAA 56

Query: 67  SHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
                L+ D RA +VGD+LTV++     A     T  S+ ++                  
Sbjct: 57  GPGLNLYGDRRARDVGDLLTVNLVESTTASSTANTSISKKDATTMAAPTLLGAPLTVGGL 116

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
                +  G  + +GKG+ +++ ++   +   V   L NGNL+I G + +R+      + 
Sbjct: 117 NVLENSTSGDRSFAGKGNTAQSNRMQGSVTVTVMQRLPNGNLVIQGQKNLRLTQGDELVQ 176

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
           V GIVR  D+   N+V   K+A+ARI+YGG+G   +        +   + LSP
Sbjct: 177 VQGIVRAADIAPDNTVPSSKVADARIAYGGRGAIAQSNAMGWLSRFFNSRLSP 229


>gi|330447906|ref|ZP_08311554.1| flagellar L-ring protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328492097|dbj|GAA06051.1| flagellar L-ring protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 222

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 58/222 (26%), Positives = 91/222 (40%), Gaps = 18/222 (8%)

Query: 16  FGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH-AALFKD 74
            GC      I   P            N   F   D   S    K  SL+R ++   LF+D
Sbjct: 15  SGCAVREEFIPPEP------------NDAAFAPPDLDYSLPEAKHGSLYRHNYSMTLFQD 62

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
            RA  VGD+LTV +    Q+     T   +++S+   +              + + +  G
Sbjct: 63  RRAYRVGDVLTVLLNEQTQSSKKANTKFGKSSSIDFAVPTL-----GNKAFDDLSASVSG 117

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
                G  + ++  KL   I   V  +L NG L+I G + +R+N     + +TG+VR  D
Sbjct: 118 DRGFDGAAASTQGNKLQGAITVTVHKVLPNGVLMIRGEKWIRLNQGDEYIRLTGVVRVDD 177

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           V+ HN VS  +I +ARI+Y G+G   +        Q   +  
Sbjct: 178 VNRHNQVSSQRIGDARITYSGRGALADSNAAGWLTQFFTSPW 219


>gi|26247219|ref|NP_753259.1| flagellar basal body L-ring protein [Escherichia coli CFT073]
 gi|26107620|gb|AAN79819.1|AE016759_93 Flagellar L-ring protein precursor [Escherichia coli CFT073]
          Length = 237

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 52/232 (22%), Positives = 91/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I       L GC    S        +P+       +  P  G     + S  +S      
Sbjct: 16  ISSLLVLSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINY 65

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 66  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGVFGNA 125

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 126 RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 185

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 186 SGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 237


>gi|82777308|ref|YP_403657.1| flagellar basal body L-ring protein [Shigella dysenteriae Sd197]
 gi|110816542|sp|Q32ET9|FLGH_SHIDS RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|81241456|gb|ABB62166.1| basal-body outer-membrane L ring protein [Shigella dysenteriae
           Sd197]
          Length = 232

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 53/232 (22%), Positives = 92/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I       L GC    S        +P+       +  P LG     + S  +S      
Sbjct: 11  ISSLLVLSLTGCAWIPS--------TPLVQGA--TSAQPVLGPTPVANGSIFQSAQPINY 60

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 61  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNA 120

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 121 RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 180

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 181 SGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|325927972|ref|ZP_08189193.1| flagellar basal body L-ring protein [Xanthomonas perforans 91-118]
 gi|325541657|gb|EGD13178.1| flagellar basal body L-ring protein [Xanthomonas perforans 91-118]
          Length = 230

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 52/233 (22%), Positives = 101/233 (43%), Gaps = 17/233 (7%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           + +  S+LL GC ++  ++    +++P+   +                 +   + +++  
Sbjct: 12  LAIACSALLGGCVAAG-DVRPFAELAPIVPVV--------------APVAQPTAGAIYAA 56

Query: 67  S-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
                L+ D RA +VGD+LTV++     A     T  S+ ++                  
Sbjct: 57  GPSLNLYGDRRARDVGDLLTVNLVESTTASSTANTSISKKDATTMAAPTLLGAPLTVGGL 116

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
                +  G  + +GKG+ +++ ++   +   V   L NGNL+I G + +R+      + 
Sbjct: 117 NVLENSTSGDRSFAGKGNTAQSNRMQGSVTVTVMQRLPNGNLVIQGQKNLRLTQGDELVQ 176

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
           V GIVR  D+   N+V   K+A+ARI+YGG+G   +        +   + LSP
Sbjct: 177 VQGIVRAADIAPDNTVPSSKVADARIAYGGRGAIAQSNAMGWLSRFFNSRLSP 229


>gi|325982368|ref|YP_004294770.1| flagellar L-ring protein [Nitrosomonas sp. AL212]
 gi|325531887|gb|ADZ26608.1| flagellar L-ring protein [Nitrosomonas sp. AL212]
          Length = 238

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 53/235 (22%), Positives = 95/235 (40%), Gaps = 10/235 (4%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
           RY F +L ++  + GC ++ S +T  P    +  +      +   G   +  +ST     
Sbjct: 13  RYLFALLFFT-FVSGCTTTPSTVTHQPN--SLRPAHQSLAVIQPNGSILQALNSTTNGVR 69

Query: 63  LWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ 122
                +  LF+D RA +VGD + V +     A   + +   R+ S+   +     +    
Sbjct: 70  -----YTPLFEDRRARSVGDTIIVTLNERTNASKSSGSNVDRSGSIDFSVPSLLGIPLGL 124

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
             +    +      +  G G  S        I   V   L NGNL++SG +++ +N    
Sbjct: 125 LKKHAT-VEAKSNNSFDGGGESSSKNDFKGTITVTVIEALPNGNLVVSGEKQIGINQGQE 183

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            + ++G+V P  V   N++S  +IA+ARI Y   G   E        +   N +P
Sbjct: 184 FIRLSGVVNPIHVM-GNTISSTQIADARIEYRANGYIDEAQTMGWLSRFFLNATP 237


>gi|94263285|ref|ZP_01287101.1| Flagellar L-ring protein [delta proteobacterium MLMS-1]
 gi|93456368|gb|EAT06492.1| Flagellar L-ring protein [delta proteobacterium MLMS-1]
          Length = 242

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 61/249 (24%), Positives = 107/249 (42%), Gaps = 20/249 (8%)

Query: 1   MYRYSFIVLCYSSLL-----FGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSD 55
           M R S I+     +       GC ++        +++P      E     F   + +   
Sbjct: 1   MKRQSLIMPALLIIGLGLNLAGCSTT---GGSSAEVAP-----SERLPERFALPETERPR 52

Query: 56  STKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG 114
              +  +++       L++D RA ++GDI+ V +           T   R +SL   L+ 
Sbjct: 53  EVAREGTIYNGGQGLDLYRDGRARDIGDIVQVRVVETSSGQKSADTSTDRGSSLSGGLTS 112

Query: 115 GFSLFG------QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLI 168
            F L         +       ++        G G  SR   +   I+A +     +GNL+
Sbjct: 113 FFGLENWVNERSSKFALTPNAMDAGMSNEFEGSGDTSRDSDVTATISARIVDKTMDGNLV 172

Query: 169 ISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIG 228
           I G QEVRVN+E + + ++G+VRP D+ + N+V  ++IA+ARI Y GKG   +  RP   
Sbjct: 173 IRGYQEVRVNNETQFIILSGLVRPDDITSDNAVLSNRIADARIEYSGKGELADKQRPGWL 232

Query: 229 HQLIENLSP 237
            + ++ + P
Sbjct: 233 SRTVDAVWP 241


>gi|197285507|ref|YP_002151379.1| flagellar basal body L-ring protein [Proteus mirabilis HI4320]
 gi|194682994|emb|CAR43439.1| flagellar L-ring protein precursor [Proteus mirabilis HI4320]
          Length = 247

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 47/239 (19%), Positives = 85/239 (35%), Gaps = 22/239 (9%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
                     L GC                    ++               +   + S++
Sbjct: 24  RLGTALLVLTLAGCA----------------QIPEKPLVEGHTTAIPTAPTTPAPNGSIF 67

Query: 65  RD------SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           +        +  LF+D R  N+GD LT+ ++ +  A  ++    SRN       S     
Sbjct: 68  QATQPVYFGYQPLFEDRRPRNIGDTLTITLQENVSASKNSSANASRNGKAGFLASITPRF 127

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                     ++  +G     GKG  +        I   V  +L NGNL + G +++ +N
Sbjct: 128 LEGLLGNSRTDMGMEGNSEFGGKGGANANNTFKGTITVTVDQLLANGNLHVVGEKQIAIN 187

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
                +  +G+V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 188 QGTEFIRFSGVVNPRTISGSNTVNSTQVADARIEYIGDGYINEAQSMGWLQRFFLNVSP 246


>gi|157373204|ref|YP_001471804.1| flagellar basal body L-ring protein [Shewanella sediminis HAW-EB3]
 gi|157315578|gb|ABV34676.1| flagellar L-ring protein [Shewanella sediminis HAW-EB3]
          Length = 220

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 58/239 (24%), Positives = 95/239 (39%), Gaps = 21/239 (8%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            R+ +I +    LL GC ++  E    P             +  +   +   S    K  
Sbjct: 1   MRHLWIGMLL--LLSGCAANFPEADTKP------------GQPEWAPPEIDYSLPDAKDG 46

Query: 62  SLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           S +R  +   LFKD RA   GDILTV +     +     T  ++   L            
Sbjct: 47  SAYRQGYMLTLFKDKRAFREGDILTVALDEKTYSSKRADTKANKEQDLSIGAQASAG--- 103

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                 +G  +        G GS ++  +L+  I   V  +L NG L+I G + +R+N  
Sbjct: 104 --DSSYSGAGDGSLARGFKGSGSSTQQNQLSGSITVTVAKVLPNGALLIRGEKWLRLNQG 161

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS-PL 238
              L + G++R  D+   N++S  +IA+ARI YGG+G   +        +   +   PL
Sbjct: 162 DEYLRLLGLIRTDDIGNDNTISSQRIADARIIYGGQGAIADSNAMGWASRYFNSPWFPL 220


>gi|260768779|ref|ZP_05877713.1| flagellar L-ring protein FlgH [Vibrio furnissii CIP 102972]
 gi|260616809|gb|EEX41994.1| flagellar L-ring protein FlgH [Vibrio furnissii CIP 102972]
          Length = 219

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 53/232 (22%), Positives = 94/232 (40%), Gaps = 17/232 (7%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
            ++   S  L GC    S+         +    D+ +  P    +     +     SL+ 
Sbjct: 1   MVLALVSMTLVGCAGRTSDF--------VPPCPDDADFAP---PEINYDVARVSKGSLYT 49

Query: 66  DSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP 124
            + A  LF+D RA  VGDILTV +    ++     T   +N++    +            
Sbjct: 50  GNAAMTLFQDRRAYRVGDILTVLLNEKTESDKSATTKYGKNSNASLNVPTL-----GTHV 104

Query: 125 QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
             N + +  G    +G  +  +   L+  I   V  +L NG L + G + +++N     +
Sbjct: 105 FDNLSASASGNRDFAGSAASKQGNSLSGSITVTVYQVLPNGVLRVRGEKWLKLNQGDEFI 164

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
            +TG VR  D+ A N++S  +IA+ARI+Y G+G   +        Q   +  
Sbjct: 165 RLTGNVRASDISADNTLSSQRIADARITYAGRGSFADTNTAGWLTQFFNSPW 216


>gi|283478791|emb|CAY74707.1| Flagellar L-ring protein precursor [Erwinia pyrifoliae DSM 12163]
          Length = 245

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 52/235 (22%), Positives = 87/235 (37%), Gaps = 12/235 (5%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLD-ENNRMPFLGIDFKNSDSTKKSYSL 63
            ++V      L GC            + P    ++      P        + S  +    
Sbjct: 22  RWLVATLLLTLNGCA-----------LVPRKPLVEGSTTAQPLPASPAMVNGSIFQGVMP 70

Query: 64  WRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT 123
               +  LF+D R  N+GD LT+ ++ +  A   +     R+ S    L+          
Sbjct: 71  MNYGYQPLFEDRRPRNIGDTLTITLQENVSASKSSSANAGRDGSAEFGLTATPRALVGLL 130

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
                 L   G     GKG  +        I   V  +L NGNL + G +++ +N     
Sbjct: 131 GGDKATLGGSGKNDFEGKGGATAKNTFTGTITVTVNQVLPNGNLNVVGEKQIEINQGTEF 190

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +  +G+V P+ + A NSV   ++A+ARI Y G G   E        +   N+SP+
Sbjct: 191 IRFSGVVNPRTISASNSVVSSQVADARIEYVGNGYINEAQTMGWLQRFFLNISPM 245


>gi|227886563|ref|ZP_04004368.1| flagellar basal body L-ring protein [Escherichia coli 83972]
 gi|300974383|ref|ZP_07172595.1| flagellar L-ring protein FlgH [Escherichia coli MS 45-1]
 gi|227836767|gb|EEJ47233.1| flagellar basal body L-ring protein [Escherichia coli 83972]
 gi|300410626|gb|EFJ94164.1| flagellar L-ring protein FlgH [Escherichia coli MS 45-1]
          Length = 235

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 52/232 (22%), Positives = 91/232 (39%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I       L GC    S        +P+       +  P  G     + S  +S      
Sbjct: 14  ISSLLVLSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINY 63

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 64  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGVFGNA 123

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 124 RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 183

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 184 SGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|259908809|ref|YP_002649165.1| flagellar basal body L-ring protein [Erwinia pyrifoliae Ep1/96]
 gi|224964431|emb|CAX55940.1| Flagellar L-ring protein [Erwinia pyrifoliae Ep1/96]
 gi|310767293|gb|ADP12243.1| Flagellar L-ring protein precursor [Erwinia sp. Ejp617]
          Length = 233

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 52/235 (22%), Positives = 87/235 (37%), Gaps = 12/235 (5%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLD-ENNRMPFLGIDFKNSDSTKKSYSL 63
            ++V      L GC            + P    ++      P        + S  +    
Sbjct: 10  RWLVATLLLTLNGCA-----------LVPRKPLVEGSTTAQPLPASPAMVNGSIFQGVMP 58

Query: 64  WRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT 123
               +  LF+D R  N+GD LT+ ++ +  A   +     R+ S    L+          
Sbjct: 59  MNYGYQPLFEDRRPRNIGDTLTITLQENVSASKSSSANAGRDGSAEFGLTATPRALVGLL 118

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
                 L   G     GKG  +        I   V  +L NGNL + G +++ +N     
Sbjct: 119 GGDKATLGGSGKNDFEGKGGATAKNTFTGTITVTVNQVLPNGNLNVVGEKQIEINQGTEF 178

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +  +G+V P+ + A NSV   ++A+ARI Y G G   E        +   N+SP+
Sbjct: 179 IRFSGVVNPRTISASNSVVSSQVADARIEYVGNGYINEAQTMGWLQRFFLNISPM 233


>gi|237755439|ref|ZP_04584064.1| flagellar L-ring protein FlgH [Sulfurihydrogenibium yellowstonense
           SS-5]
 gi|237692403|gb|EEP61386.1| flagellar L-ring protein FlgH [Sulfurihydrogenibium yellowstonense
           SS-5]
          Length = 224

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 54/238 (22%), Positives = 95/238 (39%), Gaps = 16/238 (6%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R   +      +  GC    SE       +P                + +     +  
Sbjct: 1   MKRLLLLFGVIGFITVGCAKKTSEYGKPFNPNP---------------PEIEQEKVVRTP 45

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SL+  ++  LF DS+A  VGDI+T+ +  +      + T       +   +     +  
Sbjct: 46  GSLYTGTYNNLFSDSKAFTVGDIITIRVVENIAGQTASNTNTQEQQKMDLNVPSPKLMGK 105

Query: 121 QQTPQMN-GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
               +     +         G  S +R   L   I+A VT +  NGNL I G + V+VND
Sbjct: 106 DLINKTPIAGITEQNSDTYKGSASTNRKSTLIATISARVTKVYPNGNLFIVGKKVVKVND 165

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           + ++L ++GIV+P D+   NSV   +I++  + Y G+    +  RP    Q ++ + P
Sbjct: 166 DYQTLVISGIVKPTDIMQDNSVDSSRISDMYVEYNGRSYMADSSRPGWLAQFLKRIWP 223


>gi|238794001|ref|ZP_04637619.1| Flagellar L-ring protein [Yersinia intermedia ATCC 29909]
 gi|238726633|gb|EEQ18169.1| Flagellar L-ring protein [Yersinia intermedia ATCC 29909]
          Length = 237

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 52/229 (22%), Positives = 91/229 (39%), Gaps = 12/229 (5%)

Query: 10  CYSSLLFGCHSSISEITGIPQMSPMGSSLD-ENNRMPFLGIDFKNSDSTKKSYSLWRDSH 68
             + LL GC              P  S +D   +  P        + S  ++       +
Sbjct: 19  LTAMLLNGCA-----------YIPHKSLVDGTTSAQPAPASAPLPNGSIFQAAQPMNYGY 67

Query: 69  AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
             LF+D R  NVGD LT+ ++ +  A   +    SRN +    ++               
Sbjct: 68  QPLFEDRRPRNVGDTLTITLQENVSASKSSSANASRNGASKFGVATSPRYLEGLLGNARA 127

Query: 129 NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
           +++  G     GKG  +     +  I   V  +L NGNL + G +++ +N     +  +G
Sbjct: 128 DMDISGDNTFGGKGGANANNTFSGTITVTVDRVLANGNLHVVGEKQIAINQGTEFIRFSG 187

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 188 VVNPRTISGSNTVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNISP 236


>gi|92114095|ref|YP_574023.1| flagellar L-ring protein [Chromohalobacter salexigens DSM 3043]
 gi|91797185|gb|ABE59324.1| flagellar L-ring protein [Chromohalobacter salexigens DSM 3043]
          Length = 224

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 54/233 (23%), Positives = 94/233 (40%), Gaps = 21/233 (9%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           + L    ++ GC   +   + +P   P+                   +   + + ++++ 
Sbjct: 10  LCLLLMLIMSGCA-QLPHESVVPDTGPVSYP---------------EAPLPQPNGAIYQA 53

Query: 67  --SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP 124
              +  LF+D R   +GDI+T+ I  D  A  D+    +R  S+   L     L      
Sbjct: 54  RYGYQPLFQDRRPRQIGDIITITINEDVSASKDSSASANREGSMGLDLETIPDLMSFLE- 112

Query: 125 QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
             +  L+  G     G G  S +      + A V  IL NGNL I G + + +N     +
Sbjct: 113 --DNGLDVSGENDFEGSGGASASNTFTGTLTATVVDILPNGNLSIRGEKRIAINQGTEYI 170

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
             +G+V P+ V   N+V   ++A+ARI Y G G   E        +L  N++P
Sbjct: 171 RFSGVVDPRSVTTQNTVPSGQVADARIEYVGDGYINEAQHMGWLQRLWLNIAP 223


>gi|294635613|ref|ZP_06714090.1| flagellar L-ring protein FlgH [Edwardsiella tarda ATCC 23685]
 gi|291091065|gb|EFE23626.1| flagellar L-ring protein FlgH [Edwardsiella tarda ATCC 23685]
          Length = 236

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 55/243 (22%), Positives = 94/243 (38%), Gaps = 22/243 (9%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R+S I L  +  L GC                     +             +   + +
Sbjct: 9   MQRHSGIALLCALALSGCA----------------YIPHDQVVTGPTTATPAPATPPRAN 52

Query: 61  YSLWRD------SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG 114
            S+++        +  LF+D R  N+GDILT+ ++ +  A   +    SRN       + 
Sbjct: 53  GSIFQGVQPMNYGYQPLFEDRRPRNIGDILTIVLQENVSASKSSSANASRNGGSKFDFAT 112

Query: 115 GFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
                         N+  +G    +GKG  +     +  I   V  +L NGNL + G ++
Sbjct: 113 VPRYLEGLFGNARANMEVNGENQFNGKGGANANNTFSGTITVTVADVLSNGNLKVVGEKQ 172

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           + +N     +  +G+V P+ +  +NSV   ++A+ARI Y G G   E        +   N
Sbjct: 173 IAINQGTEYIRFSGVVNPRTISGNNSVPSTQVADARIEYVGSGYINEAQNMGWMQRFFLN 232

Query: 235 LSP 237
           LSP
Sbjct: 233 LSP 235


>gi|303248237|ref|ZP_07334500.1| flagellar L-ring protein [Desulfovibrio fructosovorans JJ]
 gi|302490375|gb|EFL50286.1| flagellar L-ring protein [Desulfovibrio fructosovorans JJ]
          Length = 240

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 56/254 (22%), Positives = 103/254 (40%), Gaps = 32/254 (12%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R  F+ L   + L  C  +  + T +PQ++P                  K     +  
Sbjct: 1   MIRKQFLPLLLIAGLAACAPASKKATPMPQVTPT---------------VAKAPPPAQNP 45

Query: 61  YSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            S++  +    LF D+RA  +GDILTV+I    ++    +T   + +S    +S  F   
Sbjct: 46  GSVFSQNQPTFLFDDTRARRIGDILTVNIVDTSKSDLKAETKNDKTSSQQFGVSNYFGNK 105

Query: 120 GQQTP----------------QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILE 163
                                     ++         KG   R   +   I   +  IL 
Sbjct: 106 TITGNLPGQLGGPDFGMKGYTGSTPLVSVSNAEKFQSKGETKRESAVTASIGCRIVNILP 165

Query: 164 NGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELL 223
            G + + G+++ RVN+E + + V G+VRP DV   N+V+  ++A+ +I Y G+G   +  
Sbjct: 166 GGVMQLEGARQTRVNNENQIIVVKGLVRPIDVGPSNTVASTQLADCQIEYYGEGDLADRQ 225

Query: 224 RPPIGHQLIENLSP 237
           +     ++++N+ P
Sbjct: 226 KSGWLARILDNVWP 239


>gi|212637788|ref|YP_002314313.1| flagellar basal body L-ring protein [Shewanella piezotolerans WP3]
 gi|212559272|gb|ACJ31726.1| Flagellar L-ring protein [Shewanella piezotolerans WP3]
          Length = 224

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 58/234 (24%), Positives = 99/234 (42%), Gaps = 19/234 (8%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           + +    LL GC +   E               E  +  +   +   S    K  S++R 
Sbjct: 8   LGIAMLVLLSGCVAHFPE------------PDTEPGKPEWAPPEIDYSLPDAKDGSVYRP 55

Query: 67  SHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
                LFKD RA   GDILTV +     +     T  ++ + L              +  
Sbjct: 56  GFMLTLFKDKRAFREGDILTVALDEKTYSSKRADTKTNKASGLSID-----GQGTTGSNS 110

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
           + G+   + G + +G GS ++  +L+  I   V  +L NG L+I G + +R+N     L 
Sbjct: 111 VAGSGEANMGRSFNGTGSSTQQNQLSGSITVTVAKVLPNGALLIRGEKWLRLNQGDEYLR 170

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS-PL 238
           + G++R  D+   N++S  +IA+ARI YGG+G  ++  R     +   +   PL
Sbjct: 171 LLGLIRTDDIGNDNTISSQRIADARIIYGGQGAISDSNRMGWASRYFNSPWFPL 224


>gi|315497879|ref|YP_004086683.1| flagellar l-ring protein [Asticcacaulis excentricus CB 48]
 gi|315415891|gb|ADU12532.1| flagellar L-ring protein [Asticcacaulis excentricus CB 48]
          Length = 242

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 92/228 (40%), Positives = 128/228 (56%), Gaps = 10/228 (4%)

Query: 16  FGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDS 75
            GC S ++E    P + PMG        +P   +    + ++  + SLWR    A FKD 
Sbjct: 18  SGCAS-VNEAVNGPSLQPMGYPAQ---LVPQQQVYAPPASTSASANSLWRTGAKAFFKDQ 73

Query: 76  RALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN------GN 129
           RA +VGDILTV I IDD+A   N T R R+ S    +   F L       +         
Sbjct: 74  RARHVGDILTVTIDIDDKAQTQNTTSRKRDGSYTGSVPSVFGLESSLGKILPSEYNPSAG 133

Query: 130 LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
           L+ +     SG GS++R+EK++L +AAIVT +L NGNLII GSQEVR N E+R L V+GI
Sbjct: 134 LSNNTAAEFSGSGSVNRSEKISLTVAAIVTGVLPNGNLIIQGSQEVRTNREVRELIVSGI 193

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           V PQD+ + N + + ++AEARISYGG+G  + +   P+   L+E  SP
Sbjct: 194 VNPQDISSANIIKHTQLAEARISYGGRGDVSRMQAAPVSQNLMEKFSP 241


>gi|320354344|ref|YP_004195683.1| flagellar L-ring protein [Desulfobulbus propionicus DSM 2032]
 gi|320122846|gb|ADW18392.1| flagellar L-ring protein [Desulfobulbus propionicus DSM 2032]
          Length = 246

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 67/241 (27%), Positives = 111/241 (46%), Gaps = 21/241 (8%)

Query: 3   RYSFIVLCYSSLL-FGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
           R + ++L  ++L+  GC S+  E+      SP+   L+E            +    +   
Sbjct: 20  RMAMVLLLAATLVTAGCGSTSQEV------SPVTEPLEEP---------VVDDARPQSPG 64

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG- 120
           +LW         D +A  VGDI+TV I  + +A  +  T   R++S+   +S  F L   
Sbjct: 65  TLWNGDEGNWLADVKARRVGDIVTVIIEEEAKASKEATTDTDRSSSISAGISSFFGLEKS 124

Query: 121 ----QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                   + +  +    G   SG G  +R+E L   +   V  +  NGNL I G + V 
Sbjct: 125 LEEKNSNLETSALVEASSGNQFSGGGKTTRSENLVATLTTQVVEVYPNGNLKIRGGKSVT 184

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN+E + + +TGIVR  DV A N+V+   I  A+ISY GKG  ++  +P    ++ ++  
Sbjct: 185 VNNENQIIYLTGIVRSYDVTADNTVNSGNILNAQISYTGKGAVSDKQKPGWMMRIFDHTW 244

Query: 237 P 237
           P
Sbjct: 245 P 245


>gi|238755321|ref|ZP_04616664.1| Flagellar L-ring protein [Yersinia ruckeri ATCC 29473]
 gi|238706457|gb|EEP98831.1| Flagellar L-ring protein [Yersinia ruckeri ATCC 29473]
          Length = 219

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 52/229 (22%), Positives = 90/229 (39%), Gaps = 12/229 (5%)

Query: 10  CYSSLLFGCHSSISEITGIPQMSPMGSSLD-ENNRMPFLGIDFKNSDSTKKSYSLWRDSH 68
               LL GC              P    +D   +  P        + S  ++       +
Sbjct: 1   MAMLLLNGCA-----------YIPHKPLVDGTTSAQPAPASAPLPNGSIFQAVQPMNYGY 49

Query: 69  AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
             LF+D R  NVGD LT+ ++ +  A   +    SRN S    ++               
Sbjct: 50  QPLFEDRRPRNVGDTLTITLQENVSASKSSSANASRNGSSKFGVATAPRYLEGLLGNARA 109

Query: 129 NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
           +++  G  +  GKG  +     +  I   V  +L NGNL + G +++ +N     +  +G
Sbjct: 110 DMDISGDNSFGGKGGANANNTFSGTITVTVNQVLANGNLHVVGEKQIAINQGTEFIRFSG 169

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 170 VVNPRTISGSNTVTSTQVADARIEYVGNGYINEAQNMGWLQRFFLNVSP 218


>gi|223041237|ref|ZP_03611486.1| flagellar L-ring protein FlgH [Campylobacter rectus RM3267]
 gi|222877496|gb|EEF12628.1| flagellar L-ring protein FlgH [Campylobacter rectus RM3267]
          Length = 233

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 60/244 (24%), Positives = 105/244 (43%), Gaps = 19/244 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  +     ++ L GC            +      +D    +    +  K  ++   +
Sbjct: 1   MKKNIYFCAVLTAFLSGC------------LPSADPRIDMKPPVYVEQLPAKQVNNQPNA 48

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLH-------RKLS 113
            SL+      LF D +A+NV DI+TV I          +   S+N++++          +
Sbjct: 49  GSLFGRGDNPLFADRKAMNVNDIVTVVISERANQSSSGKHDTSKNSTINLGGGLFSAGSA 108

Query: 114 GGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
              +L  Q     N   +       +G GS  RAE     I+A +  +LENGN  I GS+
Sbjct: 109 PLSTLATQLNKVGNIGFSAGTKNEFTGAGSSVRAEAFTTTISARIIKVLENGNYFIEGSR 168

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+ +N E + + ++G++RP D+   N +    IA+A+I Y  +G      R P G +L+E
Sbjct: 169 ELLINGEKQIMQLSGVIRPYDISNANEIDSRYIADAKILYKTEGDLDRATRKPWGTKLME 228

Query: 234 NLSP 237
            + P
Sbjct: 229 AIWP 232


>gi|325916944|ref|ZP_08179188.1| flagellar basal body L-ring protein [Xanthomonas vesicatoria ATCC
           35937]
 gi|325536847|gb|EGD08599.1| flagellar basal body L-ring protein [Xanthomonas vesicatoria ATCC
           35937]
          Length = 230

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 52/233 (22%), Positives = 102/233 (43%), Gaps = 17/233 (7%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
             +  S+LL GC ++  ++    +++P+   +                 +   + +++  
Sbjct: 12  FAIACSALLGGCVAAG-DVRPFAELAPIVPVV--------------APVAQPTAGAIYAA 56

Query: 67  S-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
                L+ D RA +VGD+LTV++     A     T  S+ +++         +       
Sbjct: 57  GPSLNLYGDRRARDVGDLLTVNLVESTTASSTANTSISKADTVDMSTPTLLGVPLTVNGT 116

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
                  +G  + +GKG+ +++ ++   +   V   L NGNL+I G + +R+      + 
Sbjct: 117 DVLRNFTNGDRSFAGKGNTAQSNRMQGSVTVTVMQRLPNGNLVIQGQKNLRLTQGDELVQ 176

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
           V GIVR  D+   N+V   K+A+ARI+YGG+G   +        +   + LSP
Sbjct: 177 VQGIVRAADIGPDNTVPSSKVADARIAYGGRGAIAQSNAMGWLSRFFNSRLSP 229


>gi|292489130|ref|YP_003532017.1| flagellar L-ring protein [Erwinia amylovora CFBP1430]
 gi|292900249|ref|YP_003539618.1| flagellar L-ring protein [Erwinia amylovora ATCC 49946]
 gi|291200097|emb|CBJ47223.1| flagellar L-ring protein [Erwinia amylovora ATCC 49946]
 gi|291554564|emb|CBA22175.1| Flagellar L-ring protein precursor [Erwinia amylovora CFBP1430]
          Length = 237

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 55/234 (23%), Positives = 93/234 (39%), Gaps = 10/234 (4%)

Query: 4   YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSL 63
              + +    LL GC      I   P +          +  P        S S  +S   
Sbjct: 13  RRVVAVSAVLLLTGCA----HIMQQPLV------QGPTSATPLQMAPIGASGSLFQSGQA 62

Query: 64  WRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT 123
               +  +F+D R  NVGD LT+ ++ +  A   +    +RN S    L    S      
Sbjct: 63  MNYGYQPMFEDRRPRNVGDTLTILLQENVSASKSSSASANRNGSAGMGLEVVPSSVSGAL 122

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
                + N  G    +GKG  +        I   V  +L NGNL + G +++ +N     
Sbjct: 123 GNGKLDFNAGGQSDFAGKGGAAARNTFTGTITVTVNQLLPNGNLQVVGEKQIAINQGTEF 182

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +  +G+V P+ +  +N+VS  ++++ARI Y G G   E        +++ N+SP
Sbjct: 183 IRFSGVVNPRTISGNNTVSSTQVSDARIEYVGNGYINESQNMGWLQRVLLNISP 236


>gi|78358196|ref|YP_389645.1| flagellar basal body L-ring protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|110816529|sp|Q30WJ6|FLGH_DESDG RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|78220601|gb|ABB39950.1| flagellar L-ring protein FlgH [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 234

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 66/247 (26%), Positives = 108/247 (43%), Gaps = 25/247 (10%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            RY+ I +       GC ++    +  P + P               +     +  +   
Sbjct: 1   MRYAVICMLL-LAASGCTAARQAPSPEPGLVP-------------PPVVTTPEEKAENPG 46

Query: 62  SLWRDSHAAL-FKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS--- 117
           SL+ D +A L + D RA  VGDI+ ++I  + +A     T  ++ ++    +S  F    
Sbjct: 47  SLFSDENADLLYADYRARRVGDIVLINIVENSKAENKASTSTNKESTGEYGVSSFFDRSK 106

Query: 118 -------LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
                              L +      SG G  +R   +   IAA VT +L  G + + 
Sbjct: 107 VGIIPGQTLLSGRTGDVPLLKFSSVSDFSGDGETTRENTVTATIAARVTRVLPGGLMQVE 166

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ 230
           GS+E RVN+E + + V+G+VR  DV   NSV   ++A+ARISY GKG  ++  R     +
Sbjct: 167 GSRETRVNEETQIVTVSGLVRTSDVADDNSVMSTQMADARISYYGKGVISDKQRVGWFTR 226

Query: 231 LIENLSP 237
           L++NL P
Sbjct: 227 LMDNLWP 233


>gi|21231394|ref|NP_637311.1| flagellar basal body L-ring protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66768553|ref|YP_243315.1| flagellar basal body L-ring protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188991638|ref|YP_001903648.1| flagellar basal body L-ring protein [Xanthomonas campestris pv.
           campestris str. B100]
 gi|31076713|sp|Q8P9B9|FLGH_XANCP RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|81305475|sp|Q4UUH8|FLGH_XANC8 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|226701938|sp|B0RT13|FLGH_XANCB RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|21113059|gb|AAM41235.1| flagellar L-ring protein [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66573885|gb|AAY49295.1| flagellar L-ring protein [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|167733398|emb|CAP51599.1| unnamed protein product [Xanthomonas campestris pv. campestris]
          Length = 230

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 53/233 (22%), Positives = 103/233 (44%), Gaps = 17/233 (7%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           + +  S+LL GC ++  ++    +++P+   +                 +   + +++  
Sbjct: 12  LAIACSALLGGCVAAG-DVRPFAELAPIVPVV--------------APVAQPTAGAIYAA 56

Query: 67  S-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
                L+ D RA +VGD+LTV++  +  A     T  S+ +++         +       
Sbjct: 57  GPSLNLYGDRRARDVGDLLTVNLVENTTASSTANTSISKADTVDMSTPTLLGVPLTVNGI 116

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
                +  G  +  GKG+ +++ ++   +   V   L NGNL+I G + +R+      + 
Sbjct: 117 DVLRNSTSGDRSFDGKGNTAQSNRMQGSVTVTVMQRLPNGNLVIQGQKNLRLTQGDELVQ 176

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
           V GIVR  D+   NSV   K+A+ARI+YGG+G   +        +   + LSP
Sbjct: 177 VQGIVRAADIAPDNSVPSSKVADARIAYGGRGAIAQSNAMGWLSRFFNSRLSP 229


>gi|294665576|ref|ZP_06730857.1| flagellar L-ring protein precursor [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292604674|gb|EFF48044.1| flagellar L-ring protein precursor [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 230

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 53/233 (22%), Positives = 100/233 (42%), Gaps = 17/233 (7%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           +    S+LL GC ++  ++    +M+P+   +                 +   + +++  
Sbjct: 12  LATACSALLGGCVAAG-DVRPFAEMAPIVPVV--------------APVAQPTAGAIYAA 56

Query: 67  SHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
                L+ D RA +VGD+LTV++     A     T  S+ ++                  
Sbjct: 57  GPGLNLYGDRRARDVGDLLTVNLVESTTASSTANTSISKKDATTMAAPTLLGAPLTVGGL 116

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
                +  G  + +GKG+ +++ ++   +   V   L NGNL+I G + +R+      + 
Sbjct: 117 NVLENSTSGDRSFAGKGNTAQSNRMQGSVTVTVMQRLPNGNLVIQGQKNLRLTQGDELVQ 176

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
           V GIVR  D+   N+V   K+A+ARI+YGG+G   +        +   + LSP
Sbjct: 177 VQGIVRAADIAPDNTVPSSKVADARIAYGGRGAIAQSNAMGWLSRFFNSRLSP 229


>gi|256830174|ref|YP_003158902.1| flagellar L-ring protein [Desulfomicrobium baculatum DSM 4028]
 gi|256579350|gb|ACU90486.1| flagellar L-ring protein [Desulfomicrobium baculatum DSM 4028]
          Length = 229

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 58/243 (23%), Positives = 102/243 (41%), Gaps = 21/243 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +   +++    +L GC ++         ++P                  +     +  
Sbjct: 1   MQKRCMMLMLAVLVLSGCRTTSRPPMPAAVVTP---------------PPQERVSEARNP 45

Query: 61  YSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS-- 117
            SL+  D    LF D+RA  VGDI+ + +     +     T   R +S++  +S      
Sbjct: 46  GSLFDPDGATMLFADARAKRVGDIVLIKVVETTLSKSKASTTADRESSMNLGVSAYLGKD 105

Query: 118 ---LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
              L    T   +  +N        G G   R   L   +AA VT +L  G + + G++E
Sbjct: 106 KLPLIPGATVGPDALVNAGSTSGFEGDGETKRESSLTTTVAARVTRVLGGGLMEVVGARE 165

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
            RVN E + + V G+ R +D+DA N++    +AEARI   G+G   +  RP    ++++N
Sbjct: 166 TRVNGETQIVLVQGVARDRDIDADNTIMSTSLAEARIELYGEGVLADKQRPGWLARILDN 225

Query: 235 LSP 237
           + P
Sbjct: 226 VWP 228


>gi|227355998|ref|ZP_03840390.1| flagellar L-ring protein precursor [Proteus mirabilis ATCC 29906]
 gi|227163986|gb|EEI48888.1| flagellar L-ring protein precursor [Proteus mirabilis ATCC 29906]
          Length = 247

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 47/239 (19%), Positives = 84/239 (35%), Gaps = 22/239 (9%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
                     L GC     +                               +   + S++
Sbjct: 24  RLGTALLVLTLAGCAQIPKK----------------PLVEGHTTAIPTAPTTPAPNGSIF 67

Query: 65  RD------SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           +        +  LF+D R  N+GD LT+ ++ +  A  ++    SRN       S     
Sbjct: 68  QATQPVYFGYQPLFEDRRPRNIGDTLTITLQENVSASKNSSANASRNGKAGFLASITPRF 127

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                     ++  +G     GKG  +        I   V  +L NGNL + G +++ +N
Sbjct: 128 LEGLLGNSRTDMGMEGNSEFGGKGGANANNTFKGTITVTVDQLLANGNLHVVGEKQIAIN 187

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
                +  +G+V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 188 QGTEFIRFSGVVNPRTISGSNTVNSTQVADARIEYIGDGYINEAQSMGWLQRFFLNVSP 246


>gi|88799024|ref|ZP_01114605.1| Flagellar basal body L-ring protein [Reinekea sp. MED297]
 gi|88778251|gb|EAR09445.1| Flagellar basal body L-ring protein [Reinekea sp. MED297]
          Length = 229

 Score =  194 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 54/234 (23%), Positives = 102/234 (43%), Gaps = 14/234 (5%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
            ++   + ++ GC S   +I  +P  SP      E   +P   +    +       SL+ 
Sbjct: 7   LLIGLTAVIMTGCGS--MQIANLP--SPPQPGDPEFAPVPSDSLVPPPN----TGGSLYA 58

Query: 66  DSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP 124
           D++  +L+ D +A  VGDI+TV +    Q    + +  S+ +           +     P
Sbjct: 59  DAYGMSLYGDKKARRVGDIITVLLDEQTQGSKSSASNTSKTSEATISAPSVGGI----GP 114

Query: 125 QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
                 +  G  + SG+G   ++  L+  I   V+ +L NG L + G + + +N+    +
Sbjct: 115 IDQLGASIQGDRSFSGRGDADQSNSLSGNITVTVSEVLPNGVLRVRGEKWITLNNGSEFI 174

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
            + G++RP D++  N+VS  K+A+ARISY G G      +         + + P
Sbjct: 175 RIQGMLRPDDINLDNTVSSQKLADARISYSGAGAIANSSKQGWLSAFFNSPVFP 228


>gi|312173288|emb|CBX81543.1| Flagellar L-ring protein precursor [Erwinia amylovora ATCC
           BAA-2158]
          Length = 237

 Score =  194 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 55/234 (23%), Positives = 92/234 (39%), Gaps = 10/234 (4%)

Query: 4   YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSL 63
                +    LL GC      I   P +          +  P        S S  +S   
Sbjct: 13  RRVAAVSAVLLLTGCA----HIMQQPLV------QGPTSATPLQMAPIGASGSLFQSGQA 62

Query: 64  WRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT 123
               +  +F+D R  NVGD LT+ ++ +  A   +    +RN S    L    S      
Sbjct: 63  MNYGYQPMFEDRRPRNVGDTLTILLQENVSASKSSSASANRNGSAGMGLEVVPSSVSGAL 122

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
                + N  G    +GKG  +        I   V  +L NGNL + G +++ +N     
Sbjct: 123 GNGKLDFNAGGQSDFAGKGGAAARNTFTGTITVTVNQLLPNGNLQVVGEKQIAINQGTEF 182

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +  +G+V P+ +  +N+VS  ++++ARI Y G G   E        +++ N+SP
Sbjct: 183 IRFSGVVNPRTISGNNTVSSTQVSDARIEYVGNGYINESQNMGWLQRVLLNISP 236


>gi|222053734|ref|YP_002536096.1| flagellar L-ring protein [Geobacter sp. FRC-32]
 gi|221563023|gb|ACM18995.1| flagellar L-ring protein [Geobacter sp. FRC-32]
          Length = 230

 Score =  194 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 64/210 (30%), Positives = 99/210 (47%), Gaps = 5/210 (2%)

Query: 33  PMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDD 92
           P  S      R P      + +  T  S S+W+DS   + +D +A   GD LTV I    
Sbjct: 20  PACSFQSSEIRTPTFDEQMQQAKPTYTSGSIWQDSSTGITEDLKARRRGDTLTVVITEQA 79

Query: 93  QAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP-----QMNGNLNYDGGGASSGKGSISRA 147
            A     TG SR +++   +     L    T       ++  LN        G G  +R 
Sbjct: 80  SASKQATTGTSRGSTISAGIPNLMGLETNITGISNWMDLSNLLNASYDSKYDGSGKTTRE 139

Query: 148 EKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIA 207
           E L   I A V  ++ NGNL+I G + V+VN+E + + +TG VR +D+ + N V+   IA
Sbjct: 140 ENLRATITAKVIDVIGNGNLLIEGKRNVKVNNEDQIIVLTGTVRTRDISSDNVVNSIYIA 199

Query: 208 EARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +ARI+Y GKG  ++  RP     +++ + P
Sbjct: 200 DARINYSGKGVISDRQRPGWLMGILDVIWP 229


>gi|294084415|ref|YP_003551173.1| flagellar L-ring protein [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663988|gb|ADE39089.1| flagellar L-ring protein [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 226

 Score =  194 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 57/238 (23%), Positives = 103/238 (43%), Gaps = 15/238 (6%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           +   S  V  +   L GC + +     + +  P+  + D    +               +
Sbjct: 2   LNARSLFVALFMLGLGGCSTYVENQASV-EFEPIYETNDFTQMVAIP------------T 48

Query: 61  YSLWRDSHAALFK-DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
             ++  +   LF  D RA NVGDILTV +     A        ++ +S    L       
Sbjct: 49  GGIFEKTKGGLFATDRRARNVGDILTVSLSESFSATKSQTAASAKTDSFGVTLPTALPNI 108

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                  +  L      + SG GS +++  L+  ++  V  + +NGN+ I G +++ +N+
Sbjct: 109 LT-GGYSDAGLTGGAARSFSGSGSAAQSNSLSGFLSVTVMRVFDNGNMEIKGQKKLNLNN 167

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
               + +TG+VRPQD+ A N V  ++IA+A+I+Y G G T +  R     + +  +SP
Sbjct: 168 GDEYVRLTGLVRPQDISASNLVLSNRIADAQITYVGAGETADSARQGWLSKTLRTISP 225


>gi|186896768|ref|YP_001873880.1| flagellar basal body L-ring protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|186699794|gb|ACC90423.1| flagellar L-ring protein [Yersinia pseudotuberculosis PB1/+]
          Length = 212

 Score =  194 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 53/230 (23%), Positives = 93/230 (40%), Gaps = 20/230 (8%)

Query: 11  YSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA- 69
               L GC S        P +      + +++       +     +  +   L++ ++  
Sbjct: 1   MVLALCGCES--------PALL-----VQKDDAEFAPPANLVQPATVTEGGGLFQPAYNW 47

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN 129
           +L +D RA  +GDILTV +    Q+    +T   + N +   +         +       
Sbjct: 48  SLLQDRRAYRIGDILTVILDESTQSSKQAKTNFGKKNDMSLGVPEVLGKKLNKFGG---- 103

Query: 130 LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
            +  G     G  + ++   L   I   V  +L NG L+I G + + +N     + VTG+
Sbjct: 104 -SISGKRDFDGSATSAQQNMLRGSITVAVHQVLPNGVLVIRGEKWLTLNQGDEYMRVTGL 162

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSPL 238
           VR  DV   NSVS  +IA ARISY G+G  ++        +   + L P+
Sbjct: 163 VRADDVARDNSVSSQRIANARISYAGRGALSDANSAGWLTRFFNHPLFPI 212


>gi|238762357|ref|ZP_04623328.1| Flagellar L-ring protein 1 [Yersinia kristensenii ATCC 33638]
 gi|238699342|gb|EEP92088.1| Flagellar L-ring protein 1 [Yersinia kristensenii ATCC 33638]
          Length = 212

 Score =  194 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 53/230 (23%), Positives = 95/230 (41%), Gaps = 20/230 (8%)

Query: 11  YSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA- 69
               L GC +        P +      + +++       +     + K+   L++ ++  
Sbjct: 1   MVLALSGCET--------PALL-----VHKDDVAFAPPANLIQPTTVKEGGGLFQPAYNW 47

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN 129
           +L +D RA  +GDILTV +    Q+    +T   + N +   +         +       
Sbjct: 48  SLLQDRRAYRIGDILTVKLDESTQSSKQAKTNFGKKNDMSLGIPEILGKKLNKLGG---- 103

Query: 130 LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
            +  G     G  + ++   L   I   V  +L NG L+I G + + +N     + VTG+
Sbjct: 104 -SISGKRDFDGSATSAQQNMLRGSITVAVHQVLPNGVLVIRGEKWLTLNQGDEYMRVTGL 162

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSPL 238
           VR  DV+  NSVS  +IA ARISY G+G  ++        +   + L P+
Sbjct: 163 VRADDVERDNSVSSQRIANARISYAGRGALSDANSAGWLTRFFNHPLFPI 212


>gi|283477479|emb|CAY73395.1| Flagellar L-ring protein precursor [Erwinia pyrifoliae DSM 12163]
          Length = 237

 Score =  194 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 55/233 (23%), Positives = 93/233 (39%), Gaps = 10/233 (4%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
               +  + LL GC      I   P +          +  P        S S  +S    
Sbjct: 14  RVAAISAALLLTGCA----HIMQQPLVQ------GPTSATPLQMAPTGASGSLFQSGQAM 63

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP 124
              +  +F+D R  NVGD LT+ ++ +  A   +    +RN S    L    S       
Sbjct: 64  NYGYQPMFEDRRPRNVGDTLTILLQENVSASKSSSASANRNGSAGMGLEVVPSSVSGALG 123

Query: 125 QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
               + N +G    +GKG  +        I   V  +L NGNL + G +++ +N     +
Sbjct: 124 NGKLDFNAEGQSDFAGKGGAAARNTFTGTITVTVNQLLPNGNLQVVGEKQIAINQGTEFI 183

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
             +G+V P+ +   N+VS  ++++ARI Y G G   E        +++ N+SP
Sbjct: 184 RFSGVVNPRTISGSNTVSSTQVSDARIEYVGNGYINESQNMGWLQRVLLNISP 236


>gi|194432358|ref|ZP_03064645.1| flagellar L-ring protein FlgH [Shigella dysenteriae 1012]
 gi|194419245|gb|EDX35327.1| flagellar L-ring protein FlgH [Shigella dysenteriae 1012]
          Length = 219

 Score =  194 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 51/229 (22%), Positives = 90/229 (39%), Gaps = 10/229 (4%)

Query: 10  CYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA 69
                L GC    S        +P+       +  P  G     + S  +S       + 
Sbjct: 1   MLVLSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINYGYQ 50

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN 129
            LF+D R  N+GD LT+ ++ +  A   +    SR+   +                   +
Sbjct: 51  PLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNARAD 110

Query: 130 LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
           +   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  +G+
Sbjct: 111 VEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRFSGV 170

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 171 VNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 219


>gi|23015790|ref|ZP_00055557.1| COG2063: Flagellar basal body L-ring protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 263

 Score =  194 bits (494), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 81/236 (34%), Positives = 121/236 (51%), Gaps = 13/236 (5%)

Query: 15  LFGCH--SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALF 72
           L  C+  + +SE+   PQ SP+ +    +   P      + S   + + SLWR    A F
Sbjct: 27  LSACNMLTRMSEVGSGPQSSPISNPTQASGYQPVSMPMPQPSAPPQNANSLWRPGARAFF 86

Query: 73  KDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP-------- 124
           KD RA +VGDILTV + I D A        SR  S         S               
Sbjct: 87  KDQRAKDVGDILTVAVSISDSATLTTGLTNSRTGSEKAGSGTTGSSITAVGLESQLAKLL 146

Query: 125 ---QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
               +    +     A +  G+ +R E + + +AA++T +L NGNL+ISG QE RVN E+
Sbjct: 147 PNINLASLADLSSTSAVTNSGNTTRTESITMSMAAVITQVLPNGNLVISGRQEFRVNYEM 206

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           R L++ GI+RP+D+ + NSVS +KIAEAR+ YGG+G  ++L +P  G Q+ + + P
Sbjct: 207 RELSIQGIIRPEDISSSNSVSSEKIAEARVYYGGRGMVSDLTQPRYGQQIFDIIFP 262


>gi|330889079|gb|EGH21740.1| flagellar basal body L-ring protein [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 237

 Score =  194 bits (493), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 53/251 (21%), Positives = 101/251 (40%), Gaps = 30/251 (11%)

Query: 1   MYRY-------SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKN 53
           M R            LC  +LL GC +  ++    P  +P+                   
Sbjct: 1   MNRISVPRFSVLIASLCGITLLSGCVAPTAK-PNDPYYAPVLP--------------RTP 45

Query: 54  SDSTKKSYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL 112
             +   + ++++      L+ D +A  +GDI+T+ +     A     +  +++++    L
Sbjct: 46  MSAAANNGAIYQAGFEQNLYGDRKAFRIGDIITITLSERMAASKAATSAMTKDSTNSIGL 105

Query: 113 SGGFSLFGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
           +  F              ++ N  Y+G   + G G  +++  L   +   V   L NG L
Sbjct: 106 TSLFGSGLTTNNPIGGNDLSLNAGYNGARTTKGDGKAAQSNSLTGSVTVTVADFLPNGIL 165

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
            + G + + +N     + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P  
Sbjct: 166 AVRGEKWMTLNTGDELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGW 225

Query: 228 GHQLIENLSPL 238
             +    LSPL
Sbjct: 226 FDRFF--LSPL 234


>gi|259907637|ref|YP_002647993.1| Flagellar L-ring protein, FlgH [Erwinia pyrifoliae Ep1/96]
 gi|224963259|emb|CAX54743.1| Flagellar L-ring protein, FlgH [Erwinia pyrifoliae Ep1/96]
 gi|310764857|gb|ADP09807.1| Flagellar L-ring protein, FlgH [Erwinia sp. Ejp617]
          Length = 245

 Score =  194 bits (493), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 55/233 (23%), Positives = 93/233 (39%), Gaps = 10/233 (4%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
               +  + LL GC      I   P +          +  P        S S  +S    
Sbjct: 22  RVAAISAALLLTGCA----HIMQQPLV------QGPTSATPLQMAPTGASGSLFQSGQAM 71

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP 124
              +  +F+D R  NVGD LT+ ++ +  A   +    +RN S    L    S       
Sbjct: 72  NYGYQPMFEDRRPRNVGDTLTILLQENVSASKSSSASANRNGSAGMGLEVVPSSVSGALG 131

Query: 125 QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
               + N +G    +GKG  +        I   V  +L NGNL + G +++ +N     +
Sbjct: 132 NGKLDFNAEGQSDFAGKGGAAARNTFTGTITVTVNQLLPNGNLQVVGEKQIAINQGTEFI 191

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
             +G+V P+ +   N+VS  ++++ARI Y G G   E        +++ N+SP
Sbjct: 192 RFSGVVNPRTISGSNTVSSTQVSDARIEYVGNGYINESQNMGWLQRVLLNISP 244


>gi|302037630|ref|YP_003797952.1| flagellar L-ring protein FlgH [Candidatus Nitrospira defluvii]
 gi|300605694|emb|CBK42027.1| Flagellar L-ring protein FlgH [Candidatus Nitrospira defluvii]
          Length = 238

 Score =  194 bits (493), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 61/244 (25%), Positives = 110/244 (45%), Gaps = 30/244 (12%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
           R+ +  L   +++ GC +S S      +M+ +                           S
Sbjct: 15  RFIWFGLALCAMV-GCSASPSTKQQKVEMAKLPPPKTM--------------------GS 53

Query: 63  LWR--DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG------ 114
           LW+  +  A L++D RA+ +GDI+T+ I    +      T   R++++   + G      
Sbjct: 54  LWQEENGRAYLYEDLRAMRIGDIITILIVEKHKGSKSADTNAERDSTISNGIGGTGMGYL 113

Query: 115 -GFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
               +      +    ++        GKG+ +R + L   I+AIVT +L NG+L + G +
Sbjct: 114 GIPGIRLGGEAKRGFGVDATAKSKFGGKGATNREDTLTGTISAIVTEVLPNGDLRVEGRR 173

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           EV VN E + + + GIVR  DV+  N+V    IA+A+I Y G G   ++ RP    ++++
Sbjct: 174 EVTVNSERQIMTIGGIVRRVDVNTKNTVQSSAIADAKIEYSGLGVVDDVQRPGWLVRILD 233

Query: 234 NLSP 237
            + P
Sbjct: 234 WVYP 237


>gi|270262398|ref|ZP_06190669.1| flagellar L-ring protein [Serratia odorifera 4Rx13]
 gi|270043082|gb|EFA16175.1| flagellar L-ring protein [Serratia odorifera 4Rx13]
          Length = 233

 Score =  194 bits (493), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 50/235 (21%), Positives = 89/235 (37%), Gaps = 12/235 (5%)

Query: 4   YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLD-ENNRMPFLGIDFKNSDSTKKSYS 62
             ++       L GC              P    +D      P        + S  ++  
Sbjct: 9   KRWLAAMAMLTLSGCA-----------YIPHKPLVDGATTAQPAPAGAPVPNGSIFQTVQ 57

Query: 63  LWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ 122
                +  LF+D R  N+GD LT+ ++ +  A   +    SRN +    ++         
Sbjct: 58  PMNYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRNGASKFGVATSPRYLDGL 117

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
                 +++  G     GKG  +     +  I   V  +L NGNL + G +++ +N    
Sbjct: 118 LGNARADMDISGDSTFGGKGGANANNTFSGTITVTVNQVLVNGNLHVVGEKQIAINQGTE 177

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            +  +G+V P+ +   NSV+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 178 FIRFSGVVNPRTISGSNSVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNVSP 232


>gi|91794992|ref|YP_564643.1| flagellar basal body L-ring protein [Shewanella denitrificans
           OS217]
 gi|91716994|gb|ABE56920.1| flagellar L-ring protein [Shewanella denitrificans OS217]
          Length = 219

 Score =  194 bits (493), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 60/225 (26%), Positives = 94/225 (41%), Gaps = 19/225 (8%)

Query: 16  FGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALFKD 74
            GC + + E    P                +   +   S    K  SL+R  +   LFKD
Sbjct: 12  SGCAAHLPEAETKPD------------TKDWAPPEVDYSLPDAKDGSLYRPGYMLTLFKD 59

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
            RA   GDILTV +     +     T  ++   +   LSG       +T       N   
Sbjct: 60  KRAYREGDILTVALDEKTYSSKKADTKTNKQQGMSLGLSGSAGSEDVKTNG-----NASL 114

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
               SG GS ++  +L+  I   V+ +L NG L+I G + +R+N     L + G++R  D
Sbjct: 115 NRGFSGMGSSTQQNQLSGSITVTVSKVLPNGTLLIRGEKWLRLNQGDEYLRLLGLIRADD 174

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS-PL 238
           +D  N++S  +IA+ARI YGG+G   +        +   +   PL
Sbjct: 175 IDNTNTISSQRIADARIIYGGQGAIADSNAMGWASRYFNSPWFPL 219


>gi|289666051|ref|ZP_06487632.1| flagellar basal body L-ring protein [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 230

 Score =  194 bits (493), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 48/229 (20%), Positives = 99/229 (43%), Gaps = 16/229 (6%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           + +  S+LL GC ++  ++    +++P+   +                 +   + +++  
Sbjct: 12  LAIACSTLLGGCVAAG-DVRPFAELAPIVPVV--------------APVAQPTAGAIYAA 56

Query: 67  SHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
                L+ D RA +VGD+LTV++     A     T  S+ ++                  
Sbjct: 57  GPGLNLYGDRRARDVGDLLTVNLVESTTASSTANTSISKKDATTMSAPTLLGAPLTVGGL 116

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
                + +G  + +GKG+ +++ ++   +   V   L NGNL+I G + +R+      + 
Sbjct: 117 NVLENSTNGDRSFAGKGNTAQSNRMQGSVTVTVMQRLPNGNLVIQGQKNLRLTQGDELVQ 176

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           V GIVR  D+   N+V   ++A+ARI+YGG+G   +        +   +
Sbjct: 177 VQGIVRAADIAPDNTVPSSRVADARIAYGGRGAIAQSNAMGWLSRFFNS 225


>gi|71906394|ref|YP_283981.1| flagellar L-ring protein [Dechloromonas aromatica RCB]
 gi|110816528|sp|Q47I20|FLGH_DECAR RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|71846015|gb|AAZ45511.1| Flagellar L-ring protein [Dechloromonas aromatica RCB]
          Length = 219

 Score =  194 bits (493), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 59/238 (24%), Positives = 96/238 (40%), Gaps = 21/238 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R   I L  +    GC +                    N   P         +    +
Sbjct: 1   MKRLVLISLVLA---AGCSTVPP----------------TNVHQPMTARPSPRFEMANGN 41

Query: 61  YSLWRD-SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            S+++  S   LF+D RA  VGD +TV I     A   +     ++N+    L     +F
Sbjct: 42  GSIYQAASSRPLFEDRRARFVGDTITVKITESTTASTKSNNKVDQSNAQKYGLGASTGMF 101

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
           G+  P    +++     A SGKG  +        +   V  ++ NGNL++SG ++V +  
Sbjct: 102 GRVLPGA-MDMSASSSTAFSGKGEAANNNIFTGNMTVTVIDVMPNGNLLVSGEKQVAIGS 160

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           E   + ++G+V P  VDA N V   KIA+ARI Y   G+ ++        +   N+ P
Sbjct: 161 EQEFVRISGVVNPSFVDAFNVVDSSKIADARIEYKSSGQVSDGQVMGWLARFFLNVMP 218


>gi|197104379|ref|YP_002129756.1| flagellar L-ring protein FlgH [Phenylobacterium zucineum HLK1]
 gi|196477799|gb|ACG77327.1| flagellar L-ring protein FlgH [Phenylobacterium zucineum HLK1]
          Length = 254

 Score =  194 bits (493), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 89/249 (35%), Positives = 128/249 (51%), Gaps = 14/249 (5%)

Query: 2   YRYSFIVLCYSSLL----FGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDS- 56
            R     +    LL      C + ++E    P+++P+G       R   +       +  
Sbjct: 6   MRIRLTAIAAPLLLGASLAACST-VTEAVRGPELAPVGYPAALVPREQNVLPLASAREPL 64

Query: 57  --TKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG 114
                + SLWR    A F D RA  VGDILTV I IDD A   N T  SR++        
Sbjct: 65  PHPASANSLWRAGARAFFVDQRAGRVGDILTVQIDIDDSAKTINSTTSSRSSGTTMGFPH 124

Query: 115 GFSLFGQQTPQMNGN------LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLI 168
              L       + G       ++     +++G G+++RAEK++L IAA+VT +L NGN+ 
Sbjct: 125 LLGLESSLGRILPGEFDPANAVDVGSKTSNTGAGAVNRAEKISLTIAAVVTGVLPNGNMT 184

Query: 169 ISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIG 228
           I G+QEVR N +IR L V GIVRP+D+ A N++ + +IAEARISYGG+G  + + + P G
Sbjct: 185 IQGTQEVRTNTDIRQLTVAGIVRPEDISASNTIRHTQIAEARISYGGRGDISRVQKTPAG 244

Query: 229 HQLIENLSP 237
             LIE  SP
Sbjct: 245 QSLIERFSP 253


>gi|91225876|ref|ZP_01260845.1| flagellar L-ring protein precursor H [Vibrio alginolyticus 12G01]
 gi|269965421|ref|ZP_06179540.1| flagellar L-ring protein precursor [Vibrio alginolyticus 40B]
 gi|91189526|gb|EAS75802.1| flagellar L-ring protein precursor H [Vibrio alginolyticus 12G01]
 gi|269829900|gb|EEZ84130.1| flagellar L-ring protein precursor [Vibrio alginolyticus 40B]
          Length = 259

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 48/259 (18%), Positives = 97/259 (37%), Gaps = 27/259 (10%)

Query: 1   MYRYSFIVLCYSSLLFGC-------------HSSISEITGIPQMSPMGSSL--------D 39
           M R   + L  +  + GC              +++ +     +     S +        D
Sbjct: 1   MKRICLLALIAT--MSGCAMLEPIETDEVTQATTVVDAVEGDKSKEESSGIVDTLRGRSD 58

Query: 40  ENNRMPFLGIDFKNSDS---TKKSYSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAV 95
                P        +        + SL+   H   L+ DS+   +GDI+TV +     A 
Sbjct: 59  PVAGDPAWAPIHPKNKPEHYAAATGSLFSAEHITDLYDDSKPRGIGDIITVTLDETTSAT 118

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
                  S+ N              Q   + N + + +   + +G  S  ++  ++  I 
Sbjct: 119 KSANADLSKTNEAQMDPLQVGGEELQIGGKYNFSYDLNNSNSFAGDSSAKQSNSISGYIT 178

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             V  +L NGNL+I G + + +N     + ++G +RP D++  N+++ ++++ ARI Y G
Sbjct: 179 VEVIEVLANGNLVIRGEKWMTLNTGDEYIRLSGTIRPDDINFDNTIASNRVSNARIQYSG 238

Query: 216 KGRTTELLRPPIGHQLIEN 234
            G   ++  P    +    
Sbjct: 239 TGLQQDMQEPGFLARFFNV 257


>gi|94267696|ref|ZP_01290965.1| Flagellar L-ring protein [delta proteobacterium MLMS-1]
 gi|93451898|gb|EAT02629.1| Flagellar L-ring protein [delta proteobacterium MLMS-1]
          Length = 242

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 61/249 (24%), Positives = 107/249 (42%), Gaps = 20/249 (8%)

Query: 1   MYRYSFIVLCYSSLL-----FGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSD 55
           M R S I+     +       GC ++        +++P      E     F   + +   
Sbjct: 1   MKRQSLIMPALLIIGLGLNLAGCSTT---GGSSAEVAP-----SERLPERFALPETERPR 52

Query: 56  STKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG 114
              +  +++       L++D RA ++GDI+ V +           T   R +SL   L+ 
Sbjct: 53  EVAREGTIYNGGQGLDLYRDGRARDIGDIVQVRVVETSSGQKSADTSTDRGSSLSGGLTS 112

Query: 115 GFSLFG------QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLI 168
            F L         +       ++        G G  SR   +   I+A +     +GNL+
Sbjct: 113 FFGLENWVNERSSKFALTPNAMDARMNNEFEGGGDTSRDSDVTATISARIVDKTMDGNLV 172

Query: 169 ISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIG 228
           I G QEVRVN+E + + ++G+VRP D+ + N+V  ++IA+ARI Y GKG   +  RP   
Sbjct: 173 IRGYQEVRVNNETQFIILSGLVRPDDITSDNAVLSNRIADARIEYSGKGELADKQRPGWL 232

Query: 229 HQLIENLSP 237
            + ++ + P
Sbjct: 233 SRTVDAVWP 241


>gi|114777907|ref|ZP_01452821.1| hypothetical protein SPV1_05779 [Mariprofundus ferrooxydans PV-1]
 gi|114551694|gb|EAU54246.1| hypothetical protein SPV1_05779 [Mariprofundus ferrooxydans PV-1]
          Length = 231

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 108/240 (45%), Gaps = 16/240 (6%)

Query: 2   YRYSFIVLCYS-SLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
            R +  +LC +  +L GC   + ++             D   +          S+ T  S
Sbjct: 3   IRTAICLLCIAPVILGGCMPRVDKVA------------DAQQKQVVNQALATPSEDTSSS 50

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG---FS 117
            SLW    A L  DS+A  VGD++TV +     A     + +S+ ++    L+       
Sbjct: 51  GSLWAGGGAGLISDSKASRVGDLVTVLVSESASATRSLGSKQSKKSARDTGLTANIKYGG 110

Query: 118 LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
             G      +G++      +  G GS + ++ L   + ++VT +  NGN+ I G +++ +
Sbjct: 111 ALGNADVNPSGSIGMTNSKSFDGSGSTNSSDTLTASVTSVVTTVYPNGNMRIIGKRQLVI 170

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N E + +  +G++RP D+   N+++  K+A+A ISYGG G   +        + ++N+ P
Sbjct: 171 NHEPQEITFSGVIRPVDIAPDNTITSAKVAQADISYGGTGSLADTAHEGWLSKTLDNIWP 230


>gi|269138585|ref|YP_003295285.1| flagellar basal body L-ring protein [Edwardsiella tarda EIB202]
 gi|267984245|gb|ACY84074.1| flagellar basal body L-ring protein [Edwardsiella tarda EIB202]
 gi|304558595|gb|ADM41259.1| Flagellar L-ring protein FlgH [Edwardsiella tarda FL6-60]
          Length = 228

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 53/243 (21%), Positives = 95/243 (39%), Gaps = 22/243 (9%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M ++S + L  +  L GC                     +             +   + +
Sbjct: 1   MQKHSGVALLCALALSGCA----------------YIPHDRVVTGPTTATPAPATPPRPN 44

Query: 61  YSLWRD------SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG 114
            S+++        +  LF+D R  N+GDILT+ ++ +  A   +    SRN +     + 
Sbjct: 45  GSIFQGVQPMNYGYQPLFEDRRPRNIGDILTIVLQENVSASKSSSANASRNGTSKFDFAT 104

Query: 115 GFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
                         N+  +G    +GKG  +     +  I   V  +L NGNL + G ++
Sbjct: 105 VPRYLEGLFGNARANMEANGDNQFNGKGGANANNTFSGTITVTVDDVLSNGNLKVVGEKQ 164

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           + +N     +  +G+V P+ +  +NSV   ++A+ARI Y G G   E        +   N
Sbjct: 165 IAINQGTEYIRFSGVVNPRTISGNNSVPSTQVADARIEYVGSGYINEAQNMGWMQRFFLN 224

Query: 235 LSP 237
           LSP
Sbjct: 225 LSP 227


>gi|156973590|ref|YP_001444497.1| flagellar basal body L-ring protein [Vibrio harveyi ATCC BAA-1116]
 gi|156525184|gb|ABU70270.1| hypothetical protein VIBHAR_01293 [Vibrio harveyi ATCC BAA-1116]
          Length = 260

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 47/259 (18%), Positives = 96/259 (37%), Gaps = 26/259 (10%)

Query: 1   MYRYSFIVLCYSSLLFGCH------------------------SSISEITGIPQMSPMGS 36
           M +    +L   + + GC                         S       I  M     
Sbjct: 1   MMKRI-CLLALITTMSGCAMLEPIETDEVSQATTVVDAVEGDKSKEESNGIIDTMRGRTD 59

Query: 37  SLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAV 95
            +  +     +    K       + SL+   H   L+ DS+   +GDI+TV +    +A 
Sbjct: 60  PVAGDPAWAPIHPKQKPEHYAAATGSLFSTEHITDLYDDSKPRGIGDIITVTLDETTRAT 119

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
              +   S+ N    +         +   + N + + +     +G  S  ++  ++  I 
Sbjct: 120 KSAKADLSKTNDAKMEPLSVGGQELKIGGKYNFSYDLNNTNTFAGDSSAKQSNSISGYIT 179

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             V  +L NGNL+I G + + +N     + ++G +RP D++  N+++ ++++ ARI Y G
Sbjct: 180 VEVIEVLANGNLVIRGEKWMTLNTGDEYIRLSGTIRPDDINFDNTIASNRVSNARIQYSG 239

Query: 216 KGRTTELLRPPIGHQLIEN 234
            G   ++  P    +    
Sbjct: 240 TGSPQDMQEPGFLARFFNV 258


>gi|120554036|ref|YP_958387.1| flagellar L-ring protein [Marinobacter aquaeolei VT8]
 gi|120323885|gb|ABM18200.1| flagellar L-ring protein [Marinobacter aquaeolei VT8]
          Length = 230

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 53/235 (22%), Positives = 95/235 (40%), Gaps = 22/235 (9%)

Query: 5   SFIVLCYSSLLFGCH--SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
           +   L    LL GC   S    I   P+ +P+                       + S S
Sbjct: 12  TLATLVVLILLQGCTAMSRPRAIPDDPEFAPVRP--------------QAMMQRDRASGS 57

Query: 63  LWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           +++ S     + D+ ALNVGD+LTV ++   +A  +  T   ++N +             
Sbjct: 58  IYQVSRNYNFYGDTVALNVGDVLTVTLQESTRASKNADTRIIKDNEIKLPEPNILGKSNF 117

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
                    + +       +    ++  L   I   VT +L NG L I G + + + +  
Sbjct: 118 GIGT-----SLNNERDFKTRADADQSNSLAGSITVSVTEVLPNGVLRIRGEKWLSLTNGE 172

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
             + +TG+VRP+D+   NSV+ ++IA+ARI+YGG G   +  +     +   +  
Sbjct: 173 EYIRLTGLVRPRDIQPDNSVASNRIADARIAYGGTGDFDQANQMGWLARFFNSEW 227


>gi|313672188|ref|YP_004050299.1| flagellar l-ring protein [Calditerrivibrio nitroreducens DSM 19672]
 gi|312938944|gb|ADR18136.1| flagellar L-ring protein [Calditerrivibrio nitroreducens DSM 19672]
          Length = 244

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 59/246 (23%), Positives = 111/246 (45%), Gaps = 22/246 (8%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            +   +++    +  GC S +             +++   +    +    K +     + 
Sbjct: 10  IKMVSLLITSIVIFSGCASKVE------------TNVPTADYKKEIEEYHKRTAPKAPTA 57

Query: 62  SLWRD--SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL- 118
           SLW D  + +ALF D +   +GDI+ V I     A   N T  S+ +S    L+    L 
Sbjct: 58  SLWTDIGNSSALFLDYKGRTIGDIVIVKIVESSSATNSNSTSASKTSSYDMGLTNLLGLP 117

Query: 119 -------FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
                  F      ++  +      + +G+G   +++++   +AA V  +L +GNL+I G
Sbjct: 118 TNLGVKNFLGTGNPLDPTVKESTKNSFTGQGKKQKSDQVKATMAARVVDVLPSGNLVIEG 177

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
            +E+ V+ E + + V GI+R +D+DA N V    IA+A+ISY GKG  ++  +      +
Sbjct: 178 QREIIVDQEKQVITVKGIIRQKDIDADNQVLSTAIADAQISYSGKGVISDSNKKGWLSNI 237

Query: 232 IENLSP 237
           I+ + P
Sbjct: 238 IDWVWP 243


>gi|126175143|ref|YP_001051292.1| flagellar basal body L-ring protein [Shewanella baltica OS155]
 gi|125998348|gb|ABN62423.1| flagellar L-ring protein [Shewanella baltica OS155]
          Length = 224

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 47/221 (21%), Positives = 89/221 (40%), Gaps = 17/221 (7%)

Query: 19  HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA-LFKDSRA 77
            +    +   P  +P+                         + S+++DS A+ L+ D RA
Sbjct: 18  STQKKPLADDPFYAPVYPE--------------APPTKIAATGSIYQDSQASSLYSDIRA 63

Query: 78  LNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGA 137
             VGDI+T+ ++   QA         + + +                 +  +L Y     
Sbjct: 64  HKVGDIITIVLKESTQAKKSAGNQIKKGSDMSLD-PIFAGGSNISVGGVPLDLRYKDSMN 122

Query: 138 SSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDA 197
           +  +    ++  L+  I+A V  +L NG+L+I G + + +N+    + VTG+VR QD+  
Sbjct: 123 TKRESDADQSNSLDGSISANVMQVLNNGSLVIRGEKWISINNGDEFIRVTGLVRSQDIKP 182

Query: 198 HNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
            N++   ++A ARI Y G G   +  +     Q   +   P
Sbjct: 183 DNTIDSTRMANARIQYSGTGTFADAQKVGWLSQFFMSDWWP 223


>gi|315180482|gb|ADT87396.1| flagellar L-ring protein precursor H [Vibrio furnissii NCTC 11218]
          Length = 234

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 57/235 (24%), Positives = 97/235 (41%), Gaps = 18/235 (7%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
           RY  + L  S  L GC    S+         +  S D+ +  P    +     +     S
Sbjct: 14  RYVVLALV-SMTLVGCAGRTSDF--------VPPSPDDADFAP---PEINYDVARVSKGS 61

Query: 63  LWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           L+  + A  LF+D RA  VGDILTV +    ++     T   +N++    +         
Sbjct: 62  LYTGNAAMTLFQDRRAYRVGDILTVLLNEKTESDKSATTKYGKNSNASLNVPTL-----G 116

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
                N + +  G    +G  +  +   L+  I   V  +L NG L + G + +++N   
Sbjct: 117 THVFDNLSASASGNRDFAGSAASKQGNSLSGSITVTVYQVLPNGVLRVRGEKWLKLNQGD 176

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
             + +TG VR  D+ A N++S  +IA+ARI+Y G+G   +        Q   +  
Sbjct: 177 EFIRLTGNVRASDISADNTLSSQRIADARITYAGRGSFADTNTAGWLTQFFNSPW 231


>gi|37679150|ref|NP_933759.1| flagellar basal body L-ring protein [Vibrio vulnificus YJ016]
 gi|320157106|ref|YP_004189485.1| flagellar L-ring protein FlgH [Vibrio vulnificus MO6-24/O]
 gi|61213555|sp|Q7MMV1|FLGH_VIBVY RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|37197892|dbj|BAC93730.1| flagellar basal body L-ring protein FlgH [Vibrio vulnificus YJ016]
 gi|319932418|gb|ADV87282.1| flagellar L-ring protein FlgH [Vibrio vulnificus MO6-24/O]
          Length = 259

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 52/259 (20%), Positives = 98/259 (37%), Gaps = 27/259 (10%)

Query: 1   MYRYSFIVLCYSSLLFGC-------------HSSISEITGIPQMSPMGSSL--------D 39
           M R S I L    L+ GC              +++ +     +     S +        D
Sbjct: 1   MKRISLIALVT--LMSGCTMLEPIETPEVVNATTVVDAVEGDKSKDESSGIVDTLRGRSD 58

Query: 40  ENNRMPFLGIDFKNSDS---TKKSYSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAV 95
                P                ++ SL+  +H + L+ DS+   VGDI+TV +     A 
Sbjct: 59  PVAGDPAWAPIHPKQQPEHYAAETGSLFSVNHLSNLYDDSKPRGVGDIITVTLDEKTNAS 118

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
                  S++N              +   + N + N       +G  S  ++  ++  I 
Sbjct: 119 KSANADLSKSNDSSMDPLEVGGQELKIDGKYNFSYNLTNSNNFTGDASAKQSNSISGYIT 178

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             V  +L NGNL+I G + + +N     + ++G +RP D+   N+++ ++++ ARI Y G
Sbjct: 179 VEVIEVLANGNLVIRGEKWLTLNTGDEYIRLSGTIRPDDISFDNTIASNRVSNARIQYSG 238

Query: 216 KGRTTELLRPPIGHQLIEN 234
            G   ++  P    +    
Sbjct: 239 TGTQQDMQEPGFLARFFNV 257


>gi|315931885|gb|EFV10840.1| flagellar L-ring family protein [Campylobacter jejuni subsp. jejuni
           327]
          Length = 232

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 63/244 (25%), Positives = 104/244 (42%), Gaps = 20/244 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  F VL ++    GC +++      PQ+S    +  E           ++++     
Sbjct: 1   MKKVLFYVLPFAFF--GCSATVD-----PQISMKPPAYVEE------LAPKQSNNVESAP 47

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SL+      LF D +A+NV D++TV I+             SR N+            G
Sbjct: 48  GSLFGKGDNPLFSDKKAMNVNDLVTVVIQESTTQSTQANKATSRTNTSKLGGGALTGSSG 107

Query: 121 QQTPQMNG-------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                +N            +     +G GS SR E     I+  V  IL NGN  I GS+
Sbjct: 108 VVANALNKVNAYSNIGFQTNSSNNYTGTGSQSRNESFKTTISTRVIKILSNGNYFIEGSR 167

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G      R P G ++IE
Sbjct: 168 ELLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKILYKTEGEVDRSTRKPWGSKVIE 227

Query: 234 NLSP 237
            + P
Sbjct: 228 AIWP 231


>gi|194365677|ref|YP_002028287.1| flagellar basal body L-ring protein [Stenotrophomonas maltophilia
           R551-3]
 gi|226701934|sp|B4SIL5|FLGH_STRM5 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|194348481|gb|ACF51604.1| flagellar L-ring protein [Stenotrophomonas maltophilia R551-3]
          Length = 230

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 47/197 (23%), Positives = 87/197 (44%), Gaps = 3/197 (1%)

Query: 39  DENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFD 97
                 P   I    +  T  + +++       L+ D RA +VGD+LT+ +  +  A   
Sbjct: 31  PYPTMAPIQPIMPPQAQPT--AGAIYAAGPTLQLYSDRRARDVGDLLTISLLENTTAQTS 88

Query: 98  NQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI 157
             T  ++ ++L       F        +   + +  G    +GKG+ +++ +L   +   
Sbjct: 89  ANTATNKESNLSLGTPSIFGAPVTLGGKDILSASAKGARDFTGKGNSAQSNRLQGNVTVT 148

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           V   L NGNL++ G + +R+N     + V GIVRP D+   N++   ++AEARI YGG+G
Sbjct: 149 VIQRLPNGNLVVQGQKNLRLNQGDELVQVQGIVRPGDISQDNTIPSSRVAEARIVYGGRG 208

Query: 218 RTTELLRPPIGHQLIEN 234
              +        +   +
Sbjct: 209 PVAQSNAMGWLSRFFNS 225


>gi|121612803|ref|YP_001000383.1| flagellar basal body L-ring protein [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|167005328|ref|ZP_02271086.1| flagellar basal body L-ring protein [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|283956097|ref|ZP_06373584.1| putative flagellar L-ring protein precursor [Campylobacter jejuni
           subsp. jejuni 1336]
 gi|166214819|sp|A1VZ42|FLGH_CAMJJ RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|87249515|gb|EAQ72475.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|283792417|gb|EFC31199.1| putative flagellar L-ring protein precursor [Campylobacter jejuni
           subsp. jejuni 1336]
          Length = 232

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 64/244 (26%), Positives = 106/244 (43%), Gaps = 20/244 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  F VL ++    GC +++      PQ+S    +  E           ++++     
Sbjct: 1   MKKVLFYVLPFAFF--GCSATVD-----PQISMKPPAYVEE------LAPKQSNNVESAP 47

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SL+      LF D +A+NV D++TV I+             SR N+ +          G
Sbjct: 48  GSLFGKGDNPLFSDKKAMNVNDLVTVVIQESTTQSTQANKATSRTNTSNLGGGALTGSSG 107

Query: 121 QQTPQMNG-------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                +N            +     +G GS SR E  N  I+  V  IL NGN  I GS+
Sbjct: 108 VVANALNKVNAYSNIGFQTNSSNKYTGTGSQSRNESFNTTISTRVIKILSNGNYFIEGSR 167

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G      R P G ++IE
Sbjct: 168 ELLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKILYKTEGEVDRSTRKPWGSKVIE 227

Query: 234 NLSP 237
            + P
Sbjct: 228 AIWP 231


>gi|294624041|ref|ZP_06702804.1| flagellar L-ring protein precursor [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292601660|gb|EFF45634.1| flagellar L-ring protein precursor [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 230

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 56/237 (23%), Positives = 101/237 (42%), Gaps = 18/237 (7%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
           R  F   C S+LL GC ++  ++    +M P+   +                 +   + +
Sbjct: 9   RLCFATAC-SALLGGCVAAG-DVRPFAEMRPIVPVV--------------APVAQPTAGA 52

Query: 63  LWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           ++       L+ D RA +VGD+LTV++     A     T  S+ ++              
Sbjct: 53  IYAAGPGLNLYGDRRARDVGDLLTVNLVESTTASSTANTSISKKDATTMAAPTLLGAPLT 112

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
                    +  G  + +GKG+ +++ ++   +   V   L NGNL+I G + +R+    
Sbjct: 113 VGGLNVLENSTSGDRSFAGKGNTAQSNRMQGSVTVTVMQRLPNGNLVIQGQKNLRLTQGD 172

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
             + V GIVR  D+   N+V   K+A+ARI+YGG+G   +        +   + LSP
Sbjct: 173 ELVQVQGIVRAADIAPDNTVPSSKVADARIAYGGRGAIAQSNAMGWLSRFFNSRLSP 229


>gi|85859198|ref|YP_461400.1| flagellar L-ring protein [Syntrophus aciditrophicus SB]
 gi|85722289|gb|ABC77232.1| flagellar L-ring protein [Syntrophus aciditrophicus SB]
          Length = 238

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 56/229 (24%), Positives = 99/229 (43%), Gaps = 24/229 (10%)

Query: 16  FGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA--LFK 73
            GC +        P  +     LD   R           ++     S+W    A+  LF 
Sbjct: 26  TGCATK-------PDFTAGEQPLDLTVR----------PEALPVRGSIWPGESASNMLFA 68

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN---- 129
           D +A  + DI+T+ I    Q      T  SR++     +   + L      +        
Sbjct: 69  DKKARYINDIVTILINEASQGGNKATTNTSRDSDSAAGIDAFWGLDQSILSRNVNMGSKI 128

Query: 130 -LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
            +         G G+ +R  +L   + A V  +L+NGNL+I G +++ +N+E + L ++G
Sbjct: 129 KIGGSSSSTLKGTGNTTRGGQLKGTVTARVVRVLDNGNLVIEGRRQLTINEEDQYLIISG 188

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           I+RP+D+   N +    IA+ARI Y GKG   + +RP    ++++ + P
Sbjct: 189 IIRPEDITTENCIFSQYIADARIVYAGKGIINDKMRPGWATRIVDWVWP 237


>gi|157961174|ref|YP_001501208.1| flagellar basal body L-ring protein [Shewanella pealeana ATCC
           700345]
 gi|157846174|gb|ABV86673.1| flagellar L-ring protein [Shewanella pealeana ATCC 700345]
          Length = 217

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 54/231 (23%), Positives = 93/231 (40%), Gaps = 18/231 (7%)

Query: 10  CYSSLLFGC-HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH 68
              + + GC  ++   I   P  +P+                         + S+++DS 
Sbjct: 1   MLMAAISGCNSTNGKPIADDPYYAPVYPE--------------APPTKIAATGSMYQDSQ 46

Query: 69  AA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           A+ L+ D +AL VGDI+TV +    QA        S+   L                   
Sbjct: 47  ASSLYSDIKALKVGDIITVLLMEQTQAKKSANNEISKGTDLSLD-PIYAGGGNVTIGGNP 105

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            +L Y     +  +    ++  L+  I+A V  +L NGNL+I G + + +N+    + +T
Sbjct: 106 IDLRYKDSMNTKRESDADQSNSLSGSISANVMQVLNNGNLVIRGEKWISINNGDEFVRIT 165

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE-NLSP 237
           GIVR QD+   N++   ++A ARI Y G G   E+ +          +  P
Sbjct: 166 GIVRAQDIRPDNTIDSQRVANARIQYSGTGTFAEVQKVGWLASFFMGSWWP 216


>gi|86153207|ref|ZP_01071411.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           HB93-13]
 gi|85842933|gb|EAQ60144.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           HB93-13]
          Length = 232

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 64/244 (26%), Positives = 105/244 (43%), Gaps = 20/244 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  F VL +     GC +++      PQ+S    +  E           ++++     
Sbjct: 1   MKKVLFYVLPFVFF--GCSATVD-----PQISMKPPAYVEE------LAPKQSNNVESAP 47

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SL+      LF D +A+NV D++TV I+             SR N+ +          G
Sbjct: 48  GSLFGKGDNPLFSDKKAMNVNDLVTVVIQESTTQSTQANKATSRTNTSNLGGGALTGSSG 107

Query: 121 QQTPQMNG-------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                +N            +     +G GS SR E  N  I+  V  IL NGN  I GS+
Sbjct: 108 VVANALNKVNAYSNIGFQTNSSNKYTGTGSQSRNESFNTTISTRVIKILSNGNYFIEGSR 167

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G      R P G ++IE
Sbjct: 168 ELLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKILYKTEGEVDRSTRKPWGSKVIE 227

Query: 234 NLSP 237
            + P
Sbjct: 228 AIWP 231


>gi|159045794|ref|YP_001534588.1| flagellar basal body L-ring protein [Dinoroseobacter shibae DFL 12]
 gi|157913554|gb|ABV94987.1| flagellar basal body L-ring protein [Dinoroseobacter shibae DFL 12]
          Length = 242

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 83/242 (34%), Positives = 120/242 (49%), Gaps = 7/242 (2%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            R     +    +L  C   I+++   P  +   S  +    +       +  D   +  
Sbjct: 1   MRIFVPFVACLVVLSAC-GRIADVGQAPDFTASSSGSEYQAMISAPIASDRTIDRAPERA 59

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLW  +  +L  D RA   GDILTV I IDD+A   N + RSR+ S    +   F L  +
Sbjct: 60  SLWSGTRNSLLGDRRAGQNGDILTVVIEIDDRAEISNSSERSRSGSETLAIDDFFGLPQR 119

Query: 122 QTPQMNGNLNYDGGGASSGKGSIS------RAEKLNLLIAAIVTAILENGNLIISGSQEV 175
             P++    +       S  GS S      R EKL L +AA V  ++ NG   I G+QEV
Sbjct: 120 IDPRLPEGASLGSAVGVSSNGSSSGDGSVSRREKLTLRVAATVVGVMPNGVFEIQGTQEV 179

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
           RVN E+R L VTG VRP+D+   N ++YDKIA ARISY G+G+ T++ +P  G Q+ + +
Sbjct: 180 RVNFELRELIVTGFVRPEDISRQNEITYDKIASARISYAGRGQITDVQQPRYGQQIADII 239

Query: 236 SP 237
            P
Sbjct: 240 LP 241


>gi|160876200|ref|YP_001555516.1| flagellar basal body L-ring protein [Shewanella baltica OS195]
 gi|217972601|ref|YP_002357352.1| flagellar basal body L-ring protein [Shewanella baltica OS223]
 gi|304409975|ref|ZP_07391594.1| flagellar L-ring protein [Shewanella baltica OS183]
 gi|307302312|ref|ZP_07582070.1| flagellar L-ring protein [Shewanella baltica BA175]
 gi|189044482|sp|A9KWR9|FLGH_SHEB9 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|254789284|sp|B8E9X5|FLGH_SHEB2 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|160861722|gb|ABX50256.1| flagellar L-ring protein [Shewanella baltica OS195]
 gi|217497736|gb|ACK45929.1| flagellar L-ring protein [Shewanella baltica OS223]
 gi|304351384|gb|EFM15783.1| flagellar L-ring protein [Shewanella baltica OS183]
 gi|306914350|gb|EFN44771.1| flagellar L-ring protein [Shewanella baltica BA175]
 gi|315268390|gb|ADT95243.1| flagellar L-ring protein [Shewanella baltica OS678]
          Length = 224

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 47/221 (21%), Positives = 89/221 (40%), Gaps = 17/221 (7%)

Query: 19  HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA-LFKDSRA 77
            +    +   P  +P+                         + S+++DS A+ L+ D RA
Sbjct: 18  STQKKPLADDPFYAPVYPE--------------APPTKIAATGSIYQDSQASSLYSDIRA 63

Query: 78  LNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGA 137
             VGDI+T+ ++   QA         + + +                 +  +L Y     
Sbjct: 64  HKVGDIITIVLKESTQAKKSAGNQIKKGSDMSLD-PIFAGGSNVSIGGVPIDLRYKDSMN 122

Query: 138 SSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDA 197
           +  +    ++  L+  I+A V  +L NG+L+I G + + +N+    + VTG+VR QD+  
Sbjct: 123 TKRESDADQSNSLDGSISANVMQVLNNGSLVIRGEKWISINNGDEFIRVTGLVRSQDIKP 182

Query: 198 HNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
            N++   ++A ARI Y G G   +  +     Q   +   P
Sbjct: 183 DNTIDSTRMANARIQYSGTGTFADAQKVGWLSQFFMSDWWP 223


>gi|188534167|ref|YP_001907964.1| flagellar basal body L-ring protein [Erwinia tasmaniensis Et1/99]
 gi|188029209|emb|CAO97081.1| Flagellar L-ring protein [Erwinia tasmaniensis Et1/99]
          Length = 233

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 53/235 (22%), Positives = 88/235 (37%), Gaps = 12/235 (5%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLD-ENNRMPFLGIDFKNSDSTKKSYSL 63
            ++V      L GC            + P    ++      P        + S  +    
Sbjct: 10  RWLVATLLLTLNGCA-----------LVPRKPLVEGSTTAQPLPASPALVNGSIFQGVMP 58

Query: 64  WRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT 123
               +  LF+D R  N+GD LT+ ++ +  A   +     R+ S    L+          
Sbjct: 59  MNYGYQPLFEDRRPRNIGDTLTITLQENVSASKSSSANAGRDGSAEFGLTATPRALVGLL 118

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
                 L   G    SGKG  +        I   V  +L NGNL + G +++ +N     
Sbjct: 119 GGDKSTLGGSGKNDFSGKGGATANNTFTGTITVTVNQVLPNGNLNVIGEKQIEINQGTEF 178

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +  +G+V P+ + A NSV   ++A+ARI Y G G   E        +   N+SP+
Sbjct: 179 IRFSGVVNPRTISASNSVVSTQVADARIEYVGNGYINEAQNMGWLQRFFLNISPM 233


>gi|255322201|ref|ZP_05363347.1| flagellar L-ring protein FlgH [Campylobacter showae RM3277]
 gi|255300574|gb|EET79845.1| flagellar L-ring protein FlgH [Campylobacter showae RM3277]
          Length = 233

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 59/244 (24%), Positives = 104/244 (42%), Gaps = 19/244 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  +     ++ L GC            +      +D    +    +  K  ++   +
Sbjct: 1   MRKNIYFCALAAAFLSGC------------LPSADPRIDMKPPVYVEQLPAKQVNNQPNA 48

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLH-------RKLS 113
            SL+      LF D +A+NV DI+TV I          +   S+N+++           +
Sbjct: 49  GSLFGRGDNPLFADRKAMNVNDIVTVVISERANQSSSGKHDTSKNSTISLGGGIFTAGSA 108

Query: 114 GGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
              +L  Q     +   +       +G GS  RAE     I+A +  +LENGN  I GS+
Sbjct: 109 PLSTLATQLNKAGDIGFSAGNKNEFTGAGSSVRAEAFTTTISARIIKVLENGNYFIEGSR 168

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+ +N E + + ++G++RP D+   N +    IA+A+I Y  +G      R P G +L+E
Sbjct: 169 ELLINGEKQIMQLSGVIRPYDISNANEIDSRYIADAKILYKTEGDVDRATRKPWGTKLME 228

Query: 234 NLSP 237
            + P
Sbjct: 229 AIWP 232


>gi|148980299|ref|ZP_01815986.1| flagellar L-ring protein precursor H [Vibrionales bacterium SWAT-3]
 gi|145961318|gb|EDK26628.1| flagellar L-ring protein precursor H [Vibrionales bacterium SWAT-3]
          Length = 240

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 47/222 (21%), Positives = 84/222 (37%), Gaps = 17/222 (7%)

Query: 16  FGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDS-HAALFKD 74
            GC     +                 N   +   +     +     SL+  +    LF+D
Sbjct: 32  AGCAGRQDDFIP-----------PSPNDEAYAPPELDYQVTRVSKGSLYTGTTSMTLFQD 80

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
            RA  VGDILTV +    ++     T   +++S +                 + + + D 
Sbjct: 81  RRAYRVGDILTVLLDEKTESDKSASTQYGKDSSANITAPTL-----GNKTFEDVSASVDA 135

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
                G  +  +   L+  I   V  +L NG L + G + +++N     + +TG VR  D
Sbjct: 136 TRDFDGAAASKQGNSLSGSITVTVYNVLPNGVLRVRGEKWLKLNQGDEYIRLTGNVRVDD 195

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           + A N++S  +IA+ARI+Y G+G   +        Q   +  
Sbjct: 196 IQADNTLSSQRIADARITYAGRGSFADTNTAGWLTQFFNSPW 237


>gi|119384849|ref|YP_915905.1| flagellar basal body L-ring protein [Paracoccus denitrificans
           PD1222]
 gi|119374616|gb|ABL70209.1| flagellar L-ring protein [Paracoccus denitrificans PD1222]
          Length = 250

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 84/229 (36%), Positives = 119/229 (51%), Gaps = 7/229 (3%)

Query: 15  LFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKD 74
           L  C   +S+I   P M+   S ++                    + SLW  S  AL  D
Sbjct: 22  LAAC-GRVSQIGQAPGMTEPESGVEFQAMTSSGHGVQDLPYRPDSAASLWAVSQNALVAD 80

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
            RA   GDILTV I IDD+A   N +GRSR+++ +  ++    L  +    +    + D 
Sbjct: 81  RRASQRGDILTVVIEIDDRAEIQNSSGRSRSSADNVGIASMMGLPQRIDEILPEGASMDK 140

Query: 135 ------GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
                   +  G G+ISR +KL L +AA V   L NG L I G+QEVRVN E+R L V G
Sbjct: 141 LAEAKASSSYKGSGNISRRDKLTLRVAATVVDRLPNGVLRIQGTQEVRVNYEVRELTVNG 200

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            VRP D+   N ++YD+IA ARISYGG+G+ +++ +P  G QL + + P
Sbjct: 201 FVRPSDIGRRNEIAYDRIAGARISYGGRGQISDVQQPRYGQQLADIVLP 249


>gi|254522805|ref|ZP_05134860.1| flagellar L-ring protein FlgH [Stenotrophomonas sp. SKA14]
 gi|219720396|gb|EED38921.1| flagellar L-ring protein FlgH [Stenotrophomonas sp. SKA14]
          Length = 230

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 43/202 (21%), Positives = 86/202 (42%), Gaps = 1/202 (0%)

Query: 34  MGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDD 92
           + +                   +   + +++       L+ D RA +VGD+LT+ +  + 
Sbjct: 24  VIAGDVRPYAAMAPIQPIMPPQAAPTAGAIYAAGPTLQLYSDRRARDVGDLLTITLLENT 83

Query: 93  QAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNL 152
            A     T  ++ ++L+               +   + +  G    +GKG+ +++ +L  
Sbjct: 84  TAQTSANTATNKESNLNLGTPSILGAPVTLGGKDILSASATGKRDFTGKGNSAQSNRLQG 143

Query: 153 LIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARIS 212
            +   V   L NGNL++ G + +R+N     + V GIVRP D+   N++   ++AEARI 
Sbjct: 144 SVTVTVVQRLPNGNLVVQGQKNLRLNQGDELVQVQGIVRPGDISQDNTIPSSRVAEARIV 203

Query: 213 YGGKGRTTELLRPPIGHQLIEN 234
           YGG+G   +        +   +
Sbjct: 204 YGGRGPVAQSNAMGWLSRFFNS 225


>gi|296445181|ref|ZP_06887141.1| flagellar L-ring protein [Methylosinus trichosporium OB3b]
 gi|296257355|gb|EFH04422.1| flagellar L-ring protein [Methylosinus trichosporium OB3b]
          Length = 240

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 86/227 (37%), Positives = 136/227 (59%), Gaps = 9/227 (3%)

Query: 17  GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSR 76
           GC +   +I   P MSP+GS L+  +     G      D     +    ++   L++D R
Sbjct: 16  GCATDPRDIGREPHMSPVGSGLNTVDDQLPTGSI---RDGALGPHMRLDENRINLYRDVR 72

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP------QMNGNL 130
           A++ GD++TV+I +DD+AV  N T RSR++ +  + S  F      +           + 
Sbjct: 73  AMSAGDVVTVNISMDDKAVLGNSTDRSRDSKVKSEWSFLFDFLAGGSGATEHKWNGTISN 132

Query: 131 NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIV 190
           +     ++ G+GSI+R+E++ L IAA+VTA+L NGNL++ GSQE+RVN E+R L + GI 
Sbjct: 133 DLQSSSSTQGQGSINRSEQIRLSIAAVVTAVLPNGNLVLRGSQEIRVNYELRVLTIAGIA 192

Query: 191 RPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           RP+D+   N++SYDKIAEAR+SYGG+GR +E+ +P  G Q+ +  +P
Sbjct: 193 RPRDIAKDNTISYDKIAEARVSYGGRGRLSEVQQPAWGQQVYDIFAP 239


>gi|296103608|ref|YP_003613754.1| Flagellar L-ring protein, FlgH [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295058067|gb|ADF62805.1| Flagellar L-ring protein, FlgH [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 228

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 47/198 (23%), Positives = 79/198 (39%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQ 99
                P          S  ++       +  +F+D R  NVGD LT+ ++ +  A   + 
Sbjct: 30  PTTATPLPMAPAATGGSLFQAGQAMNYGYQPMFEDRRPRNVGDTLTILLQENVSASKSSS 89

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVT 159
              +RN S    L    +           +   +G    +GKG  +        I   V 
Sbjct: 90  ASANRNGSAGMGLIAVPTKLNGWLGDGKADFEAEGKNDFAGKGGAAARNTFTGTITVTVK 149

Query: 160 AILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRT 219
            +L NGNL + G +++ +N     +  +G+V P+ +   N+V   ++A+ARI Y G G  
Sbjct: 150 ELLPNGNLGVVGEKQIAINQGTEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYI 209

Query: 220 TELLRPPIGHQLIENLSP 237
            E        +L  NLSP
Sbjct: 210 NEAQNMGWLQRLFLNLSP 227


>gi|320173531|gb|EFW48727.1| Flagellar L-ring protein FlgH [Shigella dysenteriae CDC 74-1112]
 gi|320186974|gb|EFW61687.1| Flagellar L-ring protein FlgH [Shigella flexneri CDC 796-83]
          Length = 232

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 51/232 (21%), Positives = 90/232 (38%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I       L GC    S        +P+       +  P  G     + S  +S      
Sbjct: 11  ISSLLVLSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINY 60

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 61  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNA 120

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 121 RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 180

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++ +ARI Y G G   E        +   NLSP+
Sbjct: 181 SGVVNPRTISGSNTVPSTQVVDARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|57236990|ref|YP_178791.1| flagellar basal body L-ring protein [Campylobacter jejuni RM1221]
 gi|157414975|ref|YP_001482231.1| flagellar basal body L-ring protein [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|218562326|ref|YP_002344105.1| flagellar basal body L-ring protein [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|315124190|ref|YP_004066194.1| flagellar L-ring protein precursor [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|14548049|sp|Q9PPM0|FLGH_CAMJE RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|81353802|sp|Q5HV94|FLGH_CAMJR RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|172047100|sp|A8FLB7|FLGH_CAMJ8 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|57165794|gb|AAW34573.1| flagellar L-ring protein FlgH [Campylobacter jejuni RM1221]
 gi|112360032|emb|CAL34824.1| putative flagellar L-ring protein precursor [Campylobacter jejuni
           subsp. jejuni NCTC 11168]
 gi|157385939|gb|ABV52254.1| putative flagellar L-ring protein precursor [Campylobacter jejuni
           subsp. jejuni 81116]
 gi|307747612|gb|ADN90882.1| Flagellar L-ring protein [Campylobacter jejuni subsp. jejuni M1]
 gi|315017912|gb|ADT66005.1| flagellar L-ring protein precursor [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|315058150|gb|ADT72479.1| Flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           S3]
 gi|315926801|gb|EFV06175.1| flagellar L-ring family protein [Campylobacter jejuni subsp. jejuni
           DFVF1099]
          Length = 232

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 64/244 (26%), Positives = 106/244 (43%), Gaps = 20/244 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  F VL ++    GC +++      PQ+S    +  E           ++++     
Sbjct: 1   MKKVLFYVLPFAFF--GCSATVD-----PQISMKPPAYVEE------LAPKQSNNVESAP 47

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SL+      LF D +A+NV D++TV I+             SR N+ +          G
Sbjct: 48  GSLFGKGDNPLFSDKKAMNVNDLVTVVIQESTTQSTQANKATSRTNTSNLGGGALTGSSG 107

Query: 121 QQTPQMNG-------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                +N            +     +G GS SR E  N  I+  V  IL NGN  I GS+
Sbjct: 108 VVANALNKVNAYSNIGFQTNSSNNYTGTGSQSRNESFNTTISTRVIKILSNGNYFIEGSR 167

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G      R P G ++IE
Sbjct: 168 ELLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKILYKTEGEVDRSTRKPWGSKVIE 227

Query: 234 NLSP 237
            + P
Sbjct: 228 AIWP 231


>gi|260597448|ref|YP_003210019.1| flagellar basal body L-ring protein [Cronobacter turicensis z3032]
 gi|260216625|emb|CBA29923.1| Flagellar L-ring protein [Cronobacter turicensis z3032]
          Length = 232

 Score =  193 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 51/238 (21%), Positives = 96/238 (40%), Gaps = 22/238 (9%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I +  +  L GC    S        +P+                   + +   + S+++ 
Sbjct: 11  IAIALALTLSGCAWVPS--------TPLVQGATTAQPA--------PAPAPVVNGSIFQS 54

Query: 67  ------SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
                  +  LF+D R  NVGD LT++++ +  A   +    SR+   +  L        
Sbjct: 55  VQQINYGYQPLFEDRRPRNVGDTLTIELQENVSASKSSSANASRDGKTNFGLDTVPRYLQ 114

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   +++  GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 115 GLFGNARADISASGGNTFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 175 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|333008283|gb|EGK27757.1| flagellar L-ring family protein [Shigella flexneri K-272]
 gi|333019773|gb|EGK39045.1| flagellar L-ring family protein [Shigella flexneri K-227]
          Length = 232

 Score =  193 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 51/232 (21%), Positives = 90/232 (38%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I       L GC    S        +P+       +  P  G     + S  +S      
Sbjct: 11  ISSLLVLSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINY 60

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 61  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNA 120

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 121 RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 180

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V  + +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 181 SGVVNSRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|224584316|ref|YP_002638114.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|224468843|gb|ACN46673.1| flagellar L-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
          Length = 221

 Score =  193 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 51/231 (22%), Positives = 91/231 (39%), Gaps = 10/231 (4%)

Query: 8   VLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDS 67
           +    + L GC    ++        P+          P  G     + S  +S       
Sbjct: 1   MALMVATLTGCAWIPAK--------PLVQGA--TTAQPIPGPVPVANGSIFQSAQPINYG 50

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+                      
Sbjct: 51  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVPRYLQGLFGNSR 110

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            ++   GG + +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  +
Sbjct: 111 ADMEASGGNSFNGKGGANASNTFSGTLTVTVVQVLANGNLHVVGEKQIAINQGTEFIRFS 170

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 171 GVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 221


>gi|153001469|ref|YP_001367150.1| flagellar basal body L-ring protein [Shewanella baltica OS185]
 gi|166214827|sp|A6WQJ8|FLGH_SHEB8 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|151366087|gb|ABS09087.1| flagellar L-ring protein [Shewanella baltica OS185]
          Length = 224

 Score =  193 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 47/221 (21%), Positives = 89/221 (40%), Gaps = 17/221 (7%)

Query: 19  HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA-LFKDSRA 77
            +    +   P  +P+                         + S+++DS A+ L+ D RA
Sbjct: 18  STQKKPLADDPFYAPVYPE--------------APPTKIAATGSIYQDSQASSLYSDIRA 63

Query: 78  LNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGA 137
             VGDI+T+ ++   QA         + + +                 +  +L Y     
Sbjct: 64  HKVGDIITIVLKESTQAKKSAGNQIKKGSDMSLD-PIFAGGSNISVGGVPIDLRYKDSMN 122

Query: 138 SSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDA 197
           +  +    ++  L+  I+A V  +L NG+L+I G + + +N+    + VTG+VR QD+  
Sbjct: 123 TKRESDADQSNSLDGSISANVMQVLNNGSLVIRGEKWISINNGDEFIRVTGLVRSQDIKP 182

Query: 198 HNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
            N++   ++A ARI Y G G   +  +     Q   +   P
Sbjct: 183 DNTIDSTRMANARIQYSGTGTFADAQKVGWLSQFFMSDWWP 223


>gi|296135670|ref|YP_003642912.1| flagellar L-ring protein [Thiomonas intermedia K12]
 gi|295795792|gb|ADG30582.1| flagellar L-ring protein [Thiomonas intermedia K12]
          Length = 237

 Score =  193 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 52/221 (23%), Positives = 94/221 (42%), Gaps = 14/221 (6%)

Query: 18  CHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSR 76
           C ++   ++    + P+    +  +                 + ++W+     +LF+DSR
Sbjct: 29  CATAPQHLSSD-SLKPLPIPAEPESMNAHTP-----------NGAIWQPGTNVSLFEDSR 76

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGG 136
           A  VGD++TV I+ +  A     T  ++++ +   LS  F          + ++      
Sbjct: 77  AHRVGDLITVLIQENANATKSTNTTVNKSDDVSAGLSSFFGKPFTVGG-YSPSMGLTSST 135

Query: 137 ASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVD 196
              G G+ S++      + A V  ++ NGN+ ISG +EV +N     + V G+VR  DV 
Sbjct: 136 KFGGNGATSQSNTFTTTLQATVVQVMSNGNMQISGQKEVMLNGGHEYIRVAGVVRAADVS 195

Query: 197 AHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
             N+V   +IA AR+ Y G G      + P       +L P
Sbjct: 196 PQNTVLSTQIANARVEYSGTGDVYAAAKVPWLASFFLSLWP 236


>gi|301029706|ref|ZP_07192760.1| flagellar L-ring protein FlgH [Escherichia coli MS 196-1]
 gi|299877394|gb|EFI85605.1| flagellar L-ring protein FlgH [Escherichia coli MS 196-1]
 gi|332092936|gb|EGI98004.1| flagellar L-ring family protein [Shigella dysenteriae 155-74]
          Length = 217

 Score =  193 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 51/227 (22%), Positives = 90/227 (39%), Gaps = 10/227 (4%)

Query: 12  SSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAAL 71
              L GC    S        +P+       +  P  G     + S  +S       +  L
Sbjct: 1   MLSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINYGYQPL 50

Query: 72  FKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLN 131
           F+D R  N+GD LT+ ++ +  A   +    SR+   +                   ++ 
Sbjct: 51  FEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNARADVE 110

Query: 132 YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVR 191
             GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  +G+V 
Sbjct: 111 ASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRFSGVVN 170

Query: 192 PQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 171 PRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 217


>gi|332162898|ref|YP_004299475.1| Lateral flagellar L-ring protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318604255|emb|CBY25753.1| flagellar L-ring protein FlgH [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325667128|gb|ADZ43772.1| Lateral flagellar L-ring protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330863348|emb|CBX73471.1| flagellar L-ring protein 2 [Yersinia enterocolitica W22703]
          Length = 221

 Score =  193 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 52/195 (26%), Positives = 87/195 (44%), Gaps = 7/195 (3%)

Query: 46  FLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR 104
              ++    DS KK   L++ ++  +L +D RA  +GDILTV +    Q+    +T   +
Sbjct: 32  APPVNQTQVDSVKKGGGLFQPAYNWSLLQDRRAYRIGDILTVKLDESTQSSKQAKTNFGK 91

Query: 105 NNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN 164
            N +   +         +        +  G     G  + ++   L   I   V  +L N
Sbjct: 92  KNDMSLGIPEVLGKKLNKFGG-----SISGKRDFDGSATSAQQNMLRGSITVAVHQVLPN 146

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           G L+I G + + +N     + VTG+VR  DV+  NSVS  +IA ARISY G+G  ++   
Sbjct: 147 GVLVIRGEKWLTLNQGDEYMRVTGLVRADDVERDNSVSSQRIANARISYAGRGALSDANS 206

Query: 225 PPIGHQLIEN-LSPL 238
                +   + L P+
Sbjct: 207 AGWLTRFFNHPLFPI 221


>gi|296157453|ref|ZP_06840288.1| flagellar L-ring protein [Burkholderia sp. Ch1-1]
 gi|295892225|gb|EFG72008.1| flagellar L-ring protein [Burkholderia sp. Ch1-1]
          Length = 232

 Score =  193 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 56/235 (23%), Positives = 95/235 (40%), Gaps = 21/235 (8%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           + + L   + L GC            + P      +             S       S++
Sbjct: 16  ALVQLTLLAALGGCG-----------LVPKQPITQQPMTALPPMPPQAQSP-----GSIF 59

Query: 65  RDSH--AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ 122
              +    LF+D R  NVGDILT+ I+ +  A   +    +R+ + +  +     L G  
Sbjct: 60  NPGYAGRPLFEDQRPRNVGDILTIVIQENVNATKSSGANANRSGNTNFNVPTAGFLGGLF 119

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
                 NL+  G    SG G  + +   N  I   VT +L NGNL++SG +++ +N    
Sbjct: 120 GK---TNLSATGANVFSGTGGANASNTFNGTITVTVTGVLPNGNLMVSGEKQMLINQGDE 176

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            +  +G+V P  +   N+V   ++A+A+I Y  KG   E        +   N+SP
Sbjct: 177 FVRFSGVVNPNTISNLNAVYSTQVADAKIEYSAKGYLNEAENMGWLQRFFLNVSP 231


>gi|89075498|ref|ZP_01161909.1| flagellar L-ring protein precursor [Photobacterium sp. SKA34]
 gi|89048770|gb|EAR54341.1| flagellar L-ring protein precursor [Photobacterium sp. SKA34]
          Length = 261

 Score =  193 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 46/262 (17%), Positives = 89/262 (33%), Gaps = 27/262 (10%)

Query: 1   MYR--YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSS--------------------L 38
           M R      ++  S  L GC S+  ++ G        +                      
Sbjct: 1   MNRQWMKRSLILLSLALTGCVSTPPDVAGSDIEKATTNVDAVEGKEKESKGLIDRIRKRE 60

Query: 39  DENNRMPFLGIDFKNSDSTK---KSYSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQA 94
           D     P                 + SL+  S    L+ D++   +GDI+T+ +     A
Sbjct: 61  DPEAGDPAWNPVRPQDKPEHYATATGSLFNQSQVQDLYDDTKPRGIGDIVTILLEEKTAA 120

Query: 95  VFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLI 154
                +   ++  L+ K               + +         +G  S  ++  +   I
Sbjct: 121 KKSASSDLDKSTDLNMK-PIELGGKPVTIRDYSLSYGMSNNNTFAGSTSADQSNSIKGSI 179

Query: 155 AAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYG 214
           +  V  +L NGNL + G + + +N     + V+G +RP D+   N+++  +I+ ARI Y 
Sbjct: 180 SVEVVEVLNNGNLAVRGEKWLMLNTGEEYIRVSGHIRPDDISQDNTIASTRISNARIQYS 239

Query: 215 GKGRTTELLRPPIGHQLIENLS 236
           G G   ++       +      
Sbjct: 240 GTGDRQDIQEQNWLSRFFNVAF 261


>gi|89068733|ref|ZP_01156119.1| flagellar L-ring protein precursor [Oceanicola granulosus HTCC2516]
 gi|89045696|gb|EAR51758.1| flagellar L-ring protein precursor [Oceanicola granulosus HTCC2516]
          Length = 250

 Score =  193 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 77/234 (32%), Positives = 114/234 (48%), Gaps = 13/234 (5%)

Query: 17  GCHSSI----SEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALF 72
           GC S+             ++        + ++P          +  +S SLW       F
Sbjct: 16  GCASAPAFNREPAVSNLDLTRQTMPEVASVQVPLPVPQPVPVPTRAESASLWAPGARGFF 75

Query: 73  KDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG---- 128
            D RA  VGDILT+DI IDD+A   N + R R+      +             + G    
Sbjct: 76  GDQRATAVGDILTIDIEIDDEASLANASSRERDGEGSVAMPTALGYENHLANVIPGISQD 135

Query: 129 -----NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
                 +       +SG G+I R E + L +AA+V  +L NGN++++G QEV+VNDE+R 
Sbjct: 136 ELSDPLIGLRSETNASGSGTIRRNESIKLKVAAMVIQLLPNGNMVVAGRQEVKVNDELRE 195

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           L V GI+RPQD+  +N+V YDKIAEARISYGG+G  +       G  +++ + P
Sbjct: 196 LRVAGIIRPQDIQMNNTVPYDKIAEARISYGGEGSLSRTQTRGYGEDVMDIVLP 249


>gi|156934437|ref|YP_001438353.1| flagellar basal body L-ring protein [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156532691|gb|ABU77517.1| hypothetical protein ESA_02268 [Cronobacter sakazakii ATCC BAA-894]
          Length = 235

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 51/238 (21%), Positives = 95/238 (39%), Gaps = 22/238 (9%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I +  +  L GC    S        +P+                   + +   + S+++ 
Sbjct: 14  IAIALALTLSGCAWVPS--------TPLVQGATTAQPA--------PAPAPVVNGSIFQS 57

Query: 67  ------SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
                  +  LF+D R  NVGD LT++++ +  A   +    SR+      L        
Sbjct: 58  VQQINYGYQPLFEDRRPRNVGDTLTIELQENVSASKSSSANASRDGKTSFGLDTVPRYLQ 117

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   +++  GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 118 GLFGNARADVSASGGNTFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQG 177

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 178 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|153834476|ref|ZP_01987143.1| flagellar L-ring protein FlgH [Vibrio harveyi HY01]
 gi|269961602|ref|ZP_06175964.1| flagellar L-ring protein precursor [Vibrio harveyi 1DA3]
 gi|148869172|gb|EDL68204.1| flagellar L-ring protein FlgH [Vibrio harveyi HY01]
 gi|269833643|gb|EEZ87740.1| flagellar L-ring protein precursor [Vibrio harveyi 1DA3]
          Length = 259

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 48/259 (18%), Positives = 95/259 (36%), Gaps = 27/259 (10%)

Query: 1   MYRYSFIVLCYSSLLFGCH------------------------SSISEITGIPQMSPMGS 36
           M R   + L  +  + GC                         S       I  +     
Sbjct: 1   MKRICLLALITT--MSGCAMLEPIETDEVSQATTVVDAVEGDKSKEESSGIIDTLRGRTD 58

Query: 37  SLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAV 95
            +  +     +    K       + SL+   H   L+ DS+   +GDI+TV +    +A 
Sbjct: 59  PVAGDPAWAPIHPKQKPEHYAAATGSLFSTEHITDLYDDSKPRGIGDIITVTLDETTRAT 118

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
                  S+ N    +         Q   + N + + +     +G  S  ++  ++  I 
Sbjct: 119 KSANADLSKTNDAKMEPLSVGGQELQIGGKYNFSYDLNNTNTFAGDSSAKQSNSISGYIT 178

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             V  +L NGNL+I G + + +N     + ++G +RP D++  N+++ ++++ ARI Y G
Sbjct: 179 VEVIEVLANGNLVIRGEKWMTLNTGDEYIRLSGTIRPDDINFDNTIASNRVSNARIQYSG 238

Query: 216 KGRTTELLRPPIGHQLIEN 234
            G   ++  P    +    
Sbjct: 239 TGSPQDMQEPGFLARFFNV 257


>gi|27363702|ref|NP_759230.1| flagellar basal body L-ring protein [Vibrio vulnificus CMCP6]
 gi|31076699|sp|Q8DFJ1|FLGH_VIBVU RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|27359818|gb|AAO08757.1| Flagellar L-ring protein flgH [Vibrio vulnificus CMCP6]
          Length = 259

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 51/259 (19%), Positives = 98/259 (37%), Gaps = 27/259 (10%)

Query: 1   MYRYSFIVLCYSSLLFGC-------------HSSISEITGIPQMSPMGSSL--------D 39
           M R S I L    ++ GC              +++ +     +     S +        D
Sbjct: 1   MKRISLIALVT--IMSGCTMLEPIETPEVVNATTVVDAVEGDKSKDESSGIVDTLRGRSD 58

Query: 40  ENNRMPFLGIDFKNSDS---TKKSYSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAV 95
                P                ++ SL+  +H + L+ DS+   VGDI+TV +     A 
Sbjct: 59  PVAGDPAWAPIHPKQQPEHYAAETGSLFSVNHLSNLYDDSKPRGVGDIITVTLDEKTNAS 118

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
                  S++N              +   + N + N       +G  S  ++  ++  I 
Sbjct: 119 KSANADLSKSNDSSMDPLEVGGQELKIDGKYNFSYNLTNSNNFTGDASAKQSNSISGYIT 178

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             V  +L NGNL+I G + + +N     + ++G +RP D+   N+++ ++++ ARI Y G
Sbjct: 179 VEVIEVLANGNLVIRGEKWLTLNTGDEYIRLSGTIRPDDISFDNTIASNRVSNARIQYSG 238

Query: 216 KGRTTELLRPPIGHQLIEN 234
            G   ++  P    +    
Sbjct: 239 TGTQQDMQEPGFLARFFNV 257


>gi|108868295|sp|Q2LT21|FLGH_SYNAS RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
          Length = 232

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 56/229 (24%), Positives = 99/229 (43%), Gaps = 24/229 (10%)

Query: 16  FGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA--LFK 73
            GC +        P  +     LD   R           ++     S+W    A+  LF 
Sbjct: 20  TGCATK-------PDFTAGEQPLDLTVR----------PEALPVRGSIWPGESASNMLFA 62

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN---- 129
           D +A  + DI+T+ I    Q      T  SR++     +   + L      +        
Sbjct: 63  DKKARYINDIVTILINEASQGGNKATTNTSRDSDSAAGIDAFWGLDQSILSRNVNMGSKI 122

Query: 130 -LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
            +         G G+ +R  +L   + A V  +L+NGNL+I G +++ +N+E + L ++G
Sbjct: 123 KIGGSSSSTLKGTGNTTRGGQLKGTVTARVVRVLDNGNLVIEGRRQLTINEEDQYLIISG 182

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           I+RP+D+   N +    IA+ARI Y GKG   + +RP    ++++ + P
Sbjct: 183 IIRPEDITTENCIFSQYIADARIVYAGKGIINDKMRPGWATRIVDWVWP 231


>gi|120598235|ref|YP_962809.1| flagellar basal body L-ring protein [Shewanella sp. W3-18-1]
 gi|146293687|ref|YP_001184111.1| flagellar basal body L-ring protein [Shewanella putrefaciens CN-32]
 gi|120558328|gb|ABM24255.1| flagellar L-ring protein [Shewanella sp. W3-18-1]
 gi|145565377|gb|ABP76312.1| flagellar L-ring protein [Shewanella putrefaciens CN-32]
 gi|319427086|gb|ADV55160.1| flagellar L-ring protein [Shewanella putrefaciens 200]
          Length = 224

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 47/208 (22%), Positives = 88/208 (42%), Gaps = 5/208 (2%)

Query: 32  SPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRI 90
           +      D+    P              + S+++DS A +L+ D RA  VGDI+T+ ++ 
Sbjct: 19  TQKKPIADDPFYAPVYP--EAPPTKIAATGSIYQDSQAASLYSDIRAHKVGDIITIVLKE 76

Query: 91  DDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKL 150
             QA         + + +        +        +  +L Y     +  +    ++  L
Sbjct: 77  ATQAKKSAGNQIKKGSDMSLD-PIYAAGSNISVAGVPLDLRYKDSMNTKRESDADQSNSL 135

Query: 151 NLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEAR 210
           +  I+A +  +L NGNL++ G + + +N+    + VTGIVR QD+   N++   ++A AR
Sbjct: 136 DGSISANIMQVLNNGNLVVRGEKWISINNGDEFIRVTGIVRSQDIKPDNTIDSTRMANAR 195

Query: 211 ISYGGKGRTTELLRPPIGHQLIEN-LSP 237
           I Y G G   +  +     Q   +   P
Sbjct: 196 IQYSGTGTFADAQKVGWLSQFFMSDWWP 223


>gi|319944132|ref|ZP_08018410.1| flagellar L-ring protein FlgH [Lautropia mirabilis ATCC 51599]
 gi|319742626|gb|EFV95035.1| flagellar L-ring protein FlgH [Lautropia mirabilis ATCC 51599]
          Length = 253

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 45/233 (19%), Positives = 92/233 (39%), Gaps = 13/233 (5%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           +++     L GC + +               +D            +     + + S+++ 
Sbjct: 33  LLVLSMLALAGCSTVMPPRAR----------IDTPMVDHNRLASMRAVPQREANGSIFQA 82

Query: 67  S-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
                +F+D RA   GD+LT+ I     A   + +   R      K      +   +  +
Sbjct: 83  GATRNMFEDRRARQPGDMLTILIEERLVAKHSSNSTIDRKGGGSAKFGALPFVKADKLGK 142

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
           +   L+     +  GKG+     +    I   V  +L NGNL++SG ++V +N  + +L 
Sbjct: 143 L--GLDASTSNSFEGKGAAGNENQFAGTITVTVVDVLPNGNLVVSGEKQVGINQGVETLK 200

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
             G+V P  +   N+VS  ++A+AR+   G G   ++       +   ++ P+
Sbjct: 201 FAGVVDPLTIMPGNTVSSTQVADARMQVRGAGDIDKVQTTGWLTRFFLSVMPI 253


>gi|28897556|ref|NP_797161.1| flagellar basal body L-ring protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153839681|ref|ZP_01992348.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AQ3810]
 gi|260364614|ref|ZP_05777216.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus K5030]
 gi|260878281|ref|ZP_05890636.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AN-5034]
 gi|260898111|ref|ZP_05906607.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus Peru-466]
 gi|260901957|ref|ZP_05910352.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AQ4037]
 gi|14548053|sp|Q9X9J5|FLGH1_VIBPA RecName: Full=Flagellar L-ring protein 1; AltName: Full=Basal body
           L-ring protein 1; Flags: Precursor
 gi|5361011|gb|AAD42918.1|U12817_12 polar flagellar FlgH homolog [Vibrio parahaemolyticus]
 gi|28805768|dbj|BAC59045.1| flagellar L-ring protein precursor FlgH [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|149746791|gb|EDM57779.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AQ3810]
 gi|308086115|gb|EFO35810.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus Peru-466]
 gi|308090111|gb|EFO39806.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AN-5034]
 gi|308106777|gb|EFO44317.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AQ4037]
 gi|308115099|gb|EFO52639.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus K5030]
 gi|328473450|gb|EGF44298.1| flagellar basal body L-ring protein [Vibrio parahaemolyticus 10329]
          Length = 259

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 46/259 (17%), Positives = 94/259 (36%), Gaps = 27/259 (10%)

Query: 1   MYRYSFIVLCYSSLLFGCH------------------------SSISEITGIPQMSPMGS 36
           M R   + L  +  + GC                         S       +  +     
Sbjct: 1   MKRICLLALITT--MSGCAMLEPIETDEVTQATTVVDAVEGDKSKDESSGIVDTLRGRND 58

Query: 37  SLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAV 95
            +  +     +    K       + SL+   H   L+ DS+   +GDI+TV +     A 
Sbjct: 59  PVAGDPAWAPIHPKQKPEHYAAATGSLFSPEHITDLYDDSKPRGIGDIITVTLDETTSAT 118

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
                  S+ N              +   + N + + +     +G  S  ++  ++  I 
Sbjct: 119 KSANADLSKTNEAQMDPLQVGGEELKVGGKYNFSYDLNNTNTFAGDSSAKQSNSISGYIT 178

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             V  +L NGNL+I G + + +N     + ++G +RP D++  N+++ ++++ ARI Y G
Sbjct: 179 VEVIEVLANGNLVIRGEKWMTLNTGDEYIRLSGTIRPDDINFDNTIASNRVSNARIQYSG 238

Query: 216 KGRTTELLRPPIGHQLIEN 234
            G + ++  P    +    
Sbjct: 239 TGLSQDMQEPGFLARFFNV 257


>gi|91785631|ref|YP_560837.1| flagellar basal body L-ring protein [Burkholderia xenovorans LB400]
 gi|91689585|gb|ABE32785.1| Flagellar L-ring protein [Burkholderia xenovorans LB400]
          Length = 234

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 56/235 (23%), Positives = 95/235 (40%), Gaps = 21/235 (8%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           + + L   + L GC            + P      +             S       S++
Sbjct: 18  ALVQLTLLAALGGCG-----------LVPKQPITQQPMTALPPMPPQAQSP-----GSIF 61

Query: 65  RDSH--AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ 122
              +    LF+D R  NVGDILT+ I+ +  A   +    +R+ + +  +     L G  
Sbjct: 62  NPGYAGRPLFEDQRPRNVGDILTIVIQENVNATKSSGANANRSGNTNFNVPTAGFLGGLF 121

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
                 NL+  G    SG G  + +   N  I   VT +L NGNL++SG +++ +N    
Sbjct: 122 GK---TNLSATGANVFSGTGGANASNTFNGTITVTVTGVLPNGNLMVSGEKQMLINQGDE 178

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            +  +G+V P  +   N+V   ++A+A+I Y  KG   E        +   N+SP
Sbjct: 179 FVRFSGVVNPNTISNLNAVYSTQVADAKIEYSAKGYLNEAENMGWLQRFFLNVSP 233


>gi|86151632|ref|ZP_01069846.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           260.94]
 gi|88596875|ref|ZP_01100111.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           84-25]
 gi|148926655|ref|ZP_01810336.1| putative flagellar L-ring protein precursor [Campylobacter jejuni
           subsp. jejuni CG8486]
 gi|85841261|gb|EAQ58509.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           260.94]
 gi|88190564|gb|EAQ94537.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           84-25]
 gi|145845174|gb|EDK22269.1| putative flagellar L-ring protein precursor [Campylobacter jejuni
           subsp. jejuni CG8486]
 gi|284925943|gb|ADC28295.1| flagellar basal body L-ring protein [Campylobacter jejuni subsp.
           jejuni IA3902]
          Length = 232

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 64/244 (26%), Positives = 106/244 (43%), Gaps = 20/244 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  F VL ++    GC +++      PQ+S    +  E           ++++     
Sbjct: 1   MKKVLFYVLPFAFF--GCSATVD-----PQISMKPPAYVEE------LAPKQSNNIESAP 47

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SL+      LF D +A+NV D++TV I+             SR N+ +          G
Sbjct: 48  GSLFGKGDNPLFSDKKAMNVNDLVTVVIQESTTQSTQANKATSRTNTSNLGGGALTGSSG 107

Query: 121 QQTPQMNG-------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                +N            +     +G GS SR E  N  I+  V  IL NGN  I GS+
Sbjct: 108 VVANALNKVNAYSNIGFQTNSSNNYTGTGSQSRNESFNTTISTRVIKILSNGNYFIEGSR 167

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G      R P G ++IE
Sbjct: 168 ELLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKILYKTEGEVDRSTRKPWGSKVIE 227

Query: 234 NLSP 237
            + P
Sbjct: 228 AIWP 231


>gi|153951340|ref|YP_001398367.1| flagellar basal body L-ring protein [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|166214818|sp|A7H4D7|FLGH_CAMJD RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|152938786|gb|ABS43527.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. doylei
           269.97]
          Length = 232

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 64/244 (26%), Positives = 106/244 (43%), Gaps = 20/244 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  F VL ++    GC +++      PQ+S    +  E           ++++     
Sbjct: 1   MKKVLFYVLPFAFF--GCSATVD-----PQISMKPPAYVEE------LAPKQSNNVESAP 47

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SL+      LF D +A+NV D++TV I+             SR N+ +          G
Sbjct: 48  GSLFGKGDNPLFSDKKAMNVNDLVTVIIQESTTQSTQANKATSRTNTSNLDGGTLTGSSG 107

Query: 121 QQTPQM-------NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                +       N     +     +G GS SR E  N  I+  V  IL NGN  I GS+
Sbjct: 108 VVASALDKVNAYSNIGFQTNSSNNYTGTGSQSRNESFNTTISTRVIKILSNGNYFIEGSR 167

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G      R P G ++IE
Sbjct: 168 ELLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKILYKTEGEVDRSTRKPWGSKVIE 227

Query: 234 NLSP 237
            + P
Sbjct: 228 AIWP 231


>gi|323171067|gb|EFZ56716.1| flagellar L-ring family protein [Escherichia coli LT-68]
          Length = 221

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 52/239 (21%), Positives = 92/239 (38%), Gaps = 20/239 (8%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            +    ++    LL GC S    +                              +  ++ 
Sbjct: 1   MKNYLWLVAQLPLLSGCESQAILVKKDDAYF-------------APPKTEAPPPADGRAG 47

Query: 62  SLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            ++   +  +L  D RA  VGDILTV +    Q+    +T   ++N++       F    
Sbjct: 48  GVFETGYNWSLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKSNTVDIGAPTIFG--- 104

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
               +   + + D      G  +  +   L   I   V A+  NG L I G + + +N  
Sbjct: 105 --HTKDKLSGSIDANRDFDGSATSQQQNSLRREITVSVHAVQPNGILEIRGEKWLTLNQG 162

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSPL 238
              + ++G+VR  D+   NSVS  +IA+ARISY G+G  ++        +L  + L P+
Sbjct: 163 DEYIRLSGLVRADDIQNDNSVSSQRIADARISYAGRGALSDANAAGWLTRLFNHPLFPI 221


>gi|157371204|ref|YP_001479193.1| flagellar basal body L-ring protein [Serratia proteamaculans 568]
 gi|157322968|gb|ABV42065.1| flagellar L-ring protein [Serratia proteamaculans 568]
          Length = 233

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 52/235 (22%), Positives = 88/235 (37%), Gaps = 12/235 (5%)

Query: 4   YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLD-ENNRMPFLGIDFKNSDSTKKSYS 62
             ++       L GC              P    +D      P        + S  ++  
Sbjct: 9   KRWLAAMVMLTLGGCA-----------YIPHKPLVDGTTTAQPAPAGAPVPNGSIFQTVQ 57

Query: 63  LWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ 122
                +  LF+D R  NVGD LT+ ++ +  A   +    SRN +    ++         
Sbjct: 58  PMNYGYQPLFEDRRPRNVGDTLTIALQENVSASKSSSANASRNGASKFGVATAPRYLDGL 117

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
                 ++   G     GKG  +     N  I   V  +L NGNL + G +++ +N    
Sbjct: 118 LGNARADMEMSGDSTFGGKGGANANNTFNGTITVTVNQVLVNGNLHVVGEKQIAINQGTE 177

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            +  +G+V P+ +   NSV+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 178 FIRFSGVVNPRTISGSNSVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNVSP 232


>gi|86149820|ref|ZP_01068049.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           CF93-6]
 gi|85839638|gb|EAQ56898.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           CF93-6]
          Length = 232

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 64/244 (26%), Positives = 105/244 (43%), Gaps = 20/244 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  F VL +     GC +++      PQ+S    +  E           ++++     
Sbjct: 1   MKKVLFYVLPFVFF--GCSATVD-----PQISMKPPAYVEE------LAPKQSNNIESAP 47

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SL+      LF D +A+NV D++TV I+             SR N+ +          G
Sbjct: 48  GSLFGKGDNPLFSDKKAMNVNDLVTVVIQESTTQSTQANKATSRTNTSNLGGGALTGSSG 107

Query: 121 QQTPQMNG-------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                +N            +     +G GS SR E  N  I+  V  IL NGN  I GS+
Sbjct: 108 VVANALNKVNAYSNIGFQTNSSNNYTGTGSQSRNESFNTTISTRVIKILSNGNYFIEGSR 167

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G      R P G ++IE
Sbjct: 168 ELLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKILYKTEGEVDRSTRKPWGSKVIE 227

Query: 234 NLSP 237
            + P
Sbjct: 228 AIWP 231


>gi|330445351|ref|ZP_08309003.1| flagellar L-ring protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489542|dbj|GAA03500.1| flagellar L-ring protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 261

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 47/262 (17%), Positives = 90/262 (34%), Gaps = 27/262 (10%)

Query: 1   MYRYSF--IVLCYSSLLFGCHSSISEITGIPQMSPMGSS--------------------L 38
           M R      ++  S +L GC S+  ++ G        +                      
Sbjct: 1   MNRQWMKGSLVVLSLVLTGCMSTPPDVAGSDIEKATTNVDAVEGKEKESKGLIDMIRKRE 60

Query: 39  DENNRMPFLGIDFKNSDSTK---KSYSLWRD-SHAALFKDSRALNVGDILTVDIRIDDQA 94
           D     P                 + SL+       L+ D++   +GDI+T+ +     A
Sbjct: 61  DPEAGDPAWNPVRPQDKPEHYATATGSLFNQVQVQDLYDDTKPRGIGDIVTILLEEKTAA 120

Query: 95  VFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLI 154
                +   ++  L+ K               N +         +G  S  ++  +   I
Sbjct: 121 KKSASSDLDKSTDLNMK-PIELGGKPVTIRDYNLSYGMSNNNTFAGSTSADQSNSIKGSI 179

Query: 155 AAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYG 214
           +  V  +L NGNL+I G + + +N     + V+G +RP D+   N+++  +I+ ARI Y 
Sbjct: 180 SVEVVEVLNNGNLVIRGEKWLTLNTGDEYIRVSGHIRPDDISQDNTIASTRISNARIQYS 239

Query: 215 GKGRTTELLRPPIGHQLIENLS 236
           G G   ++       +      
Sbjct: 240 GTGDRQDVQDQNWLSRFFNVAF 261


>gi|163784420|ref|ZP_02179304.1| hypothetical protein HG1285_04703 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880311|gb|EDP73931.1| hypothetical protein HG1285_04703 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 232

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 54/232 (23%), Positives = 91/232 (39%), Gaps = 18/232 (7%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           +VL    L   C              P                +  + +      SL+  
Sbjct: 17  LVLFAIFLFVSCAEKKE------TYKPFNP----------KPPEIVDENIKTPPGSLYT- 59

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF D +AL VGD +T+ I  +       Q+   ++ +L+  L     L      + 
Sbjct: 60  GYDNLFSDDKALRVGDTITIKITENISGQGSAQSDAKKDTNLNYDLPSPTWLGKNLVKKT 119

Query: 127 N-GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
               +      +  G GS  R  KL   I A V  +  NGNL + G + +R+ND+ + L 
Sbjct: 120 PIAGMTAKSSDSFKGSGSTKRQAKLIATITARVVKVYPNGNLFVVGKKIIRINDDTQILK 179

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           ++GIV+P  +   NSV   +I++  + Y GKG   +  RP    + +  + P
Sbjct: 180 ISGIVKPTYIQQDNSVDSSRISDMYVEYNGKGYIADHQRPGWLARFLAKIWP 231


>gi|157959899|ref|YP_001499933.1| flagellar basal body L-ring protein [Shewanella pealeana ATCC
           700345]
 gi|157844899|gb|ABV85398.1| flagellar L-ring protein [Shewanella pealeana ATCC 700345]
          Length = 224

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 63/232 (27%), Positives = 99/232 (42%), Gaps = 19/232 (8%)

Query: 9   LCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH 68
           +    LL GC S I E+   P             +  +   +   S    K  S++R   
Sbjct: 10  IGLVLLLSGCISHIPELDTKP------------GKPEWAPPEIDYSLPDAKDGSVYRPGF 57

Query: 69  A-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
              LFKD RA   GDILTV +     +     T  ++N  L                 + 
Sbjct: 58  MLTLFKDKRAFREGDILTVALDEKTYSSKSADTKTNKNTGLSLD-----GQGTTGNNSIA 112

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
           G+   + G + SG GS ++  +L+  I   V  +L NG L+I G + +R+N     L + 
Sbjct: 113 GSGEANLGSSFSGTGSSTQQNQLSGSITVTVAKVLPNGALLIRGEKWLRLNQGDEYLRLL 172

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS-PL 238
           G++R  D+   N++S  +IA+ARI YGG+G  T+  R     +   +   PL
Sbjct: 173 GLIRTDDIGNDNTISSQRIADARIIYGGQGAITDSNRMGWASRYFNSPWFPL 224


>gi|163802600|ref|ZP_02196492.1| flagellar L-ring protein precursor [Vibrio sp. AND4]
 gi|159173683|gb|EDP58502.1| flagellar L-ring protein precursor [Vibrio sp. AND4]
          Length = 259

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 50/272 (18%), Positives = 95/272 (34%), Gaps = 53/272 (19%)

Query: 1   MYRYSFIVLCYSSLLFGCH-------------------------------------SSIS 23
           M R   + L  +  + GC                                          
Sbjct: 1   MKRICLLALITT--MSGCAMLKPIETDEVSQATTVVDAVEGDKSKDESSGIIDTLRGRTD 58

Query: 24  EITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH-AALFKDSRALNVGD 82
            + G P  SP+       +                 + SL+   H   L+ DS+   VGD
Sbjct: 59  PVAGDPAWSPIHPKQKPEHYA-------------AATGSLFSADHITDLYDDSKPRGVGD 105

Query: 83  ILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKG 142
           I+TV +    +A        S+ N    +         Q   + N + + +     +G  
Sbjct: 106 IITVTLDETTRATKSANADLSKTNDAKMEPLSVGGQELQIGGKYNFSYDLNNTNTFAGDS 165

Query: 143 SISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVS 202
           S  ++  ++  I   V  +L NGNL+I G + + +N     + ++G +RP D++  N+++
Sbjct: 166 SAKQSNSISGYITVEVIEVLANGNLVIRGEKWMTLNTGDEYIRLSGTIRPDDINFDNTIA 225

Query: 203 YDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
            ++++ ARI Y G G   ++  P    +    
Sbjct: 226 SNRVSNARIQYSGTGLPQDMQEPGFLARFFNV 257


>gi|311694364|gb|ADP97237.1| flagellar basal body L-ring protein [marine bacterium HP15]
          Length = 233

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 51/226 (22%), Positives = 93/226 (41%), Gaps = 23/226 (10%)

Query: 17  GCH--SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALFK 73
           GC   S    +   P+ +P+                         S S+++ S     + 
Sbjct: 27  GCTAMSRPRAVPDDPEFAPVRP--------------QAMMQRDSASGSIYQVSRNYNFYG 72

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYD 133
           D+ ALNVGD+LTV+++    A  + +T  +++N                        +++
Sbjct: 73  DTVALNVGDVLTVNLQESTSASKNAETSITKDNETTLPNPTILGKDNFGINT-----SFN 127

Query: 134 GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQ 193
                 G     ++  L   I   VT +L NG L I G + + + +    + +TG+VRPQ
Sbjct: 128 HERDFQGAAEADQSNSLAGSITVTVTEVLPNGVLRIRGEKWLSLTNGDEYIRLTGLVRPQ 187

Query: 194 DVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSPL 238
           D+   N+V+ ++IA+AR +YGG G   +  +     +   +   PL
Sbjct: 188 DIQPDNTVASNRIADARFAYGGTGDFDQANQMGWLARFFNSEWWPL 233


>gi|194444848|ref|YP_002040434.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194451511|ref|YP_002045179.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194469566|ref|ZP_03075550.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194734750|ref|YP_002114179.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195874175|ref|ZP_03080178.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197248047|ref|YP_002146863.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197265095|ref|ZP_03165169.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197300930|ref|ZP_03166241.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|198244937|ref|YP_002215957.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|204930741|ref|ZP_03221614.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205358037|ref|ZP_02575136.2| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205358793|ref|ZP_02659164.2| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205359396|ref|ZP_02669711.2| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205360098|ref|ZP_03224515.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205360746|ref|ZP_02686000.2| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|213424683|ref|ZP_03357448.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|194403511|gb|ACF63733.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194409815|gb|ACF70034.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194455930|gb|EDX44769.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194710252|gb|ACF89473.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195630338|gb|EDX48964.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197211750|gb|ACH49147.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197243350|gb|EDY25970.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197289795|gb|EDY29156.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197939453|gb|ACH76786.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|204320200|gb|EDZ05404.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205328053|gb|EDZ14817.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205331927|gb|EDZ18691.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205336407|gb|EDZ23171.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205340986|gb|EDZ27750.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205347398|gb|EDZ34029.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|321223798|gb|EFX48861.1| Flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
          Length = 221

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 51/231 (22%), Positives = 91/231 (39%), Gaps = 10/231 (4%)

Query: 8   VLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDS 67
           +    + L GC    ++        P+          P  G     + S  +S       
Sbjct: 1   MALMVATLTGCAWIPAK--------PLVQGA--TTAQPIPGPVPVANGSIFQSAQPINYG 50

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+                      
Sbjct: 51  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVPRYLQGLFGNSR 110

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            ++   GG + +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  +
Sbjct: 111 ADMEASGGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQGTEFIRFS 170

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 171 GVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 221


>gi|303328378|ref|ZP_07358816.1| flagellar L-ring protein FlgH [Desulfovibrio sp. 3_1_syn3]
 gi|302861708|gb|EFL84644.1| flagellar L-ring protein FlgH [Desulfovibrio sp. 3_1_syn3]
          Length = 239

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 64/249 (25%), Positives = 105/249 (42%), Gaps = 23/249 (9%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMS-PMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M     + +   + L  C +        P +  P+    +            + +     
Sbjct: 1   MKTQLIVPVLGLAFLL-CAACGGGAHKRPALQHPVTPPQE----------YRQETSGPNN 49

Query: 60  SYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS- 117
             SL+  S    LF DSRA  VGDI+ V +  + +A    +T  +++ S   +++  F  
Sbjct: 50  PGSLFAASEEDTLFADSRARRVGDIVVVKLVENTKAQNKAETTANKDGSNDYQVAAMFGK 109

Query: 118 ---------LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLI 168
                      G Q       LN       S  G   R   +   +AA V  +L  G L 
Sbjct: 110 SKTGFVPLVGIGPQARVGTPVLNTSSVSDLSATGKTKRENYVTTSMAARVLRVLPGGLLQ 169

Query: 169 ISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIG 228
           I G++E+RVN+E   + V G++R +DVDA NSV   +IA+A I Y G+G   +  +P   
Sbjct: 170 IEGAREIRVNEETEYMVVRGMIRAKDVDAENSVYSTQIADASIEYYGRGVLADKQKPGWF 229

Query: 229 HQLIENLSP 237
            +L++N+ P
Sbjct: 230 TRLMDNIWP 238


>gi|319898641|ref|YP_004158734.1| flagellar L-ring protein precursor (Basal body L-ring protein)
           [Bartonella clarridgeiae 73]
 gi|319402605|emb|CBI76150.1| Flagellar L-ring protein precursor (Basal body L-ring protein)
           [Bartonella clarridgeiae 73]
          Length = 210

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 86/216 (39%), Positives = 131/216 (60%), Gaps = 7/216 (3%)

Query: 22  ISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVG 81
           + +    P  SP+ ++L   +           S+S     SL+R S  + ++D RA+  G
Sbjct: 1   MKDFNSAPNFSPVRANLGYASGNAVSVYPPAPSESQY---SLYRSSANSFYRDPRAMKPG 57

Query: 82  DILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGK 141
           D+LTV I I+D+A F+N++   R++     +  G+S       +  G++  +    S G 
Sbjct: 58  DVLTVQIFINDRASFNNKSDLKRDSGSKYTIGAGYSFM----NKFAGSIEGESSSQSKGD 113

Query: 142 GSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSV 201
             I R E + L IAAIVT +L NGNL+I+GSQEVRVN+E+R LN+ G+VRP+D+  +N +
Sbjct: 114 AKIERQENIRLSIAAIVTDVLPNGNLVINGSQEVRVNNELRVLNIAGLVRPRDISGNNMI 173

Query: 202 SYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            YDKIAEARISYGG+GR +E+ +PP G QL+  ++P
Sbjct: 174 DYDKIAEARISYGGRGRMSEIQQPPYGQQLLNQIAP 209


>gi|310816833|ref|YP_003964797.1| flagellar L-ring protein FlgH [Ketogulonicigenium vulgare Y25]
 gi|308755568|gb|ADO43497.1| flagellar L-ring protein FlgH [Ketogulonicigenium vulgare Y25]
          Length = 240

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 89/243 (36%), Positives = 122/243 (50%), Gaps = 10/243 (4%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R S ++ C  + L  C      +   PQ++P   S +    +                
Sbjct: 1   MLRPSLLLACAMT-LSACGGGTPLVGQ-PQLTPSLMSDEHLAMVSSDMPMSL--GPLNTG 56

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF- 119
            SLW  +  +L  D RA+  GDILTV I I+D+A F N +G+SR  S    +     L  
Sbjct: 57  ASLWSGTRNSLLGDRRAMQRGDILTVVISINDRAEFSNSSGQSRTASQDMSVGALLGLPE 116

Query: 120 -----GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
                      +N  +  D     +G GS+SR E+L L +AA V   L NG L I GSQE
Sbjct: 117 RAAEVLHGGATLNPGIQLDSSSNFNGTGSVSRNERLTLRVAATVIGTLPNGALEIIGSQE 176

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           +RVN+EIR L VTG VR  D++  N VSYD+IA ARISYGG+G  +    P  G Q+I+ 
Sbjct: 177 IRVNNEIRELTVTGFVRTADINRQNEVSYDRIASARISYGGRGPISVAQSPRYGQQIIDR 236

Query: 235 LSP 237
           ++P
Sbjct: 237 IAP 239


>gi|329888228|ref|ZP_08266826.1| flagellar L-ring family protein [Brevundimonas diminuta ATCC 11568]
 gi|328846784|gb|EGF96346.1| flagellar L-ring family protein [Brevundimonas diminuta ATCC 11568]
          Length = 240

 Score =  191 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 83/220 (37%), Positives = 122/220 (55%), Gaps = 10/220 (4%)

Query: 24  EITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDI 83
           E    P+++P+G              +     ++  + SLWR    + F D RA  VGDI
Sbjct: 24  EAVKGPELAPIGYPAALVPVEQAYLPEP----TSASANSLWRTGARSFFGDQRARRVGDI 79

Query: 84  LTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG------GGA 137
           LTV I I+D+A   N T R+R NS    ++  F L         G  +            
Sbjct: 80  LTVAIDINDRAQTQNTTQRNRTNSASGGVTNFFGLENSLGRAFPGGFDPANMIGTEGAVN 139

Query: 138 SSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDA 197
           ++G GS++R+E++NL +AA+VTA++ NGNL+I G QEVR N E+R L V GIVRP+D+D+
Sbjct: 140 ANGSGSVNRSERVNLTVAAVVTAVMPNGNLVIQGRQEVRTNREVRELTVAGIVRPEDIDS 199

Query: 198 HNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            N++ + +IAEARISYGG+G  + +   P    L+E  SP
Sbjct: 200 ANTIRHSQIAEARISYGGRGDISRMQATPAAQSLVERFSP 239


>gi|254463113|ref|ZP_05076529.1| flagellar L-ring protein FlgH [Rhodobacterales bacterium HTCC2083]
 gi|206679702|gb|EDZ44189.1| flagellar L-ring protein FlgH [Rhodobacteraceae bacterium HTCC2083]
          Length = 202

 Score =  191 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 79/201 (39%), Positives = 109/201 (54%), Gaps = 6/201 (2%)

Query: 43  RMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGR 102
            +           S     SLWR    +L  D RAL  GDI+TV I IDD+A   N T R
Sbjct: 1   MIYQGLPQSVERGSVVDGSSLWRRDRMSLLGDRRALQQGDIMTVVIEIDDKAEISNTTSR 60

Query: 103 SRNNSLHRKLSGGFSLFGQQTPQMNGN------LNYDGGGASSGKGSISRAEKLNLLIAA 156
           SR+ S    +     +  +   Q          ++ +   +S G GS+ R EKL L IAA
Sbjct: 61  SRDGSDSMNIPNLVGIPQKLAKQWPDGASPTNAIDLNSNSSSKGDGSVRRKEKLTLRIAA 120

Query: 157 IVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGK 216
            +  +L NG L I G+QEVRVN E+R L V G VRP+D+   N ++YDKIA ARISYGG+
Sbjct: 121 TIIQVLPNGVLAIEGTQEVRVNFELRELLVNGYVRPEDISRQNEITYDKIASARISYGGR 180

Query: 217 GRTTELLRPPIGHQLIENLSP 237
           G+ +++ +P  G Q++E + P
Sbjct: 181 GQISDVQQPRYGRQVLEAILP 201


>gi|146281774|ref|YP_001171927.1| flagellar basal body L-ring protein [Pseudomonas stutzeri A1501]
 gi|166214825|sp|A4VJD4|FLGH_PSEU5 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|145569979|gb|ABP79085.1| flagellar L-ring protein precursor FlgH [Pseudomonas stutzeri
           A1501]
          Length = 231

 Score =  191 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 57/245 (23%), Positives = 103/245 (42%), Gaps = 23/245 (9%)

Query: 1   MYRYSFIV-LCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R   +V L  +  L GC +  +     P  +P+                     + + 
Sbjct: 1   MSRLLIVVSLSSAFALAGCVA-PAPKPNDPYYAPVLP--------------RTPLPAAQN 45

Query: 60  SYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           S ++++      L+ D +A  VGDI+T+ +    QA  +  +  S+++S +  L   F  
Sbjct: 46  SGAIYQAGFETYLYDDRKAYRVGDIITITLAERTQASKNASSSISKDSSANIGLGSLFGG 105

Query: 119 FGQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                       M+    YD    +SG G   ++  L+  I   V+ +L NG L + G +
Sbjct: 106 AVSMANPLTGNSMSLGAEYDASRDTSGSGQAGQSNSLSGSITVTVSEVLPNGILAVRGEK 165

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
            + +N     + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P    +   
Sbjct: 166 WMTLNTGDELVRIAGLVRQDDIATDNTVSSTRIADARITYSGTGAFADASQPGWLDRFFM 225

Query: 234 N-LSP 237
           + L P
Sbjct: 226 SPLWP 230


>gi|254496890|ref|ZP_05109738.1| flagelle L-ring protein [Legionella drancourtii LLAP12]
 gi|254353909|gb|EET12596.1| flagelle L-ring protein [Legionella drancourtii LLAP12]
          Length = 224

 Score =  191 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 61/234 (26%), Positives = 106/234 (45%), Gaps = 19/234 (8%)

Query: 1   MYRYSFIVLCYSSL-LFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M  ++F+V+ +S L L GC +    + G              +  P            ++
Sbjct: 1   MRLFNFLVVGFSVLVLGGCDAINPPVQG-----------KNPDYAPTYPAAPDPKQLRRE 49

Query: 60  SYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           S +++    A  LF+ +RA + GDILTV +  +  A  +    + +N+S     S  F  
Sbjct: 50  SGAIYHPETALPLFETARARHEGDILTVYLLENTNASKNATLQQMKNDSNVMTNSATFG- 108

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                   + N+N +     +G     +  +L   I+  V  +L NGNL++ G + V++N
Sbjct: 109 -----DTYSMNINLNNQRQFNGSAQAVQNNQLAGSISVTVAKVLSNGNLVVQGEKWVKIN 163

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
                + ++GIVRPQD+ A NS + D++A ARISYGG G+           + +
Sbjct: 164 QGEEYVRLSGIVRPQDIKADNSTTSDRVANARISYGGTGQVNNTNAQGWLARFM 217


>gi|257095356|ref|YP_003168997.1| flagellar L-ring protein [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257047880|gb|ACV37068.1| flagellar L-ring protein [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 229

 Score =  191 bits (485), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 52/206 (25%), Positives = 86/206 (41%), Gaps = 4/206 (1%)

Query: 33  PMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDS-HAALFKDSRALNVGDILTVDIRID 91
           P  +        P    +   + S   + S+++      LF+D RA  VGD +TV I  +
Sbjct: 26  PPTNVHQPMTARPQYRPE-TLAASLAATGSIYQAGASRTLFEDRRARYVGDTITVTITEN 84

Query: 92  DQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLN 151
             A   + T  S+  S+           G+      G L  +    +SGKG  +      
Sbjct: 85  TSAATKSNTAVSKTGSISAAAGPIVGFPGKSFQG--GELKANSSNVASGKGDAAANNVFT 142

Query: 152 LLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARI 211
             I   V  +L NGNL++SG ++V +      + ++G+V P  V+A N+V+  +IA+ARI
Sbjct: 143 GTITVTVIEVLPNGNLLVSGEKQVAIGHGQEYIRLSGVVNPYFVNAANTVASSQIADARI 202

Query: 212 SYGGKGRTTELLRPPIGHQLIENLSP 237
            Y   G  +E        +      P
Sbjct: 203 EYKESGTISEAQVMGWLARFFLTFLP 228


>gi|293395586|ref|ZP_06639869.1| flagellar L-ring protein FlgH [Serratia odorifera DSM 4582]
 gi|291421905|gb|EFE95151.1| flagellar L-ring protein FlgH [Serratia odorifera DSM 4582]
          Length = 219

 Score =  191 bits (485), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 53/229 (23%), Positives = 88/229 (38%), Gaps = 12/229 (5%)

Query: 10  CYSSLLFGCHSSISEITGIPQMSPMGSSLD-ENNRMPFLGIDFKNSDSTKKSYSLWRDSH 68
                + GC              P    +D   +  P        + S  +S       +
Sbjct: 1   MLMLTIGGCA-----------YIPHKPLVDGSTSAQPAPASAPMPNGSIFQSVQPMNYGY 49

Query: 69  AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
             LF+D R  N+GD LT+ ++ +  A   +    SRN S    ++               
Sbjct: 50  QPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRNGSSKFGVATAPRYLDGLFGNARA 109

Query: 129 NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
           ++   G     GKG  +     N  I   V  +L NGNL + G +++ +N     +  +G
Sbjct: 110 DMEMSGDNTFGGKGGANANNTFNGTITVTVNQVLANGNLHVVGEKQIAINQGTEFIRFSG 169

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +V P+ +  +NSV+  ++A+ARI Y G G   E        +   NLSP
Sbjct: 170 VVNPRTISGNNSVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNLSP 218


>gi|49205095|dbj|BAC75959.2| flagellar L-ring protein FlgH [Pseudomonas syringae pv. tabaci]
          Length = 222

 Score =  191 bits (485), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 49/233 (21%), Positives = 98/233 (42%), Gaps = 23/233 (9%)

Query: 12  SSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDS-HAA 70
            +LL GC +  ++    P  +P+                     +   + ++++      
Sbjct: 4   ITLLSGCVAPTAK-PNDPYYAPVLP--------------RTPMSAAANNGAIYQAGFEQN 48

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ-----QTPQ 125
           L+ D +A  +GDI+T+ +     A     +  +++++    L+  F              
Sbjct: 49  LYGDRKAFRIGDIITITLSERMAASKAATSAMTKDSTNSIGLTSLFGSGLTTNNPIGGND 108

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
           ++ N  Y+G   + G G  +++  L   +   V  +L NG L + G + + +N     + 
Sbjct: 109 LSLNAGYNGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGILAVRGEKWMTLNTGDELVR 168

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P    +    LSPL
Sbjct: 169 IAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGWFDRFF--LSPL 219


>gi|163750567|ref|ZP_02157805.1| flagellar L-ring protein FlgH [Shewanella benthica KT99]
 gi|161329722|gb|EDQ00711.1| flagellar L-ring protein FlgH [Shewanella benthica KT99]
          Length = 228

 Score =  191 bits (485), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 53/225 (23%), Positives = 90/225 (40%), Gaps = 19/225 (8%)

Query: 17  GCHSS--ISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA-LFK 73
           GC S+     I   P  SP+                         + S+++DS A+ L+ 
Sbjct: 18  GCTSTSGQKPIPDDPYYSPVYPE--------------APPTKIAATGSMYQDSQASSLYS 63

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYD 133
           D +AL VGDI+TV +    QA         +  +L                    +L Y 
Sbjct: 64  DIKALKVGDIITVILMEATQAKKSASNEIKKGTNLTLD-PIYAGGGNITIGGQALDLRYK 122

Query: 134 GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQ 193
               +  +    ++  L   I+A V  +L NGNL+I G + + +N+    + +TG+VR Q
Sbjct: 123 DSMNTKRESDADQSNSLTGSISANVMQVLNNGNLVIRGEKWISINNGNEFIRITGVVRSQ 182

Query: 194 DVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
           D+   N++   ++A ARI Y G G   ++ +         +   P
Sbjct: 183 DIRPDNTIDSTRVANARIQYSGTGTFADVQQVGWLSSFFMSGWWP 227


>gi|82544455|ref|YP_408402.1| flagellar basal body L-ring protein [Shigella boydii Sb227]
 gi|110816541|sp|Q31ZD4|FLGH_SHIBS RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|81245866|gb|ABB66574.1| basal-body outer-membrane L (lipopolysaccharide layer) ring protein
           [Shigella boydii Sb227]
 gi|332094025|gb|EGI99077.1| flagellar L-ring family protein [Shigella boydii 3594-74]
          Length = 232

 Score =  191 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 51/232 (21%), Positives = 89/232 (38%), Gaps = 10/232 (4%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I       L GC    S        +P+       +  P  G     + S  +S      
Sbjct: 11  ISSLLVLSLTGCAWIPS--------TPLVQGA--TSAQPVPGPTPVANGSIFQSAQPINY 60

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D R  N+GD LT+ ++ +  A   +    SR+   +                 
Sbjct: 61  GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNA 120

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     +  
Sbjct: 121 RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF 180

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G+V P+ +   N+V   ++ +ARI Y G G   E            NLSP+
Sbjct: 181 SGVVNPRTISGSNTVPSTQVVDARIEYVGNGYINEAQNMGWLQHFFLNLSPM 232


>gi|315638552|ref|ZP_07893728.1| flagellar L-ring protein FlgH [Campylobacter upsaliensis JV21]
 gi|315481396|gb|EFU72024.1| flagellar L-ring protein FlgH [Campylobacter upsaliensis JV21]
          Length = 232

 Score =  191 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 60/244 (24%), Positives = 102/244 (41%), Gaps = 20/244 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +    +L ++    GC + +      P++S    +  E           ++ +     
Sbjct: 1   MKKVFVYMLPFAFF--GCSAVVD-----PEISMKPPTYVEE------LAPKQSHNVESAP 47

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SL+      LF D +A+NV D++TV I+             SR N+ +          G
Sbjct: 48  GSLFGKGDNPLFSDKKAMNVNDLVTVIIQESTTQSTQANKTTSRTNNANLGGGALVGSTG 107

Query: 121 QQTPQMNG-------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                +N            +     +G G+ SR E  N  I+  V  IL NGN  I GS+
Sbjct: 108 AVNQVLNKVNSYSNIGFQTNSTNNYTGTGTQSRNESFNTTISTRVIKILSNGNYFIEGSR 167

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G      R P G + IE
Sbjct: 168 ELLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKILYKTEGEVDRSTRKPWGSKFIE 227

Query: 234 NLSP 237
            + P
Sbjct: 228 AVWP 231


>gi|149188069|ref|ZP_01866364.1| flagellar L-ring protein precursor H [Vibrio shilonii AK1]
 gi|148838057|gb|EDL54999.1| flagellar L-ring protein precursor H [Vibrio shilonii AK1]
          Length = 257

 Score =  191 bits (484), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 47/259 (18%), Positives = 94/259 (36%), Gaps = 29/259 (11%)

Query: 1   MYRYSFIVLCYSSLLFGCH---------------SSISEITGIPQMSP---------MGS 36
           M +   + +   ++L GC                +++  + G    S             
Sbjct: 1   MKK--LLCVSLLAVLSGCAQFGQEESVDDVSNSTTTVDAVEGDKTQSSGIVDTLRGRTDP 58

Query: 37  SLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAV 95
             D+    P      K       + SL+   +    + DS+   +GDI+TV++    +A 
Sbjct: 59  VADDPAWAPIH-PKNKPEHYAAATGSLFNTHYARDWYDDSKPRGIGDIITVELNEATKAA 117

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
                  S+ N                    + +          G  S +++  L+  I 
Sbjct: 118 KSADADLSKANDSSMD-PLFVGGRPVTVNDYDFSYELKNDNNFKGNASANQSNSLSGSIT 176

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             V  +L NGNL+I G + + +N     + ++G +RP D++  N+++ ++I+ ARI Y G
Sbjct: 177 VEVIEVLANGNLVIRGEKWLTLNTGDEYIRLSGTIRPDDIEFDNTIASNRISNARIQYSG 236

Query: 216 KGRTTELLRPPIGHQLIEN 234
            G   ++  P    +    
Sbjct: 237 TGTQQDMQEPGFLARFFNV 255


>gi|222823644|ref|YP_002575218.1| flagellar L-ring protein FlgH [Campylobacter lari RM2100]
 gi|222538866|gb|ACM63967.1| flagellar L-ring protein FlgH [Campylobacter lari RM2100]
          Length = 233

 Score =  191 bits (484), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 59/243 (24%), Positives = 106/243 (43%), Gaps = 17/243 (6%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M   +        ++FGC +++      P ++    +  E           +N+++    
Sbjct: 1   MKFKNVNFYLLPFVMFGCSATVD-----PHINMKPPAYVEE------LAPKQNNNTQSNP 49

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SL+      LF D +A+NV D++TV IR +           S+NN+++       +  G
Sbjct: 50  GSLFGKGDNPLFSDKKAMNVNDLVTVVIRENATQNSQGSKATSKNNNVNLGGGQVTTGAG 109

Query: 121 QQTPQM------NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
               +       N            G GS +R+E     I+A V  +L NGN  I GS+E
Sbjct: 110 LSKARDFINDYTNIGYTTASTSQYQGTGSQTRSENFQTTISARVIKVLSNGNYFIEGSRE 169

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           + +N E + + ++G++RP D+   N +    IA+A+I Y  +G   +  R P G + +E 
Sbjct: 170 LLINGEKQIIQLSGVIRPYDISQDNMIDSKYIADAKILYKTEGDIDKSTRKPWGTKFMET 229

Query: 235 LSP 237
           + P
Sbjct: 230 IWP 232


>gi|220903673|ref|YP_002478985.1| flagellar basal body L-ring protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|219867972|gb|ACL48307.1| flagellar L-ring protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 239

 Score =  191 bits (484), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 59/213 (27%), Positives = 91/213 (42%), Gaps = 13/213 (6%)

Query: 36  SSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQA 94
            +L +    P       N        SL+  S    LF DSRA  VGDI+ V +  + +A
Sbjct: 28  PALQQPVVDPQEYRQEANGPD--NPGSLFAASEQDTLFSDSRARRVGDIVVVKLVENTKA 85

Query: 95  VFDNQTGRSRNNSLHRKLSGGFS----------LFGQQTPQMNGNLNYDGGGASSGKGSI 144
               +T  ++  +   ++                 G         L        SG G  
Sbjct: 86  QNKAETTANKKGANDYQVGALMGQGSHGFIPFLGLGPTNRVGTPALTTSSTSDLSGTGKT 145

Query: 145 SRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYD 204
            R   +   +AA V  +L  G L I G++E+RVN+E   + V G+VR +DV A NSV   
Sbjct: 146 KRENYVTTSLAARVIRVLPGGLLQIEGAREIRVNEETEYMVVRGMVRAKDVSADNSVLST 205

Query: 205 KIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +IA+A I Y G+G   +  +P    +L++N+ P
Sbjct: 206 QIADASIEYYGRGVLADKQKPGWFTRLMDNIWP 238


>gi|110816539|sp|Q46PF8|FLGH_RALEJ RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
          Length = 229

 Score =  191 bits (484), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 58/238 (24%), Positives = 93/238 (39%), Gaps = 20/238 (8%)

Query: 3   RYSFIVLCYSSLLFG-CHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
           R  + +   + L  G C            + P    +               +     + 
Sbjct: 8   RVLYCLAGLALLASGGCA-----------LMPREPLVQLPTTARAEPRPMGPA-----TG 51

Query: 62  SLWRDSHA--ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
           S++  S+A   LF+D R  NVGDILT+ I  +  A  ++ T  SR  S            
Sbjct: 52  SIFASSYAGNPLFEDRRPRNVGDILTIVITENVNATKNSGTNASRTGSTSMAFDAVPKAL 111

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                  + N + +G  A    G  S A   N  I   V  +L NGNL++SG +++ +N 
Sbjct: 112 AGLFSS-SSNASINGANALKASGGASAANTFNGTITVTVLEVLANGNLVVSGEKQLAINQ 170

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
               +  +G+V P+ +   N V   ++A+ARI Y  KG   E        +   N+SP
Sbjct: 171 GAEFIRFSGVVNPRTITGDNGVLSTQVADARIEYTAKGYIDEAQNMGWLQRFFLNVSP 228


>gi|331007442|ref|ZP_08330619.1| Flagellar L-ring protein FlgH [gamma proteobacterium IMCC1989]
 gi|330418749|gb|EGG93238.1| Flagellar L-ring protein FlgH [gamma proteobacterium IMCC1989]
          Length = 236

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 50/242 (20%), Positives = 98/242 (40%), Gaps = 24/242 (9%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
            FI++     L  C               + S++  ++      +          + SL+
Sbjct: 9   FFIIIVSVLPLAAC---------------IPSAIKPDDPKYAPVLPEPKPVPKPTNGSLF 53

Query: 65  RD-SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT 123
           ++    +LF ++    +GDI+T+ +  +  +      G  + + +     G  ++ G+  
Sbjct: 54  QEYQGMSLFGNTNNHRIGDIITITLDEETISSKSTGVGIDKTSDVSLLEGGNSTILGRDN 113

Query: 124 -------PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                    +   L+     + SG  S  ++  L   I+  V  IL NGNLI+ G + + 
Sbjct: 114 TKNIPIVGDVTIPLSSSQDRSFSGDASADQSNSLQGNISVTVVDILANGNLIVRGEKWMT 173

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-L 235
           +N     + V+G++R +DV   N VS  K+A ARISY G G   +  +     +   + +
Sbjct: 174 LNRGEEYIRVSGMLRKEDVSLDNVVSSTKLANARISYSGTGDLADSQKMGWLGRFFNSVI 233

Query: 236 SP 237
            P
Sbjct: 234 WP 235


>gi|149911699|ref|ZP_01900307.1| Flagellar basal body L-ring protein [Moritella sp. PE36]
 gi|149805229|gb|EDM65246.1| Flagellar basal body L-ring protein [Moritella sp. PE36]
          Length = 251

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 60/254 (23%), Positives = 95/254 (37%), Gaps = 21/254 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSIS---------------EITGIPQMSPMGSSLDENNRMP 45
           M  + F +  +   L GC S +                E    P         D  +  P
Sbjct: 1   MRNFIFALFVFMQ-LVGCASLVKVKENVVAKNEDATKTEDAKEPADVAETPQQDSPDYAP 59

Query: 46  FLGIDFKNSDSTKKSYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR 104
              +   N    K + SL+   +   +F D +A  VGDI+TV +     A     +   +
Sbjct: 60  I--VPDNNPVQAKVTGSLFNPQYNNNIFSDIKARRVGDIITVMLTESTSAKKQASSNLGK 117

Query: 105 NNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN 164
           +NS                       + +   + SG GS  ++  L   I+  V  +L N
Sbjct: 118 DNSFELD-PVNLGGEDVVIGGYTIEGSLNQKSSFSGNGSADQSNSLKGNISVTVVRVLPN 176

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
            NL+I G + + +N+    + +TG++RPQDVDA N V    IA ARI YG      E   
Sbjct: 177 NNLVIRGEKWLMLNNGSEYIRLTGLLRPQDVDADNKVDSSLIANARIQYGAVDDLGEAQV 236

Query: 225 PPIGHQLIENL-SP 237
                + + +   P
Sbjct: 237 QGWATKFLNSSKWP 250


>gi|291334317|gb|ADD93978.1| flagellar L ring protein FlgH [uncultured marine bacterium
           MedDCM-OCT-S09-C247]
          Length = 225

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 62/241 (25%), Positives = 107/241 (44%), Gaps = 19/241 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           MY+Y   +     LL  C + + +   +             +  P    + +  D +   
Sbjct: 1   MYKY---LAPLIFLLAACDTYVEDKRSV-------------DFEPIYLPETEQEDESSDL 44

Query: 61  YSLWRDSHAALFK-DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            ++++ +  +LF  ++RA  +GDILTV      QA        +R++     L       
Sbjct: 45  GTIYQQNKGSLFAMEARAHRIGDILTVSFTESFQATKSQNAASTRSSENSLTLPTVMKKL 104

Query: 120 GQQTPQMN--GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                 +   G L   G    SG GS +++  L  LI+  V  +  NGNL I G +++ +
Sbjct: 105 PVIGKGIPEAGELASSGESKFSGSGSSNQSNSLTGLISVHVVRVFTNGNLEILGQKKLTL 164

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N+    + V+GIVRP+D+ + N V  D+IA A I+Y G G T    R     +++E ++P
Sbjct: 165 NNGDEYIRVSGIVRPRDISSDNIVQSDRIANADINYIGAGDTARSGRKGWYTKMLETITP 224

Query: 238 L 238
           L
Sbjct: 225 L 225


>gi|57242591|ref|ZP_00370528.1| flagellar L-ring protein FlgH [Campylobacter upsaliensis RM3195]
 gi|57016520|gb|EAL53304.1| flagellar L-ring protein FlgH [Campylobacter upsaliensis RM3195]
          Length = 232

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 60/244 (24%), Positives = 102/244 (41%), Gaps = 20/244 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +    +L ++    GC + +      P++S    +  E           ++ +     
Sbjct: 1   MKKVFVYMLPFAFF--GCSAVVD-----PEISMKPPTYVEE------LAPKQSHNVESAP 47

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SL+      LF D +A+NV D++TV I+             SR N+ +          G
Sbjct: 48  GSLFGKGDNPLFSDKKAMNVNDLVTVIIQESTTQSTQANKTTSRTNNANLGGGALVGSTG 107

Query: 121 QQTPQMNG-------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                +N            +     +G G+ SR E  N  I+  V  IL NGN  I GS+
Sbjct: 108 AVNQVLNRVNSYSNIGFQTNSTNNYTGTGTQSRNESFNTTISTRVIKILSNGNYFIEGSR 167

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G      R P G + IE
Sbjct: 168 ELLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKILYKTEGEVDRSTRKPWGSKFIE 227

Query: 234 NLSP 237
            + P
Sbjct: 228 AVWP 231


>gi|293408370|ref|ZP_06652209.1| flagellar L-ring protein FlgH [Escherichia coli B354]
 gi|291471548|gb|EFF14031.1| flagellar L-ring protein FlgH [Escherichia coli B354]
          Length = 221

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 52/239 (21%), Positives = 92/239 (38%), Gaps = 20/239 (8%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            +    ++    LL GC S    +                              +  ++ 
Sbjct: 1   MKNYLWLVALFPLLSGCESQAILVKKDDAYF-------------APPTTEAPPPADGRAG 47

Query: 62  SLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            ++   +  +L  D RA  VGDILTV +    Q+    +T   ++N++       F    
Sbjct: 48  GVFETGYNWSLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKSNTVDIGAPTIFG--- 104

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
               +   + + D      G  +  +   L   I   V A+  NG L I G + + +N  
Sbjct: 105 --HTKDKLSGSIDANRDFDGSATSQQQNSLRGEITVSVHAVQPNGILEIRGEKWLTLNQG 162

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSPL 238
              + ++G+VR  D+   NSVS  +IA+ARISY G+G  ++        +L  + L P+
Sbjct: 163 DEYIRLSGLVRADDIQNDNSVSSQRIADARISYAGRGALSDANAAGWLTRLFNHPLFPI 221


>gi|114307378|gb|ABI58621.1| flagellar L-ring protein [Nitrosomonas eutropha C91]
          Length = 212

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 45/212 (21%), Positives = 88/212 (41%), Gaps = 10/212 (4%)

Query: 34  MGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDS--------HAALFKDSRALNVGDILT 85
           +  +      M     +      ++ +  +++ +        +  LF+D RA  +GD + 
Sbjct: 2   ITPAPKVQQPMTIRPPEPLIIPVSQSNGGIYQAAFNYQGSGRYTPLFEDRRARGIGDTII 61

Query: 86  VDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSIS 145
           V +     A   + +   R+  +   +     L  +   Q + +L         GKG  S
Sbjct: 62  VMLNEKTNASKKSGSNAQRDGGIDLSVPSFLGLPFKSIFQ-DLDLEAKSSNKFDGKGESS 120

Query: 146 RAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDK 205
                   I   V  IL NGNL++SG +++ +N     + ++G++ P +V  +N+VS  +
Sbjct: 121 SNNNFTGTITVTVIDILPNGNLLVSGEKQIGINQGHEFIRLSGVINPINVM-NNTVSSVQ 179

Query: 206 IAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +A+ARI Y G G   E        +   ++SP
Sbjct: 180 VADARIEYRGTGYLDEAQTMGWLSRFFLSISP 211


>gi|268679671|ref|YP_003304102.1| flagellar L-ring protein [Sulfurospirillum deleyianum DSM 6946]
 gi|268617702|gb|ACZ12067.1| flagellar L-ring protein [Sulfurospirillum deleyianum DSM 6946]
          Length = 237

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 58/246 (23%), Positives = 101/246 (41%), Gaps = 20/246 (8%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            R     L  + ++ GC +  +     P++S       +            N +      
Sbjct: 1   MRVFTCSLVTAFIVLGCSNHPA----SPEISMKPPVYVDE------IPSRVNENIASNPG 50

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SL+      LF D +A++V DI+T+ I          +   S+ +S          +   
Sbjct: 51  SLFGQGDNPLFADLKAMHVNDIVTITITEQTVQTSSGKKALSKESSSDLNAGVIAGVPFG 110

Query: 122 Q----------TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
                      T   N   N     + +G GS SR E     I+A +  +L NGN  I G
Sbjct: 111 GVVGNVADKIATKSANLGFNAGSTNSFTGTGSTSRNESFTTTISARIIKVLNNGNYFIEG 170

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           S+E+ +N E + + V+G++RP D+D +N++    IA+A+I Y  +G   +    P G + 
Sbjct: 171 SRELLINGEKQLIQVSGVIRPYDIDQYNNIDSKYIADAKILYKTEGDIDQTTTKPWGSKF 230

Query: 232 IENLSP 237
           +E + P
Sbjct: 231 METIWP 236


>gi|73539453|ref|YP_299820.1| flagellar basal body L-ring protein [Ralstonia eutropha JMP134]
 gi|72122790|gb|AAZ64976.1| Flagellar L-ring protein [Ralstonia eutropha JMP134]
          Length = 232

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 58/238 (24%), Positives = 93/238 (39%), Gaps = 20/238 (8%)

Query: 3   RYSFIVLCYSSLLFG-CHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
           R  + +   + L  G C            + P    +               +     + 
Sbjct: 11  RVLYCLAGLALLASGGCA-----------LMPREPLVQLPTTARAEPRPMGPA-----TG 54

Query: 62  SLWRDSHA--ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
           S++  S+A   LF+D R  NVGDILT+ I  +  A  ++ T  SR  S            
Sbjct: 55  SIFASSYAGNPLFEDRRPRNVGDILTIVITENVNATKNSGTNASRTGSTSMAFDAVPKAL 114

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                  + N + +G  A    G  S A   N  I   V  +L NGNL++SG +++ +N 
Sbjct: 115 AGLFSS-SSNASINGANALKASGGASAANTFNGTITVTVLEVLANGNLVVSGEKQLAINQ 173

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
               +  +G+V P+ +   N V   ++A+ARI Y  KG   E        +   N+SP
Sbjct: 174 GAEFIRFSGVVNPRTITGDNGVLSTQVADARIEYTAKGYIDEAQNMGWLQRFFLNVSP 231


>gi|239817162|ref|YP_002946072.1| flagellar L-ring protein [Variovorax paradoxus S110]
 gi|239803739|gb|ACS20806.1| flagellar L-ring protein [Variovorax paradoxus S110]
          Length = 227

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 57/231 (24%), Positives = 95/231 (41%), Gaps = 18/231 (7%)

Query: 9   LCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDS- 67
           +  + L  GC     E      M+                 D   S   + + ++++D  
Sbjct: 12  VAVTVLASGCAQVPREPLVHQPMT--------------ARADNMASMPRRANGAIFQDGP 57

Query: 68  -HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
             +ALF+D R  NVGDILT+ I     A  ++    SR  SL    +G   L G      
Sbjct: 58  GGSALFEDRRPRNVGDILTIVISERVNASKNSGASASRTGSLAADFAGIPKLLGSLLDGQ 117

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
           +  L+      + G  +       N +I   V  ++ NGNL++SG +++ +N     +  
Sbjct: 118 DAKLSGGNKLDAKGGANA--NNTFNGVITVTVVDVMRNGNLLVSGEKQMGINQGTEYIRF 175

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +G+V P+ V  +N+V    +A+ARI Y  KG   E        +   N+ P
Sbjct: 176 SGVVNPRTVSGNNTVPSTLVADARIEYTAKGYIDEAQHMGWMQRFFLNVMP 226


>gi|238782795|ref|ZP_04626824.1| Flagellar L-ring protein [Yersinia bercovieri ATCC 43970]
 gi|238716218|gb|EEQ08201.1| Flagellar L-ring protein [Yersinia bercovieri ATCC 43970]
          Length = 260

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 51/234 (21%), Positives = 93/234 (39%), Gaps = 10/234 (4%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
               +  +  L GC      I   P +  +          P        + S  ++    
Sbjct: 37  FLSPIVLTLFLTGCS----YIPHQPLVGGV------TTASPASPTMTTVNGSIFQTGQAM 86

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP 124
              +  +F+D R  NVGD LT+ ++ +  A   +    +R  S    +    ++      
Sbjct: 87  SYGYQPMFEDRRPRNVGDTLTIVLQENVSASKSSSASANRGGSTGISVDAVPNMLSGLLG 146

Query: 125 QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
               N    G    SGKG  +     +  I   V  +LENGNL + G +++ +N     +
Sbjct: 147 GDRANTAISGSSDFSGKGGAAARNTFSGTITVTVQQLLENGNLRVVGEKQIAINQGTEFI 206

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
             +G+V P+ + + N+V   ++++ARI Y G G   E  +     +L  N+SP+
Sbjct: 207 RFSGVVNPRTISSSNTVISTQVSDARIEYVGNGYINEAQQMGWLQRLFLNISPI 260


>gi|188592120|ref|YP_001796718.1| flagellar basal body l-ring protein [Cupriavidus taiwanensis LMG
           19424]
 gi|226701916|sp|B2AI82|FLGH_CUPTR RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|170938494|emb|CAP63481.1| FlgH: Flagellar L-ring protein ; signal peptide [Cupriavidus
           taiwanensis LMG 19424]
          Length = 229

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 57/233 (24%), Positives = 91/233 (39%), Gaps = 19/233 (8%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           +         GC            + P    +               +     S S+++ 
Sbjct: 13  LAGVAMLAASGCA-----------LMPREPLVQMPTTARAEPRPIGPA-----SGSIFQS 56

Query: 67  SHA--ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP 124
           S+A   LF+D R  NVGDILT+ I  +  A  ++ T  SR  +            G    
Sbjct: 57  SYAGNPLFEDRRPRNVGDILTILITENVNASKNSGTNTSRTGNAALAFDSVPRALGGLFG 116

Query: 125 QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
             + N N +G       G  S A   N  I   V  +L NGNL++SG +++ +N     +
Sbjct: 117 T-SQNANINGANTMKASGGASAANTFNGTITVTVLEVLANGNLVVSGEKQMAINQGAEFI 175

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
             +G+V P+ +   N+V   ++A+ARI Y  KG   E        +   N+SP
Sbjct: 176 RFSGVVNPRTITGDNAVLSTQVADARIEYTAKGVIDEAQNMGWLQRFFLNVSP 228


>gi|254516992|ref|ZP_05129050.1| flagellar L-ring protein FlgH [gamma proteobacterium NOR5-3]
 gi|219674497|gb|EED30865.1| flagellar L-ring protein FlgH [gamma proteobacterium NOR5-3]
          Length = 231

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 55/205 (26%), Positives = 91/205 (44%), Gaps = 5/205 (2%)

Query: 36  SSLDENNRMPFLGIDFKNSDSTKKSYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQA 94
           S  +     P    +   S +   + SL+  +    LF+D RA  +GDI++V +     A
Sbjct: 27  SPPEYVKIEPIEYPEVTVS-TAPITGSLYASNRSMFLFEDVRAHEIGDIVSVVLVESTSA 85

Query: 95  VFDNQTGRSRNNSLHRKLSGGFSLFGQ-QTPQMNGNLNYDGGGASSGKGSISRAEKLNLL 153
                T  S++ S+                 + +         A   +GS +++ +LN  
Sbjct: 86  TKSADTDVSKDGSVSIVEPTILGAPVTINNGRYSLGTELSSSSAFESEGSSNQSNRLNGS 145

Query: 154 IAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISY 213
           IA  V+ +L NGNL I G + +++N     + + GIVRP+D+   N++    +A+ARISY
Sbjct: 146 IAVQVSKVLPNGNLEIQGEKWIKINQGDEYIRLRGIVRPEDLSPTNTIPSTLVADARISY 205

Query: 214 GGKGRTTELLRPPIGHQLIENLSPL 238
           GG G   E   P    +     SPL
Sbjct: 206 GGTGILNESNTPGWLTRFFM--SPL 228


>gi|254508442|ref|ZP_05120562.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus 16]
 gi|219548652|gb|EED25657.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus 16]
          Length = 260

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 43/216 (19%), Positives = 89/216 (41%), Gaps = 14/216 (6%)

Query: 20  SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH-AALFKDSRAL 78
                + G P  +P+       +                ++ SL+  +  ++L+ DS+  
Sbjct: 56  GRNDPVAGDPAWAPIHPKHKREHYA-------------AETGSLFNSASTSSLYDDSKPR 102

Query: 79  NVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGAS 138
            VGDI+TV +    +A        S+ N    +         +     N + + +     
Sbjct: 103 GVGDIITVTLDEKTKAAKSANADMSKKNDSSMEPLFVGGQELKVGGDYNFSYDLNNTNTF 162

Query: 139 SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAH 198
           +G  S +++  L+  I   V  +L NGNL+I G + + +N     + ++G +RP D+   
Sbjct: 163 AGDASANQSNSLSGSITVEVIEVLGNGNLVIRGEKWLTLNTGDEYIRLSGTIRPDDISFD 222

Query: 199 NSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           N+++ ++++ ARI Y G G   ++  P    +    
Sbjct: 223 NTIASNRVSNARIQYSGTGTQQDMQEPGFLARFFNV 258


>gi|158422254|ref|YP_001523546.1| flagellar L-ring protein precursor [Azorhizobium caulinodans ORS
           571]
 gi|189044478|sp|A8IPJ4|FLGH_AZOC5 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|158329143|dbj|BAF86628.1| flagellar L-ring protein precursor [Azorhizobium caulinodans ORS
           571]
          Length = 239

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 85/226 (37%), Positives = 136/226 (60%), Gaps = 8/226 (3%)

Query: 18  CHSSI-SEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSR 76
           C ++    +   P ++P+G  L E  RMP      +  + T +  S +  +  ++++  R
Sbjct: 17  CQTNSYDSLAYGPTLTPVGQGL-EAGRMPVPQPFQQAKERTFR--SAYNLNSQSMYRALR 73

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG----QQTPQMNGNLNY 132
           A  VGD++ + I IDD+A  DN T RSR ++     +   +L G      +   +GNL  
Sbjct: 74  AAAVGDVIRITIDIDDKAQLDNNTNRSRKSASDVGFASALNLSGFQSGSTSGSASGNLGL 133

Query: 133 DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRP 192
            G  ++ GKG I R+EKL L +AA+VT ++ NGNL+I+GSQE+ VN E+R L + GIV P
Sbjct: 134 TGDTSTDGKGKIDRSEKLRLSLAAVVTEVMPNGNLVINGSQEILVNYEVRVLTLGGIVNP 193

Query: 193 QDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            DV ++N+V+YDK+AEARISY G+GR  ++ +P  G +L + ++P+
Sbjct: 194 LDVTSNNTVAYDKVAEARISYAGRGRLNDVQQPAWGQRLFDAVNPM 239


>gi|300114796|ref|YP_003761371.1| flagellar l-ring protein [Nitrosococcus watsonii C-113]
 gi|299540733|gb|ADJ29050.1| flagellar L-ring protein [Nitrosococcus watsonii C-113]
          Length = 234

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 53/249 (21%), Positives = 94/249 (37%), Gaps = 28/249 (11%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R   ++     L+ GC + +      P  +     +                     +
Sbjct: 1   MNRKKAMLAMAGMLITGCAAQLPP--PDPSFAATRPVV--------------APPPQPSN 44

Query: 61  YSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS-- 117
            +++   +  +LF D RA  VGD+LT+ +         + T   RN S            
Sbjct: 45  GAIYHPGYEISLFTDFRAQRVGDVLTIVLEERTTGEKGSDTAIDRNTSYSLTNPTLLGSG 104

Query: 118 --------LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLII 169
                   +        +  +     GA SG G  S+  +L+  I   V  +L NGNL++
Sbjct: 105 VQFNTPNWVPLASNQNNSLEMAVKSKGAFSGSGDSSQNNRLSGHITVTVAEVLPNGNLVV 164

Query: 170 SGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGH 229
            G + + +N     + ++GIV  + ++  N+VS   +A+ARI+Y G G T E  R     
Sbjct: 165 RGEKVITINHGNEYIKISGIVNRRYINPDNTVSSLNLADARIAYVGDGATQEANRMGWLS 224

Query: 230 QLIEN-LSP 237
           +   +   P
Sbjct: 225 RFFFSRFMP 233


>gi|304321135|ref|YP_003854778.1| flagellar L-ring protein precursor [Parvularcula bermudensis
           HTCC2503]
 gi|303300037|gb|ADM09636.1| flagellar L-ring protein precursor [Parvularcula bermudensis
           HTCC2503]
          Length = 231

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 75/243 (30%), Positives = 124/243 (51%), Gaps = 19/243 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R SF +   +  +  C ++  ++      +P     D     P             ++
Sbjct: 1   MTRSSFPLFIAALAVSACTTTNDQLPYAEIPTPEPIVADLPALAP-------------RN 47

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SLW     +LF + RA NVGDILTV + +D+QA   N   R+R N     ++  F +  
Sbjct: 48  ASLWNQEPQSLFGNRRARNVGDILTVIVSVDEQAEIQNSLARNRTNQEDFSVNALFGIDQ 107

Query: 121 QQTPQMNGNLNYDGG------GASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
           Q   Q+ G+  +           ++G GSI+R E++ L +AA V   L NG+L++ GSQ 
Sbjct: 108 QFQDQLPGDATFSPAVGVTRQATAAGDGSITRQERITLRLAAQVIEQLPNGHLVVVGSQR 167

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           +RVN E+R L + G+VRP+D+   N++++DKIA A I Y G+G+ +    P  G ++++ 
Sbjct: 168 IRVNQEVRDLRLQGVVRPEDITRDNTITHDKIAAADIVYTGQGQISRTTNPKPGSRVLDF 227

Query: 235 LSP 237
           + P
Sbjct: 228 IVP 230


>gi|85058014|ref|YP_453716.1| flagellar basal body L-ring protein [Sodalis glossinidius str.
           'morsitans']
 gi|84778534|dbj|BAE73311.1| flagellar L-ring protein precursor FlgH [Sodalis glossinidius str.
           'morsitans']
          Length = 253

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 47/230 (20%), Positives = 87/230 (37%), Gaps = 10/230 (4%)

Query: 8   VLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDS 67
           +   + LL GC +            P           P   +    + S  +        
Sbjct: 33  IALATLLLGGCAAPP----------PRPLVAGATTAAPAAPMPIAVNGSVFQPGQAMNYG 82

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           +  LF+D R  N+GD LT+ ++ +  A   + +   R  +    ++   S+         
Sbjct: 83  YQPLFEDRRPRNIGDTLTIMLQENVSASKSSSSNADRKGNADLGINALPSMLNGLIGGDR 142

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
              + +     +GKG  +     +  I   V  +L NGNL + G +++ +N     +  +
Sbjct: 143 LATDIESSNGFNGKGGAAAKNTFSGTITVTVIDVLTNGNLRVVGEKQIAINQGTEFIRFS 202

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           GIV P+ +D +N V    +++ARI Y G G   E  +     +   N  P
Sbjct: 203 GIVNPRTIDGNNQVVSTLVSDARIEYVGDGYINEAQQMGWLQRFFLNYFP 252


>gi|300024602|ref|YP_003757213.1| flagellar L-ring protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526423|gb|ADJ24892.1| flagellar L-ring protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 246

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 91/220 (41%), Positives = 133/220 (60%), Gaps = 5/220 (2%)

Query: 21  SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNV 80
            + E++  P MSP+GS L             K   +     S WRDS A LF+D+RA   
Sbjct: 28  QLKEVSREPVMSPVGSGLLPERLPHVQLPVTK--AAYTSGNSTWRDSGADLFRDARAFKN 85

Query: 81  GDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS---GGFSLFGQQTPQMNGNLNYDGGGA 137
           GD++TV ++I DQA   N   R R++S+    S            +   + N N D   +
Sbjct: 86  GDVVTVKVQIKDQATLGNTLNRKRDSSVGLTSSLDYDLGFGGAGGSGSGSLNGNLDRTTS 145

Query: 138 SSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDA 197
           +  KG I+R+E +NLL+AA+V+ +L NGNL+ISG+QEVRVN E+R L+V GI+RP+D+  
Sbjct: 146 TDSKGGITRSENINLLVAAVVSEVLPNGNLVISGTQEVRVNFEVRVLSVAGIIRPRDIST 205

Query: 198 HNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            N +SYDKIAEAR+SYGG+GR  E+ +P  G Q+++ ++P
Sbjct: 206 DNQISYDKIAEARVSYGGRGRVMEVQQPAYGQQILDIIAP 245


>gi|157165376|ref|YP_001466900.1| flagellar basal body L-ring protein [Campylobacter concisus 13826]
 gi|112800285|gb|EAT97629.1| flagellar L-ring protein FlgH [Campylobacter concisus 13826]
          Length = 235

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 55/243 (22%), Positives = 105/243 (43%), Gaps = 18/243 (7%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
           Y+  ++V        GC       +  P ++       E            +      + 
Sbjct: 3   YKKIWLVTFAGIFYTGCT-----PSADPHINMKPPVYVEQ------LPSKDSGSGQSNAG 51

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLH-------RKLSG 114
           SL+      LF D +A+NV DI+T+ I  +   +       ++++++           + 
Sbjct: 52  SLFGKGDNPLFSDRKAMNVNDIVTIVISENASQISSGSKSTNKDSTISLGGGVFTAGAAP 111

Query: 115 GFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
             ++        +      GG   +G G+ +R+EK    I+A +  IL NGN  I GS+E
Sbjct: 112 LSTVADNLNKYGDIGFKAGGGNKFTGSGTSNRSEKFTATISARIIKILNNGNYFIEGSRE 171

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           + +N E + + V+G++RP D+  +N +    IA+A+I Y  +G   +  + P G +L+E 
Sbjct: 172 LLINGEKQIMQVSGVIRPYDISQNNEIDSKYIADAKILYKTEGELDKSTKKPWGTRLMEA 231

Query: 235 LSP 237
           + P
Sbjct: 232 IWP 234


>gi|59712478|ref|YP_205254.1| flagellar basal body L-ring protein [Vibrio fischeri ES114]
 gi|197334935|ref|YP_002156697.1| flagellar L-ring protein FlgH [Vibrio fischeri MJ11]
 gi|75353594|sp|Q5E3N0|FLGH_VIBF1 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|226701937|sp|B5FGS5|FLGH_VIBFM RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|59480579|gb|AAW86366.1| flagellar basal body L ring protein FlgH [Vibrio fischeri ES114]
 gi|197316425|gb|ACH65872.1| flagellar L-ring protein FlgH [Vibrio fischeri MJ11]
          Length = 263

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 45/216 (20%), Positives = 85/216 (39%), Gaps = 14/216 (6%)

Query: 20  SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR-DSHAALFKDSRAL 78
                I G P  +P+       +                 + SL+  D    ++ D++  
Sbjct: 59  GRNDPIAGDPAWAPIHPKEKPEHYA-------------AATGSLFNVDHAQDMYDDTKPR 105

Query: 79  NVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGAS 138
            +GDI+TV +  + +A        S++N              Q   Q N +         
Sbjct: 106 GLGDIVTVMLAENTKAAKSADAELSKSNDSSMDPLQVGGQELQMGGQYNFSYELSNDNNF 165

Query: 139 SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAH 198
           +G  S +++  L+  I   V  +L NGNL+I G + + +N     + ++G +RP D++  
Sbjct: 166 TGNTSANQSNSLSGSITVEVIEVLSNGNLLIRGEKWLTLNTGDEYIRLSGTIRPDDINFD 225

Query: 199 NSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           N++   +I+ ARI Y G G   ++  P    +    
Sbjct: 226 NTIDSTRISNARIQYSGTGDQQDMQEPGFLARFFNV 261


>gi|293409445|ref|ZP_06653021.1| flagellar L-ring protein FlgH [Escherichia coli B354]
 gi|291469913|gb|EFF12397.1| flagellar L-ring protein FlgH [Escherichia coli B354]
          Length = 232

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 46/199 (23%), Positives = 83/199 (41%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQ 99
             +  P  G     + S  +S       +  LF+D R  N+GD LT+ ++ +  A   + 
Sbjct: 34  ATSAQPVPGPTPVANGSIFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSS 93

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVT 159
              SR+   +                   ++   GG   +GKG  + +   +  +   V 
Sbjct: 94  ANASRDGKTNFGFDTVPRYLQGLFGNARADVEASGGNTFNGKGGANASNTFSGTLTVTVD 153

Query: 160 AILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRT 219
            +L NGNL + G +++ +N     +  +G+V P+ +   N+V   ++A+ARI Y G G  
Sbjct: 154 QVLVNGNLHVVGEKQIAINQGTEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYI 213

Query: 220 TELLRPPIGHQLIENLSPL 238
            E        +   NLSP+
Sbjct: 214 NEAQNMGWLQRFFLNLSPM 232


>gi|34558388|ref|NP_908203.1| flagellar basal body L-ring protein [Wolinella succinogenes DSM
           1740]
 gi|34484107|emb|CAE11103.1| FLAGELLAR L-RING PROTEIN FLGH [Wolinella succinogenes]
          Length = 238

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 59/249 (23%), Positives = 103/249 (41%), Gaps = 24/249 (9%)

Query: 1   MYRYS--FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
           M R S   +V   ++L  GC          PQ+S       E           +  +S  
Sbjct: 1   MRRMSGFLLVTLVAALYSGCS------VADPQISFKPPEYVEE------MPAREVEESFG 48

Query: 59  KSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG-FS 117
            + SL+      LF D RA+ + D++TV I     A    +   S  +S         F 
Sbjct: 49  NAGSLFGQGDNPLFADRRAMKLNDLVTVIINETASASSSGKKDLSETSSSTMNGPSVTFG 108

Query: 118 LFGQQTPQMNGNLNY---------DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLI 168
              Q        LN          +     +G G+  R E     ++A +  ++ENGN  
Sbjct: 109 GPSQSIGNAVNKLNNFTSFGLSTGNNNSTFAGSGTQQRQESFTTTVSARIIKVMENGNYF 168

Query: 169 ISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIG 228
           I G +E+ +N E + + +TG++RP D+  +N+++   IA+A+I Y  +G   +      G
Sbjct: 169 IEGGREILINGEKQIMRLTGVIRPYDIGRNNTINSRYIADAKIMYETQGEIKKSTEKGWG 228

Query: 229 HQLIENLSP 237
            +++E++ P
Sbjct: 229 TKVLESVWP 237


>gi|294339840|emb|CAZ88203.1| putative Flagellar L-ring protein precursor (Basal body L-ring
           protein) FlgH [Thiomonas sp. 3As]
          Length = 237

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 50/193 (25%), Positives = 90/193 (46%), Gaps = 2/193 (1%)

Query: 46  FLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR 104
            +  + ++ ++   + ++W+     +LF+DSRA  VGD++TV I+ +  A     T  ++
Sbjct: 45  PIPAEPESMNAHTPNGAIWQPGTNVSLFEDSRAHRVGDLITVLIQENANATKSTNTTVNK 104

Query: 105 NNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN 164
           ++ +   LS  F          + ++         G G+ S++      + A V  ++ N
Sbjct: 105 SDDVSAGLSSFFGKPFTVGG-YSPSMGLTSSTKFGGNGATSQSNTFTTTLQATVVQVMSN 163

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           GN+ ISG +EV +N     + V G+VR  DV   N+V   +IA AR+ Y G G      +
Sbjct: 164 GNMQISGQKEVMLNGGHEYIRVAGVVRAADVSPQNTVLSTQIANARVEYSGTGDVYAAAK 223

Query: 225 PPIGHQLIENLSP 237
            P       +L P
Sbjct: 224 VPWLASFFLSLWP 236


>gi|304397207|ref|ZP_07379086.1| flagellar L-ring protein [Pantoea sp. aB]
 gi|304355356|gb|EFM19724.1| flagellar L-ring protein [Pantoea sp. aB]
          Length = 236

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 55/241 (22%), Positives = 95/241 (39%), Gaps = 24/241 (9%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
           ++V      L GC             +P+         MP              + S+++
Sbjct: 12  WLVASLLLTLNGCALVPR--------TPLVEGATTAQPMPSAPPVV--------NGSIFQ 55

Query: 66  D------SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
                   +  LF+D R  N+GD LT+ ++ +  A   +    SR+ S    ++G  +  
Sbjct: 56  GVAPLNYGYQPLFEDRRPRNIGDTLTITLQENVSASKSSSASASRDGSNSLGITGVPTGL 115

Query: 120 GQQTPQMN--GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                      NL+ +G    +GKG  S        I   V  +L NGNL + G +++ +
Sbjct: 116 AGLVGAGGEKANLSAEGKNDFAGKGGASANNTFTGTITVTVDQVLSNGNLHVVGEKQIAI 175

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N     +  +G+V P+ + A N+V    +A+ARI Y G G   E        +   N+SP
Sbjct: 176 NQGTEFIRFSGVVNPRTISASNAVLSTAVADARIEYVGNGYINEAQTMGWFQRFFLNISP 235

Query: 238 L 238
           +
Sbjct: 236 M 236


>gi|283953947|ref|ZP_06371476.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           414]
 gi|283794552|gb|EFC33292.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           414]
          Length = 232

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 63/244 (25%), Positives = 106/244 (43%), Gaps = 20/244 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  F VL ++    GC +++      PQ+S    +  E           ++++     
Sbjct: 1   MKKVLFYVLPFAFF--GCSATVD-----PQISMKPPAYVEE------LAPKQSNNVESAP 47

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG------ 114
            SL+      LF D +A+NV D++TV I+             SR N+ +           
Sbjct: 48  GSLFGKGDNPLFSDKKAMNVNDLVTVVIQESTTQSTQANKATSRTNTSNLGGGTLTGSSG 107

Query: 115 -GFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
              +   +     N     +     +G GS SR E  N  I+  V  IL NGN  I GS+
Sbjct: 108 LVANALNKVNAYSNIGFQTNSTNNYTGTGSQSRNESFNTTISTRVIKILSNGNYFIEGSR 167

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G      R P G ++IE
Sbjct: 168 ELLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKILYKTEGEVDRSTRKPWGSKVIE 227

Query: 234 NLSP 237
            + P
Sbjct: 228 AIWP 231


>gi|331672599|ref|ZP_08373388.1| flagellar L-ring protein FlgH [Escherichia coli TA280]
 gi|331070242|gb|EGI41608.1| flagellar L-ring protein FlgH [Escherichia coli TA280]
          Length = 235

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 46/199 (23%), Positives = 83/199 (41%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQ 99
             +  P  G     + S  +S       +  LF+D R  N+GD LT+ ++ +  A   + 
Sbjct: 37  ATSAQPVPGPTPVANGSIFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSS 96

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVT 159
              SR+   +                   ++   GG   +GKG  + +   +  +   V 
Sbjct: 97  ANASRDGKTNFGFDTVPRYLQGLFGNARADVEASGGNTFNGKGGANASNTFSGTLTVTVD 156

Query: 160 AILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRT 219
            +L NGNL + G +++ +N     +  +G+V P+ +   N+V   ++A+ARI Y G G  
Sbjct: 157 QVLVNGNLHVVGEKQIAINQGTEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYI 216

Query: 220 TELLRPPIGHQLIENLSPL 238
            E        +   NLSP+
Sbjct: 217 NEAQNMGWLQRFFLNLSPM 235


>gi|154174210|ref|YP_001408222.1| flagellar basal body L-ring protein [Campylobacter curvus 525.92]
 gi|153793061|gb|EAT99529.2| flagellar L-ring protein FlgH [Campylobacter curvus 525.92]
          Length = 235

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 60/245 (24%), Positives = 101/245 (41%), Gaps = 19/245 (7%)

Query: 1   MY-RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M  +Y       + L  GC       +  P ++       E           ++      
Sbjct: 1   MKFKYCLSFATATILYTGCT-----PSADPHINMKPPVYVEQ------LPAKESGSGQSN 49

Query: 60  SYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLH-------RKL 112
           + SL+      LF D +A+NV DI+TV I              SR+++            
Sbjct: 50  AGSLFGRGENPLFSDRKAMNVNDIVTVVISETATQSSTGSKKSSRDSTTSLGGGVFTAGA 109

Query: 113 SGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
           +   ++  Q     +      G     G G+ SR E+    I+A +  IL NGN  I GS
Sbjct: 110 APLSTVANQLNKYSDIGFKAGGENKFEGSGTTSRNERFTATISARIIKILNNGNYFIEGS 169

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           +E+ VN E + + V+G++RP D+  +N +    IA+A+I Y  +G   +  + P G +L+
Sbjct: 170 REILVNGEKQVIQVSGVIRPYDISQNNQIDSKYIADAKILYKTEGDVDKSTKKPWGTRLM 229

Query: 233 ENLSP 237
           E + P
Sbjct: 230 EAIWP 234


>gi|209695759|ref|YP_002263689.1| flagellar basal body L-ring protein [Aliivibrio salmonicida
           LFI1238]
 gi|226701910|sp|B6EJG2|FLGH_ALISL RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|208009712|emb|CAQ80016.1| flagellar L-ring protein 1 precursor (basal body L-ring protein 1)
           [Aliivibrio salmonicida LFI1238]
          Length = 261

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 45/216 (20%), Positives = 85/216 (39%), Gaps = 14/216 (6%)

Query: 20  SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR-DSHAALFKDSRAL 78
                I+G P  +P+       +                 + SL+  D    ++ D++  
Sbjct: 57  GRSEPISGDPAWAPIHPKEKPEHYA-------------AATGSLFNVDHAQDMYDDTKPR 103

Query: 79  NVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGAS 138
            +GDI+TV +  + +A        S+ N              Q   Q N +         
Sbjct: 104 GLGDIVTVMLAENTKAAKSADAELSKKNDSSMDPLQVGGQELQVGGQYNFSYELSNDNKF 163

Query: 139 SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAH 198
           +G  S +++  L+  I   V  +L NGNL+I G + + +N     + ++G +RP D+   
Sbjct: 164 TGNTSANQSNSLSGSITVEVIEVLSNGNLLIRGEKWLTLNTGDEYIRLSGTIRPDDIAFD 223

Query: 199 NSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           N+++  +I+ ARI Y G G   ++  P    +    
Sbjct: 224 NTIASTRISNARIQYSGTGDQQDMQEPGFLARFFNV 259


>gi|325295401|ref|YP_004281915.1| Flagellar L-ring protein [Desulfurobacterium thermolithotrophum DSM
           11699]
 gi|325065849|gb|ADY73856.1| Flagellar L-ring protein [Desulfurobacterium thermolithotrophum DSM
           11699]
          Length = 233

 Score =  188 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 62/237 (26%), Positives = 97/237 (40%), Gaps = 20/237 (8%)

Query: 4   YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSL 63
              I+   S  LF C SS  ++                + +  L              SL
Sbjct: 13  LQVIIAFTSIFLFSCGSSGKKV----------------SVVKPLPPPPVEEAKPTSPGSL 56

Query: 64  WRDSHAALFKDSRALNVGDILTVDIRI--DDQAVFDNQTGRSRNNSLHRKLSGGFSL-FG 120
           +   +  LF D++A  VGDI+TV I           +Q+G+     ++      F     
Sbjct: 57  FS-GYDNLFADTKARRVGDIVTVKIYEVLTGYGSTQSQSGKKSTFDINVNNPTLFGKKIP 115

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
             T     N +       SG+G+  R  KL   I+A V  +  NGNL I G + V++ND+
Sbjct: 116 NGTKDPLLNFSTKPSIDFSGQGTTKRDAKLIATISARVVKVYPNGNLYIVGEKIVKINDD 175

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            + L ++GIV+P D+   NSV   KIA   + Y GKG   +  +P    + +  + P
Sbjct: 176 TQILKISGIVKPTDIAPDNSVPSSKIANMYVEYNGKGYIADNQKPGWLARFLIKIWP 232


>gi|238028846|ref|YP_002913077.1| flagellar basal body L-ring protein [Burkholderia glumae BGR1]
 gi|237878040|gb|ACR30373.1| Flagellar L-ring protein [Burkholderia glumae BGR1]
          Length = 224

 Score =  188 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 50/202 (24%), Positives = 84/202 (41%), Gaps = 5/202 (2%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAV 95
             +      +        S +   S++   +    LF+D R  N+GDILT+ I  +  A 
Sbjct: 25  PRQPITQQPMTAVPPVPPSMQAPGSIYNPGYAGRPLFEDQRPRNIGDILTIMIAENVNAT 84

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
             +    +R ++   K+     L G         L+  G    +  G  S A      I 
Sbjct: 85  KSSGANANRGSATDFKVPTAGFLGGLFGK---AKLSASGDNKFTATGGASAANTFTGTIT 141

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             VT +L NGNL++SG +++ +N     +  +G+V P  +   NSV   ++A+ARI Y  
Sbjct: 142 VTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGVVNPNTISGANSVYSTQVADARIEYSS 201

Query: 216 KGRTTELLRPPIGHQLIENLSP 237
           KG   E        +   N++P
Sbjct: 202 KGYINETETMGWLQRFFLNVAP 223


>gi|146277705|ref|YP_001167864.1| flagellar L-ring protein [Rhodobacter sphaeroides ATCC 17025]
 gi|145555946|gb|ABP70559.1| flagellar L-ring protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 222

 Score =  188 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 56/222 (25%), Positives = 95/222 (42%), Gaps = 19/222 (8%)

Query: 18  CHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALF-KDSR 76
           C + + +                    P   ++      +  +  ++  S   LF  D R
Sbjct: 19  CSTYVEDRASE-------------AWAPVYPVEEPARLDSLPTGGIYSASARGLFVSDRR 65

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGG 136
           A  VGDI+T+D      A        SR+N     L    +L        +G L+     
Sbjct: 66  AARVGDIVTIDFAEKFSASKSQTATGSRSNDYALDLPDALTL-----GLDDGALDNSTSQ 120

Query: 137 ASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVD 196
           + +G+G+ S++  L   ++  VT +L  GNL I G + + +N+    + + G+VRP+D+ 
Sbjct: 121 SFAGRGAASQSNSLRGRMSVSVTRVLPGGNLEIMGQKLLTLNNGNEYVRLKGVVRPEDIG 180

Query: 197 AHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
             N VS D+IA A I Y G G T +  +P    + +  +SPL
Sbjct: 181 PDNVVSSDRIAHAEIKYVGAGDTADTAKPGWLRRGLSVVSPL 222


>gi|327254557|gb|EGE66173.1| flagellar L-ring family protein [Escherichia coli STEC_7v]
          Length = 221

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 50/195 (25%), Positives = 84/195 (43%), Gaps = 7/195 (3%)

Query: 46  FLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR 104
                     +  ++  L+   +  +L  D RA  VGDILTV +    Q+    +T   +
Sbjct: 32  APPKTEAPPPADGRAGGLFETGYNWSLTADRRAYRVGDILTVILEESTQSSKQAKTNFGK 91

Query: 105 NNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN 164
           +NS+       F        + N + + D      G  +  +   L   I   V A+  N
Sbjct: 92  SNSVDITAPTVFG-----HTKNNLSGSIDANRDFDGSATSQQQNSLRGEITVSVHAVQPN 146

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           G L I G + + +N     + ++G+VR  D+   NSVS  +IA+ARISY G+G  ++   
Sbjct: 147 GILEIRGEKWLTLNQGDEYIRLSGLVRADDIQNDNSVSSQRIADARISYAGRGALSDANA 206

Query: 225 PPIGHQLIEN-LSPL 238
                +L  + L P+
Sbjct: 207 AGWLTRLFNHPLFPI 221


>gi|332704821|ref|ZP_08424909.1| Flagellar L-ring protein [Desulfovibrio africanus str. Walvis Bay]
 gi|332554970|gb|EGJ52014.1| Flagellar L-ring protein [Desulfovibrio africanus str. Walvis Bay]
          Length = 235

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 56/243 (23%), Positives = 98/243 (40%), Gaps = 24/243 (9%)

Query: 4   YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSL 63
            +  ++  S  L  C       T +P ++                       S     SL
Sbjct: 7   LAVFLVAASLPLVACAPGKKTPTAMPVLT---------------QPVPPPPVSQNNPGSL 51

Query: 64  WRDSHAAL-FKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ 122
           +     +L F+D RA  VGDI+ V I           T   +++S    ++  F      
Sbjct: 52  FDAGQNSLLFEDDRARRVGDIVLVRIVETSSGSHTADTTSDKDSSYQAGVTNYFGRSKVG 111

Query: 123 TPQMN--------GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
              +N          +  +     S  G  SR   L   + A V  +L +G L + G+++
Sbjct: 112 IAGINFPGTVGTDPMIGTNTTSKFSASGETSRESDLTAAVGARVIRVLPDGLLQVEGARQ 171

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           +R+NDE + L V G+VR +D+   NS+S  ++A A + Y G+G   +  RP    ++++N
Sbjct: 172 MRINDETQILVVRGLVRSRDIGPDNSISSSQMANAEVEYYGQGVLADKQRPGWIARILDN 231

Query: 235 LSP 237
           + P
Sbjct: 232 IWP 234


>gi|46203816|ref|ZP_00050943.2| COG2063: Flagellar basal body L-ring protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 191

 Score =  188 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 121/191 (63%), Gaps = 1/191 (0%)

Query: 47  LGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNN 106
           +   F         +S W  + AAL++D RA +VGD++TV I I+D+A FDN + R R+ 
Sbjct: 1   MPTSFGALGPRHSYHSTWSPASAALYQDPRAHDVGDVITVSISINDKAQFDNASDRQRSQ 60

Query: 107 SLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGN 166
                   G+ + G +      +     G  + G+GSI R E L+L +AA+VT +L NGN
Sbjct: 61  KSSLGFDFGYGVSGLKD-TATADTGIRSGTETKGQGSIDRKESLSLSVAAVVTEVLPNGN 119

Query: 167 LIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPP 226
           ++ISGSQEVRVN+E+R L V GIVRP+D+   N++ YDKIAEARISYGG+GR T++  P 
Sbjct: 120 VVISGSQEVRVNNEVRVLEVAGIVRPRDISRKNTIDYDKIAEARISYGGRGRLTDVQGPT 179

Query: 227 IGHQLIENLSP 237
           +G Q+ E L+P
Sbjct: 180 LGQQVFETLAP 190


>gi|116694222|ref|YP_728433.1| flagellar basal body L-ring protein [Ralstonia eutropha H16]
 gi|113528721|emb|CAJ95068.1| flagellar basal body L-ring protein [Ralstonia eutropha H16]
          Length = 234

 Score =  188 bits (476), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 57/237 (24%), Positives = 95/237 (40%), Gaps = 21/237 (8%)

Query: 5   SFIVLCYSSLLF--GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
           + + L   ++L   GC            + P    +               +     S S
Sbjct: 14  ALVCLAGVAMLASGGCA-----------LMPREPLVQLPTTARAEPRPMGPA-----SGS 57

Query: 63  LWRDSHA--ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           +++ S+A   LF+D R  NVGDILT+ I  +  A  ++ T  SR  +             
Sbjct: 58  IYQSSYAGNPLFEDRRPRNVGDILTILITENVNASKNSGTNTSRTGNTALAFDAVPRALS 117

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                 + N + +G       G  S A   N  I   V  +L NGNL++SG +++ +N  
Sbjct: 118 GLFNS-SSNASINGANTMKASGGASAANTFNGTITVTVLEVLTNGNLVVSGEKQMAINQG 176

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
              +  +G+V P+ +   N+V   ++A+ARI Y  KG   E        +   N+SP
Sbjct: 177 AEFIRFSGVVNPRTITGDNAVLSTQVADARIEYTAKGVIDEAQNMGWLQRFFLNVSP 233


>gi|307546965|ref|YP_003899444.1| flagellar basal body L-ring protein [Halomonas elongata DSM 2581]
 gi|307218989|emb|CBV44259.1| flagellar basal body L-ring protein [Halomonas elongata DSM 2581]
          Length = 241

 Score =  188 bits (476), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 43/190 (22%), Positives = 74/190 (38%), Gaps = 5/190 (2%)

Query: 50  DFKNSDSTKKSYSLWRD--SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS 107
           D  +      + S+++    +  LF+D R   VGD+LT+ +     A  + ++   RN S
Sbjct: 54  DIPDRQRPIPNGSIYQAHRGYQPLFEDRRPRQVGDVLTIVLDEQVSASKNARSNADRNGS 113

Query: 108 LHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
                                  + +G    +G G           I   V  +L NGNL
Sbjct: 114 ASLAFDQLPDALDTL---AEYGFDIEGESDFAGGGGAQANNSFTGTITVSVIEVLNNGNL 170

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
            + G +++ +N     +   G+V P+ +   N+V    +A+ARI Y G G   E      
Sbjct: 171 RVRGEKQIAINQGTEFIRFGGVVNPRSITGKNTVPSTSVADARIEYVGDGYINEAQHMGW 230

Query: 228 GHQLIENLSP 237
             +   N+SP
Sbjct: 231 LQRFFLNISP 240


>gi|298529924|ref|ZP_07017326.1| flagellar L-ring protein [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509298|gb|EFI33202.1| flagellar L-ring protein [Desulfonatronospira thiodismutans ASO3-1]
          Length = 233

 Score =  187 bits (475), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 59/245 (24%), Positives = 106/245 (43%), Gaps = 21/245 (8%)

Query: 1   MYRYSFIVLCY-SSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M  Y  I++   +  L  C  +  + T +P   P                          
Sbjct: 1   MKSYKLIIIVAMAFFLGACAPAQKKSTPMPSYGPEQYPDPGAVTEADSP----------- 49

Query: 60  SYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK------L 112
             SL++ +    LF D+RA NVGDI+TV I     A     T   R++++          
Sbjct: 50  --SLFQPNRTQFLFGDNRARNVGDIVTVHIEESSDAESRANTEYDRDSTMDLSSMPISAA 107

Query: 113 SGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
           +G          +M             G G+ SR   +   ++A V  +L+ G + + G+
Sbjct: 108 TGAIFPGAGTPGEMQQQFQSQSDRDFEGDGTTSRGSDVQASVSARVVEVLDGGVMHVEGA 167

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           ++++VN+E + + V G+VR +DVD++NSVS  ++A+A+I   G+G   +  RP    +++
Sbjct: 168 RQIKVNNETQIIAVRGLVRSRDVDSNNSVSSTQLADAQIEMYGEGILADQQRPGWLTRVL 227

Query: 233 ENLSP 237
             + P
Sbjct: 228 GRVWP 232


>gi|218679634|ref|ZP_03527531.1| flagellar basal body L-ring protein [Rhizobium etli CIAT 894]
          Length = 176

 Score =  187 bits (475), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 109/177 (61%), Positives = 133/177 (75%), Gaps = 1/177 (0%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLW DS AALFKD+RALNVGDILTVDI+I+D+A FDN+T RSR NS          +FG 
Sbjct: 1   SLWSDSQAALFKDARALNVGDILTVDIQINDKASFDNETNRSRTNSSGMNWDVNAQIFG- 59

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
            TPQ   +L Y    ++ GKG I R +K+ LL+AA+VT ILENGNL+ISGSQEVR+N E+
Sbjct: 60  WTPQSKTDLTYGSDTSTDGKGKIERTDKITLLVAAVVTGILENGNLVISGSQEVRLNQEL 119

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           R LNV GIVRPQDV++ N +SYDKIAEARISYGG+GR  E+ +PP G Q ++  SPL
Sbjct: 120 RILNVAGIVRPQDVNSDNQISYDKIAEARISYGGRGRLMEVQQPPRGQQAVDLFSPL 176


>gi|57167699|ref|ZP_00366839.1| flagellar L-ring protein FlgH [Campylobacter coli RM2228]
 gi|57020821|gb|EAL57485.1| flagellar L-ring protein FlgH [Campylobacter coli RM2228]
          Length = 232

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 62/244 (25%), Positives = 105/244 (43%), Gaps = 20/244 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  F VL ++    GC +++      PQ+S    +  E           ++++     
Sbjct: 1   MKKVLFYVLPFAFF--GCSATVD-----PQISMKPPAYVEE------LAPKQSNNVETSP 47

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF---- 116
            SL+      LF D +A+NV D++TV I+             SR N+ +           
Sbjct: 48  GSLFGKGDNPLFSDKKAMNVNDLVTVVIQESTTQSTQANKATSRTNTSNLGGGALTGGSG 107

Query: 117 ---SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
              +   +     N     +      G G+ SR E  N  I+  V  IL NGN  I GS+
Sbjct: 108 LLGTAIDKVNAYSNIGFQTNSTNNYQGTGTQSRNESFNTTISTRVIKILSNGNYFIEGSR 167

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G      R P G ++IE
Sbjct: 168 ELLINGEKQIIQLSGVIRPYDIGQDNTIDSRYIADAKILYKTEGEVDRSTRKPWGSKVIE 227

Query: 234 NLSP 237
            + P
Sbjct: 228 AIWP 231


>gi|317047694|ref|YP_004115342.1| flagellar L-ring protein [Pantoea sp. At-9b]
 gi|316949311|gb|ADU68786.1| flagellar L-ring protein [Pantoea sp. At-9b]
          Length = 236

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 52/241 (21%), Positives = 92/241 (38%), Gaps = 24/241 (9%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
           ++V      L GC             +P+          P              + S+++
Sbjct: 12  WLVALSLLTLNGCALIPR--------TPLVQGSTTAEPTPSAPPVV--------NGSIFQ 55

Query: 66  D------SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
                   +  LF+D R  N+GD LT+ ++ +  A   +    SR+ S    L+   +  
Sbjct: 56  GVAPLNYGYQPLFEDRRPRNIGDTLTITLQENVSASKSSSANASRDGSGSFGLTTVPTGL 115

Query: 120 GQQTPQMNG--NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                       L+ +G    +GKG  +        I   V  +L NGNL + G +++ +
Sbjct: 116 NGLVGASGEKVGLDGEGKNDFTGKGGATANNTFTGTITVTVNQVLSNGNLRVVGEKQIEI 175

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N     +  +G+V P+ + A N+V    +A+ARI Y G G   E        +   N+SP
Sbjct: 176 NQGTEFIRFSGVVNPRTISASNAVLSTAVADARIEYVGNGYINEAQTMGWFQRFFLNVSP 235

Query: 238 L 238
           +
Sbjct: 236 M 236


>gi|332284022|ref|YP_004415933.1| flagellar L-ring protein [Pusillimonas sp. T7-7]
 gi|330427975|gb|AEC19309.1| flagellar L-ring protein [Pusillimonas sp. T7-7]
          Length = 227

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 49/241 (20%), Positives = 97/241 (40%), Gaps = 20/241 (8%)

Query: 1   MYRYSFIVLC-YSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           + R+S + LC   +++ GC               +                         
Sbjct: 2   LKRFSRLFLCCAIAVISGCA--------------LVPPEPIVTGPLTAPPPAPPPAEALA 47

Query: 60  SYSLWRD---SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
           + ++++     +  LF+D R  NVGDI+TV I+    A  + QT   R+ +    ++   
Sbjct: 48  NGAIYQPSAYGNYPLFEDRRPRNVGDIVTVIIQEKTNAAKNVQTQTDRSGNADFGVTLAP 107

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                   + +  ++     A+ G GS       +  +   V  +L NGNL I+G +++ 
Sbjct: 108 DFMPSDFAKQSFEMSGG--NAAKGTGSTRADNTFSGTLTTTVIGVLPNGNLQIAGDKQMA 165

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N     +  +G++ P+ +   N+V   ++A+ARI +  KG   E+       +   N+S
Sbjct: 166 INRGSEHIRFSGVIDPRSITGSNTVLSTQVADARIEFRSKGVMDEVQTMGWLQRFFLNIS 225

Query: 237 P 237
           P
Sbjct: 226 P 226


>gi|94312672|ref|YP_585881.1| flagellar basal body L-ring protein [Cupriavidus metallidurans
           CH34]
 gi|93356524|gb|ABF10612.1| flagellar basal body L-ring protein [Cupriavidus metallidurans
           CH34]
          Length = 237

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 54/234 (23%), Positives = 87/234 (37%), Gaps = 20/234 (8%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           IV   +    GC            M P    +                     + S++  
Sbjct: 20  IVGLAALASGGCA-----------MMPKEPLVQLPTTARAESRPVSAP-----TGSIFAS 63

Query: 67  SHA---ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT 123
           S+A    LF+D R  NVGDILT+ I  +  A  ++ +  SR  +     +          
Sbjct: 64  SYAAGNPLFEDRRPRNVGDILTIVITENINASKNSGSNASRAGNSTLSFNAVPRALAGLF 123

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
              + N +  G       G  S     N  I   V  +L NGNL++SG +++ +N     
Sbjct: 124 SSAS-NADIGGTNTLKASGGSSANNTFNGTITVTVLEVLPNGNLVVSGEKQMAINQGAEF 182

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +  +G+V P+ +   N V   ++A+ARI Y  KG   E        +   N+ P
Sbjct: 183 IRFSGVVNPRTITGDNGVLSTQVADARIEYTAKGYIDEAQNMGWLQRFFLNVLP 236


>gi|218703528|ref|YP_002411047.1| flagellar basal body L-ring protein [Escherichia coli UMN026]
 gi|293403358|ref|ZP_06647449.1| flgH [Escherichia coli FVEC1412]
 gi|298378969|ref|ZP_06988850.1| flgH [Escherichia coli FVEC1302]
 gi|59889783|emb|CAH19139.1| Lateral flagellar L-ring protein (FlgH-like) [Escherichia coli]
 gi|218430625|emb|CAR11491.1| Flagellar L-ring protein 2 precursor (Basal body L-ring protein 2)
           (FlgH-like) [Escherichia coli UMN026]
 gi|284920047|emb|CBG33104.1| lateral flagellar L-ring protein (FlgH-like) [Escherichia coli 042]
 gi|291429211|gb|EFF02231.1| flgH [Escherichia coli FVEC1412]
 gi|298280082|gb|EFI21586.1| flgH [Escherichia coli FVEC1302]
          Length = 221

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 48/195 (24%), Positives = 83/195 (42%), Gaps = 7/195 (3%)

Query: 46  FLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR 104
                     +  ++  ++   +  +L  D RA  VGDILTV +    Q+    +T   +
Sbjct: 32  APPKTEAPPPADGRAGGVFETGYNWSLTADRRAYRVGDILTVILEESTQSSKQAKTNFGK 91

Query: 105 NNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN 164
           NN++       F        +   + + D      G  +  +   L   I   V A+  N
Sbjct: 92  NNTVDIGAPTIFG-----HTKDKLSGSIDANRDFDGSATSQQQNSLRGEITVSVHAVQPN 146

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           G L I G + + +N     + ++G+VR  D+   NSVS  +IA+ARISY G+G  ++   
Sbjct: 147 GILEIRGEKWLTLNQGDEYIRLSGLVRADDIQNDNSVSSQRIADARISYAGRGALSDANA 206

Query: 225 PPIGHQLIEN-LSPL 238
                +L  + L P+
Sbjct: 207 AGWLTRLFNHPLFPI 221


>gi|88911318|sp|Q8XSW9|FLGH_RALSO RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
          Length = 229

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 47/243 (19%), Positives = 89/243 (36%), Gaps = 21/243 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M       L  +SLL                  M    +   + P          + +++
Sbjct: 1   MRILRLAALGTASLLAAACG-------------MLPPPEPIVQGPTTARPPMPVMAPRQN 47

Query: 61  YSLWR------DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG 114
            ++++           +F+D RA  VGD +T+ I  +  A         R+ S    +  
Sbjct: 48  GAIYQEVASGSGGFRGMFEDRRAHMVGDTITIVITENTAASKQTSGSVDRSGSKTTSVPT 107

Query: 115 GFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
              +       +   ++         KG+          I   V  +L NGNL++SG ++
Sbjct: 108 FAGMNPGVLSLL--GVSASDANKFDSKGANGATNNFTATITVTVVEVLSNGNLVVSGEKQ 165

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           + V     S+  +G+V P  V+  N+V   ++A+AR+ Y G G   E  +     +   +
Sbjct: 166 MAVGQGTESIKFSGVVNPTTVNNQNTVLSTQVADARMEYRGTGYVAEAQQMGWLSRFFLS 225

Query: 235 LSP 237
           +SP
Sbjct: 226 VSP 228


>gi|90579912|ref|ZP_01235720.1| flagellar L-ring protein precursor [Vibrio angustum S14]
 gi|90438797|gb|EAS63980.1| flagellar L-ring protein precursor [Vibrio angustum S14]
          Length = 261

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 39/217 (17%), Positives = 81/217 (37%), Gaps = 15/217 (6%)

Query: 21  SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH-AALFKDSRALN 79
            +    G P  +P+       +                 + SL+  S    L+ D++   
Sbjct: 59  RVDPEAGDPAWNPVRPQDKPEHYA-------------TATGSLFNQSQVQDLYDDTKPRG 105

Query: 80  VGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASS 139
           +GDI+T+ +     A     +   ++  L+ K               + +         +
Sbjct: 106 IGDIVTILLEEKTAAKKSASSDLDKSTDLNMK-PIELGGKPVTIRDYSLSYGMSNNNTFA 164

Query: 140 GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHN 199
           G  S  ++  +   I+  V  +L NGNL++ G + + +N     + V+G +RP D+   N
Sbjct: 165 GSTSADQSNSIKGSISVEVVEVLNNGNLVVRGEKWLMLNTGEEYIRVSGHIRPDDISQDN 224

Query: 200 SVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +++  +I+ ARI Y G G   ++       +      
Sbjct: 225 TIASTRISNARIQYSGTGDRQDIQEQNWLSRFFNVAF 261


>gi|305433205|ref|ZP_07402361.1| flagellar L-ring protein FlgH [Campylobacter coli JV20]
 gi|304443906|gb|EFM36563.1| flagellar L-ring protein FlgH [Campylobacter coli JV20]
          Length = 232

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 62/244 (25%), Positives = 105/244 (43%), Gaps = 20/244 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  F VL ++    GC +++      PQ+S    +  E           ++++     
Sbjct: 1   MKKVLFYVLPFAFF--GCSATVD-----PQISMKPPAYVEE------LAPKQSNNVETSP 47

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF---- 116
            SL+      LF D +A+NV D++TV I+             SR N+ +           
Sbjct: 48  GSLFGKGDNPLFSDKKAMNVNDLVTVVIQESTTQSTQANKATSRTNTSNLGGGALTGGSG 107

Query: 117 ---SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
              +   +     N     +      G G+ SR E  N  I+  V  IL NGN  I GS+
Sbjct: 108 LLGTAIDKVNAYSNIGFQTNSANNYQGTGTQSRNESFNTTISTRVIKILSNGNYFIEGSR 167

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G      R P G ++IE
Sbjct: 168 ELLINGEKQIIQLSGVIRPYDIGQDNTIDSRYIADAKILYKTEGEVDRSTRKPWGSKVIE 227

Query: 234 NLSP 237
            + P
Sbjct: 228 AIWP 231


>gi|118574273|sp|Q7M7T1|FLGH_WOLSU RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
          Length = 235

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 56/246 (22%), Positives = 100/246 (40%), Gaps = 22/246 (8%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
                +V   ++L  GC          PQ+S       E           +  +S   + 
Sbjct: 1   MSGFLLVTLVAALYSGCS------VADPQISFKPPEYVEE------MPAREVEESFGNAG 48

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG-FSLFG 120
           SL+      LF D RA+ + D++TV I     A    +   S  +S         F    
Sbjct: 49  SLFGQGDNPLFADRRAMKLNDLVTVIINETASASSSGKKDLSETSSSTMNGPSVTFGGPS 108

Query: 121 QQTPQMNGNLNY---------DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
           Q        LN          +     +G G+  R E     ++A +  ++ENGN  I G
Sbjct: 109 QSIGNAVNKLNNFTSFGLSTGNNNSTFAGSGTQQRQESFTTTVSARIIKVMENGNYFIEG 168

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
            +E+ +N E + + +TG++RP D+  +N+++   IA+A+I Y  +G   +      G ++
Sbjct: 169 GREILINGEKQIMRLTGVIRPYDIGRNNTINSRYIADAKIMYETQGEIKKSTEKGWGTKV 228

Query: 232 IENLSP 237
           +E++ P
Sbjct: 229 LESVWP 234


>gi|299068735|emb|CBJ39974.1| flagellar protein of basal-body outer-membrane L ring [Ralstonia
           solanacearum CMR15]
          Length = 244

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 45/243 (18%), Positives = 89/243 (36%), Gaps = 24/243 (9%)

Query: 3   RYSFIVLC--YSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           R   + +    S     C               M    +   + P          + +++
Sbjct: 17  RILRLAVLGTASLFAAACG--------------MLPPPEPIVQGPTTARPPMPVMAPRQN 62

Query: 61  YSLWR------DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG 114
            ++++           +F+D RA  VGD +T+ I  +  A         R+ S+   +  
Sbjct: 63  GAIYQEVASGSGGFRGMFEDRRAHMVGDTITIVITENTAASKQTSGSVDRSGSMTASVPT 122

Query: 115 GFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
              +       +   ++         KG+          I   V  +L NGNL++SG ++
Sbjct: 123 FAGMNPGVLSLL--GVSASDANKFDSKGANGATNNFTATITVTVVEVLSNGNLVVSGEKQ 180

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           + V     S+  +G+V P  V+  N+V   ++A+AR+ Y G G   E  +     +   +
Sbjct: 181 MAVGQGTESIKFSGVVNPTTVNNQNTVLSTQVADARMEYRGTGYVAEAQQMGWLSRFFLS 240

Query: 235 LSP 237
           +SP
Sbjct: 241 VSP 243


>gi|256020231|ref|ZP_05434096.1| flagellar basal body L-ring protein [Shigella sp. D9]
 gi|301645416|ref|ZP_07245357.1| flagellar L-ring protein FlgH [Escherichia coli MS 146-1]
 gi|307136861|ref|ZP_07496217.1| flagellar basal body L-ring protein [Escherichia coli H736]
 gi|331640716|ref|ZP_08341863.1| flagellar L-ring protein FlgH [Escherichia coli H736]
 gi|331666549|ref|ZP_08367423.1| flagellar L-ring protein FlgH [Escherichia coli TA271]
 gi|332281393|ref|ZP_08393806.1| lateral flagellar L-ring protein [Shigella sp. D9]
 gi|301076300|gb|EFK91106.1| flagellar L-ring protein FlgH [Escherichia coli MS 146-1]
 gi|315616824|gb|EFU97441.1| flagellar L-ring family protein [Escherichia coli 3431]
 gi|323181550|gb|EFZ66970.1| flagellar L-ring family protein [Escherichia coli 1357]
 gi|323191541|gb|EFZ76802.1| flagellar L-ring family protein [Escherichia coli RN587/1]
 gi|331040090|gb|EGI12298.1| flagellar L-ring protein FlgH [Escherichia coli H736]
 gi|331065773|gb|EGI37657.1| flagellar L-ring protein FlgH [Escherichia coli TA271]
 gi|332103745|gb|EGJ07091.1| lateral flagellar L-ring protein [Shigella sp. D9]
          Length = 221

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 47/195 (24%), Positives = 83/195 (42%), Gaps = 7/195 (3%)

Query: 46  FLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR 104
                     +  ++  ++   +  +L  D RA  VGDILTV +    Q+    +T   +
Sbjct: 32  APPKTEAPPPADGRAGGVFETGYNWSLTADRRAYRVGDILTVILEESTQSSKQAKTNFGK 91

Query: 105 NNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN 164
           +N++       F        +   + + D      G  +  +   L   I   V A+  N
Sbjct: 92  SNTVDIGAPTIFG-----HTKDKLSGSIDANRDFDGSATSQQQNSLRGEITVSVHAVQPN 146

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           G L I G + + +N     + ++G+VR  D+   NSVS  +IA+ARISY G+G  ++   
Sbjct: 147 GILEIRGEKWLTLNQGDEYIRLSGLVRADDIQNDNSVSSQRIADARISYAGRGALSDANA 206

Query: 225 PPIGHQLIEN-LSPL 238
                +L  + L P+
Sbjct: 207 AGWLTRLFNHPLFPI 221


>gi|221069319|ref|ZP_03545424.1| flagellar L-ring protein [Comamonas testosteroni KF-1]
 gi|220714342|gb|EED69710.1| flagellar L-ring protein [Comamonas testosteroni KF-1]
          Length = 235

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 52/235 (22%), Positives = 91/235 (38%), Gaps = 15/235 (6%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
              L  + L+ GC +                 +D  +  P   +  +   +   + SL+ 
Sbjct: 12  LCALAGALLVSGCVTLNP-----------PPPVDMPSTAP-PVLQPREQTAQNPTGSLFN 59

Query: 66  DS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP 124
            S +  +F+D RA  VGD +TV I     A     +   R N L   ++    L G    
Sbjct: 60  ASRYRPMFEDQRARMVGDSVTVQIVERVSASQSTDSKVGRANELSTGITSLPLLRGGAEK 119

Query: 125 QMNGNLNYDGGG--ASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
            +   L           G G+ S        IA  V  +L NG+L+I+G +++ VN  + 
Sbjct: 120 TVADALTLGAESKNDFKGSGATSSNNTFTGSIATTVVDVLPNGHLVIAGEKQIGVNHNVD 179

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            L  TG V P+ +   ++V+  ++A  R+    +G+  E        +   N+ P
Sbjct: 180 VLRFTGTVDPRSLRPGSTVASTQVANLRVESRSRGQAGEAQSIGWLSRFFLNVMP 234


>gi|118474322|ref|YP_891989.1| flagellar basal body L-ring protein [Campylobacter fetus subsp.
           fetus 82-40]
 gi|118413548|gb|ABK81968.1| flagellar L-ring protein FlgH [Campylobacter fetus subsp. fetus
           82-40]
          Length = 234

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 54/244 (22%), Positives = 101/244 (41%), Gaps = 19/244 (7%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            +  +I++       GC +        P +S    +  E           +N        
Sbjct: 1   MKKKYILVFILPFFAGCAT-----GANPDISMEPPAYVEQ------LPSKENGIGVSSPG 49

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SL+      LF D +A+NV DI+TV I+              ++++         +    
Sbjct: 50  SLFGRGDNPLFSDRKAMNVNDIVTVVIQETANQTSKADKTTKKDSTTSLSGGTFTTPSNS 109

Query: 122 QTPQMNGNLN--------YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
               +  ++N          G    SG G+ +R E  N  ++A +  IL NGN  I GS+
Sbjct: 110 ALSGIANDINKISGIGFSAGGANNYSGSGTSTRNETFNTTVSARIIKILNNGNYFIEGSK 169

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+ +N+E + + ++G++RP D+  +N +    I++A+I Y  +G        P G +++E
Sbjct: 170 EILINNEKQIMQISGVIRPYDISQNNQIESRYISDAKILYKTEGDLQRATSKPWGTKVLE 229

Query: 234 NLSP 237
            + P
Sbjct: 230 TIWP 233


>gi|58582199|ref|YP_201215.1| flagellar basal body L-ring protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84624091|ref|YP_451463.1| flagellar basal body L-ring protein [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|75435189|sp|Q5GZP1|FLGH_XANOR RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|110816548|sp|Q2P2N8|FLGH_XANOM RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|58426793|gb|AAW75830.1| flagellar L-ring protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84368031|dbj|BAE69189.1| flagellar L-ring protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 230

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 54/244 (22%), Positives = 97/244 (39%), Gaps = 22/244 (9%)

Query: 1   MYRYSFIVLCYS-----SLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSD 55
           M R   +           LL GC ++  ++     M+P+   +    +            
Sbjct: 1   MSRPPLLSSACLAATCSLLLGGCVAAG-DVRPYAAMAPIVPVVAPTVQ------------ 47

Query: 56  STKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG 114
               + +++       L+ D RA +VGD+LT+ +     A     T  S+ ++       
Sbjct: 48  --PTAGAIYAAGPGLNLYGDRRARDVGDLLTITLIESTTASSSANTSTSKKDATTMASPT 105

Query: 115 GFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
                              G  A  GKG+ +++ ++   +   V   L NGNL++ G + 
Sbjct: 106 LLGAPLTVAGLDVLQNTLKGDRAFDGKGNTAQSNRMQGSVTVTVIQRLPNGNLVVQGQKN 165

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           +R+N     + V GIVR  D+   N++   K+AEARI+YGG+G   +        +   +
Sbjct: 166 LRLNQGDELVQVQGIVRDADIAPDNTIPSSKVAEARIAYGGRGAIAQSNAMGWLSRFFNS 225

Query: 235 -LSP 237
            LSP
Sbjct: 226 RLSP 229


>gi|90411008|ref|ZP_01219022.1| flagellar L-ring protein precursor [Photobacterium profundum 3TCK]
 gi|90328221|gb|EAS44532.1| flagellar L-ring protein precursor [Photobacterium profundum 3TCK]
          Length = 256

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 45/257 (17%), Positives = 83/257 (32%), Gaps = 26/257 (10%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLG------------ 48
           M +   +      LL GC      +    + +       E +     G            
Sbjct: 1   MKK--VLAGIVILLLNGCAMDPDLVPSDIEKATTTVDAVEGSTEQDSGLIDMLRRREDPQ 58

Query: 49  ----------IDFKNSDSTKKSYSLWRD-SHAALFKDSRALNVGDILTVDIRIDDQAVFD 97
                        K       + SL+       L+ D++   +GDI+TV +    QA   
Sbjct: 59  AGDPAWNSIRPQAKPEHYATATGSLFSSVQAQDLYDDTKPRGIGDIVTVMLEEKTQAKKS 118

Query: 98  NQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI 157
             +   ++  L                  + +         SG  S  ++  +   I+  
Sbjct: 119 ASSDLDKSTDLSMD-PLVLGGKPLTIGDRDLSYEVANANKFSGTTSADQSNSIKGSISVE 177

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           V  +L NGNL++ G + + +N     + V+G +RP D+   N++   +I  ARI Y G G
Sbjct: 178 VIDVLANGNLMVRGEKWLTLNTGDEYIRVSGTIRPDDISQENTIESTRITNARIQYSGTG 237

Query: 218 RTTELLRPPIGHQLIEN 234
              ++            
Sbjct: 238 DRQDVQEQGWLANFFNV 254


>gi|119899024|ref|YP_934237.1| flagellar L-ring protein [Azoarcus sp. BH72]
 gi|166214814|sp|A1K945|FLGH_AZOSB RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|119671437|emb|CAL95350.1| flagellar L-ring protein precursor [Azoarcus sp. BH72]
          Length = 225

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 51/225 (22%), Positives = 91/225 (40%), Gaps = 16/225 (7%)

Query: 16  FGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH-AALFKD 74
            GC S             + S+       P        + +   + S+++ S    LF+D
Sbjct: 13  SGCAS-------------IYSTPPTAIHQPMSARPDMRAQAVPATGSIYQPSQARPLFED 59

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL--NY 132
            RA NVGDI+T+++   + A        +R +++   +S                L  + 
Sbjct: 60  RRARNVGDIITINLVERNTAQKSANASATRGSAITGGISLTAPNIASLANAKLNGLQADV 119

Query: 133 DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRP 192
                 SG+G+ +     N  I+  V  +  NGNL++SG + V +N     +  +G++ P
Sbjct: 120 GLDSDFSGEGAAAANNVFNGTISVTVIDVYPNGNLLVSGEKMVAINQGNEFIRFSGVINP 179

Query: 193 QDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
             V A N+V   ++A+ARI Y G G   E        +    ++P
Sbjct: 180 TTVTAANTVQSTQVADARIEYRGSGFIDESNTMGWLQRFFVAIAP 224


>gi|261253611|ref|ZP_05946184.1| flagellar L-ring protein FlgH [Vibrio orientalis CIP 102891]
 gi|260937002|gb|EEX92991.1| flagellar L-ring protein FlgH [Vibrio orientalis CIP 102891]
          Length = 260

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 48/216 (22%), Positives = 88/216 (40%), Gaps = 15/216 (6%)

Query: 20  SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA-LFKDSRAL 78
                ++G P  SP+       +                ++ SL+    A+ L+ DS+  
Sbjct: 57  GRNDPVSGDPAWSPIHPKHQPEHYA-------------AETGSLFNSGRASSLYDDSKPR 103

Query: 79  NVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGAS 138
            +GDI+TV +     A   +    S+NN                    N + N     + 
Sbjct: 104 GIGDIITVTLDESTNASKSSDADLSKNNDATMD-PLEVGGQQLNIGDYNFSYNLSNDNSF 162

Query: 139 SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAH 198
           SG  + +++  L+  I   V  +L NGNL+I G + + +N     + ++G +RP D+D  
Sbjct: 163 SGSAAANQSNSLSGSITVEVIEVLANGNLVIRGEKWLTLNTGDEYIRLSGTIRPDDIDYQ 222

Query: 199 NSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           N+++  +I+ ARI Y G G   ++  P    +    
Sbjct: 223 NTIASTRISNARIQYSGTGTQQDMQEPGFLARFFNV 258


>gi|152990361|ref|YP_001356083.1| flagellar L-ring protein FlgH [Nitratiruptor sp. SB155-2]
 gi|151422222|dbj|BAF69726.1| flagellar L-ring protein FlgH [Nitratiruptor sp. SB155-2]
          Length = 206

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 47/203 (23%), Positives = 88/203 (43%), Gaps = 2/203 (0%)

Query: 36  SSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAV 95
           +             +   +   +   SL+   +  LF D +A  VGD++T++I  +    
Sbjct: 4   APKAPMKPKILSEKEVMQTPKPQVPGSLYS-GYDNLFSDMKAYEVGDVVTININENLSGK 62

Query: 96  FDNQTGRSRNNSLHRKLSG-GFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLI 154
             +    SR+NS+   +                 +L+     + SG+G   R+ KL   I
Sbjct: 63  GQSDVQTSRSNSVGLGVPTPKIKGRSVVQGDELLSLDGSSQNSFSGQGGTKRSAKLIAKI 122

Query: 155 AAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYG 214
            A V  +  NGNL I G + +++N + + L + GIV P+D+   NS+   +I++  + Y 
Sbjct: 123 TARVVKVYPNGNLYIVGKKYLKINSDTQYLKIAGIVNPKDISPDNSIDSSRISDMYVEYN 182

Query: 215 GKGRTTELLRPPIGHQLIENLSP 237
           G+G  T+   P    + +  + P
Sbjct: 183 GQGFVTDGQEPGWLAKFVMKIWP 205


>gi|300899453|ref|ZP_07117702.1| flagellar L-ring protein FlgH [Escherichia coli MS 198-1]
 gi|300356959|gb|EFJ72829.1| flagellar L-ring protein FlgH [Escherichia coli MS 198-1]
          Length = 253

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 48/195 (24%), Positives = 83/195 (42%), Gaps = 7/195 (3%)

Query: 46  FLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR 104
                     +  ++  ++   +  +L  D RA  VGDILTV +    Q+    +T   +
Sbjct: 64  APPKTEAPPPADGRAGGVFETGYNWSLTADRRAYRVGDILTVILEESTQSSKQAKTNFGK 123

Query: 105 NNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN 164
           NN++       F        +   + + D      G  +  +   L   I   V A+  N
Sbjct: 124 NNTVDIGAPTIFG-----HTKDKLSGSIDANRDFDGSATSQQQNSLRGEITVSVHAVQPN 178

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           G L I G + + +N     + ++G+VR  D+   NSVS  +IA+ARISY G+G  ++   
Sbjct: 179 GILEIRGEKWLTLNQGDEYIRLSGLVRADDIQNDNSVSSQRIADARISYAGRGALSDANA 238

Query: 225 PPIGHQLIEN-LSPL 238
                +L  + L P+
Sbjct: 239 AGWLTRLFNHPLFPI 253


>gi|325529017|gb|EGD06030.1| flagellar basal body L-ring protein [Burkholderia sp. TJI49]
          Length = 229

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 53/200 (26%), Positives = 85/200 (42%), Gaps = 5/200 (2%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAVFD 97
           E      +        S +   S++   +    LF+D R  NVGDILT+ I  +  A   
Sbjct: 32  EPIIQQPMTAQPPMPVSMQAPGSIFNPGYAGRPLFEDQRPRNVGDILTIVIAENINATKS 91

Query: 98  NQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI 157
           +    +R  +    +     L G  +     NL+  G    +  G  S A   N  I   
Sbjct: 92  SGANTNRQGNTDFNVPTAGFLGGLFSK---ANLSASGDNKFAATGGASAANTFNGTITVT 148

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           VT +L NGNL++SG +++ +N     +  +G+V P  +   NSV   ++A+ARI Y  KG
Sbjct: 149 VTNVLPNGNLVVSGEKQMLINQGNEFVRFSGVVNPNTISGSNSVYSTQVADARIEYSAKG 208

Query: 218 RTTELLRPPIGHQLIENLSP 237
              E        +   N++P
Sbjct: 209 YINEAETMGWLQRFFLNIAP 228


>gi|329898286|ref|ZP_08272369.1| Flagellar L-ring protein FlgH [gamma proteobacterium IMCC3088]
 gi|328920851|gb|EGG28294.1| Flagellar L-ring protein FlgH [gamma proteobacterium IMCC3088]
          Length = 226

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 57/242 (23%), Positives = 101/242 (41%), Gaps = 21/242 (8%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            +Y +++L   SL+ GC S  S +    + +P+                 +   +   + 
Sbjct: 1   MKY-WMLLAGLSLIVGCASKPS-LERYNEFAPIRP--------------LQPVVTGPATG 44

Query: 62  SLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR----KLSGGF 116
           S+  +    +LF+  R   VGDI+T+ +    QA  +      R +  +       S  F
Sbjct: 45  SILNNRSGLSLFEGQREWYVGDIVTIVLSETTQASRNTNLSTERVSENNVLGTRGPSELF 104

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
              G     +           S G GS ++   L  +I A+VT +L NGNL++ G +++ 
Sbjct: 105 PQTGFIGKALPYLKRDGATVKSEGGGSTAQNASLEGVITAMVTEVLPNGNLVVQGEKQLS 164

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           + +    + V GIVR  D+   NSV   ++A A+I+Y G G      +P     ++    
Sbjct: 165 MTEGSEFIQVRGIVRSTDIQMDNSVLSQRLANAQIAYKGTGDLATSTQPGWLTSMLFKFW 224

Query: 237 PL 238
           PL
Sbjct: 225 PL 226


>gi|323976266|gb|EGB71359.1| flagellar L-ring protein [Escherichia coli TW10509]
          Length = 221

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 49/195 (25%), Positives = 84/195 (43%), Gaps = 7/195 (3%)

Query: 46  FLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR 104
                     +  ++  ++   +  +L  D RA  VGDILTV +    Q+    +T   +
Sbjct: 32  APPKTEAPPPADGRAGGVFETGYNWSLTADRRAYRVGDILTVILEESTQSSKQAKTNFGK 91

Query: 105 NNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN 164
           +NS+       F        + N + + D      G  +  +   L   I   V A+  N
Sbjct: 92  SNSVDITAPTVFG-----HTKNNLSGSIDANRDFDGSATSQQQNSLRGEITVSVHAVQPN 146

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           G L I G + + +N     + ++G+VR  D+   NSVS  +IA+ARISY G+G  ++   
Sbjct: 147 GILEIRGEKWLTLNQGDEYIRLSGLVRADDIQNDNSVSSQRIADARISYAGRGALSDANA 206

Query: 225 PPIGHQLIEN-LSPL 238
                +L  + L P+
Sbjct: 207 AGWLTRLFNHPLFPI 221


>gi|226944495|ref|YP_002799568.1| flagellar L-ring protein [Azotobacter vinelandii DJ]
 gi|226719422|gb|ACO78593.1| Flagellar L-ring protein [Azotobacter vinelandii DJ]
          Length = 232

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 42/202 (20%), Positives = 81/202 (40%), Gaps = 5/202 (2%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRDS--HAALFKDSRALNVGDILTVDIRIDDQAV 95
           L   + +    ++       + + S+++    +  LF+D R   +GDILT+ +     A 
Sbjct: 33  LPRTSVVKDQPLEVPQMPLRQANGSIFQVGHIYQPLFEDRRPRMIGDILTIVLNEQVSAS 92

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
            ++ +  +R++ +    S       +            G    SG G           I 
Sbjct: 93  KNSASNANRSSGMSLGFSTTSDKPEKVGEF---GAEASGDNDFSGSGGSRANNSFTGTIT 149

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             V  ++ NGNL + G +++ +N     +  +G+V P+ +   N+VS   ++ ARI Y G
Sbjct: 150 VTVQQVMPNGNLRVVGEKQIAINQGTEYIRFSGLVNPRTITVQNTVSSTLVSMARIEYVG 209

Query: 216 KGRTTELLRPPIGHQLIENLSP 237
            G   E        +   N+SP
Sbjct: 210 DGYINEAQHMGWLQRFFLNVSP 231


>gi|331671807|ref|ZP_08372603.1| flagellar L-ring protein FlgH [Escherichia coli TA280]
 gi|331070796|gb|EGI42155.1| flagellar L-ring protein FlgH [Escherichia coli TA280]
          Length = 246

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 47/195 (24%), Positives = 83/195 (42%), Gaps = 7/195 (3%)

Query: 46  FLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR 104
                     +  ++  ++   +  +L  D RA  VGDILTV +    Q+    +T   +
Sbjct: 57  APPKTEAPPPADGRAGGVFETGYNWSLTADRRAYRVGDILTVILEESTQSSKQAKTNFGK 116

Query: 105 NNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN 164
           +N++       F        +   + + D      G  +  +   L   I   V A+  N
Sbjct: 117 SNTVDIGAPAIFG-----HTKDKLSGSIDANRDFDGSATSQQQNSLRGEITVSVHAVQPN 171

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           G L I G + + +N     + ++G+VR  D+   NSVS  +IA+ARISY G+G  ++   
Sbjct: 172 GILEIRGEKWLTLNQGDEYIRLSGLVRADDIQNDNSVSSQRIADARISYAGRGALSDANA 231

Query: 225 PPIGHQLIEN-LSPL 238
                +L  + L P+
Sbjct: 232 AGWLTRLFNHPLFPI 246


>gi|264676573|ref|YP_003276479.1| flagellar L-ring protein [Comamonas testosteroni CNB-2]
 gi|299531283|ref|ZP_07044693.1| flagellar L-ring protein [Comamonas testosteroni S44]
 gi|262207085|gb|ACY31183.1| flagellar L-ring protein [Comamonas testosteroni CNB-2]
 gi|298720690|gb|EFI61637.1| flagellar L-ring protein [Comamonas testosteroni S44]
          Length = 235

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 52/235 (22%), Positives = 91/235 (38%), Gaps = 15/235 (6%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
              L  + L+ GC +                 +D  +  P   +  +   +   + SL+ 
Sbjct: 12  LCALAGALLVSGCVTLNP-----------PPPVDMPSTAP-PVLQPREQTAQAPTGSLFN 59

Query: 66  DS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP 124
            S +  +F+D RA  VGD +TV I     A     +   R N L   ++    L G    
Sbjct: 60  ASRYRPMFEDQRARMVGDSVTVQIVERVSASQSTDSKVGRANELSTGITSLPLLRGGAEK 119

Query: 125 QMNGNLNYDGGG--ASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
            +   L           G G+ S        IA  V  +L NG+L+I+G +++ VN  + 
Sbjct: 120 TVADALTLGAESKNDFKGSGATSSNNTFTGSIATTVVDVLPNGHLVIAGEKQIGVNHNVD 179

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            L  TG V P+ +   ++V+  ++A  R+    +G+  E        +   N+ P
Sbjct: 180 VLRFTGTVDPRSLRPGSTVASTQVANLRVESRSRGQAGEAQSIGWLSRFFLNVMP 234


>gi|187926951|ref|YP_001893296.1| flagellar L-ring protein [Ralstonia pickettii 12J]
 gi|241665280|ref|YP_002983639.1| flagellar L-ring protein [Ralstonia pickettii 12D]
 gi|187728705|gb|ACD29869.1| flagellar L-ring protein [Ralstonia pickettii 12J]
 gi|240867307|gb|ACS64967.1| flagellar L-ring protein [Ralstonia pickettii 12D]
          Length = 247

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 91/237 (38%), Gaps = 11/237 (4%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R + +    + L   C         +P  +P+        R P   +  + + +  + 
Sbjct: 21  MVRLAVLGT-AALLATAC-------GMLPPPAPIVQG-PTTARPPMPVMAPRQNGAIYQE 71

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            +        +F+D RA  VGD +T+ I  +  A        +R  S+   +     +  
Sbjct: 72  VASGSGGFRGMFEDRRAHMVGDTITIVITENTAASKQTSGSVNRTGSMSASVPTFAGMNA 131

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                +   ++         KG+          I   V  +L NGNL++SG +++ V   
Sbjct: 132 GVLSLL--GVSASDANKFDSKGANGAQNNFTATITVTVVEVLSNGNLVVSGEKQMAVGQG 189

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
             S+  +G+V P  V+  N+V   ++A+AR+ Y G G   E  +     +    +SP
Sbjct: 190 TESIKFSGVVNPTTVNNQNTVLSTQVADARMEYRGTGYVAESQQMGWLSRFFLTVSP 246


>gi|126668561|ref|ZP_01739515.1| Flagellar basal body L-ring protein [Marinobacter sp. ELB17]
 gi|126626966|gb|EAZ97609.1| Flagellar basal body L-ring protein [Marinobacter sp. ELB17]
          Length = 233

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 51/226 (22%), Positives = 96/226 (42%), Gaps = 23/226 (10%)

Query: 17  GCH--SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALFK 73
           GC   S    +   P+ +P+ +                      ++ S+++ S     + 
Sbjct: 27  GCTAMSRPRAMPDDPEYAPVRA--------------QAMMQRDLETGSIYQISRNYNFYG 72

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYD 133
           D+ ALNVGD+LTV +    +A  + +T  S+++ +                Q+      +
Sbjct: 73  DTVALNVGDVLTVTLSESTRASKNAETSISKDSDISLTEPNILG-----RNQLGLATAIE 127

Query: 134 GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQ 193
                 G     ++  L   I   VT +L NG L I G + + + +    + +TG+VRPQ
Sbjct: 128 QQRDFEGAAEADQSNSLAGSITVTVTEVLPNGVLRIRGEKWLSLTNGEEYIRLTGLVRPQ 187

Query: 194 DVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSPL 238
           D+   N+++ ++IA+ARI+YGG G   +  +     +   +   PL
Sbjct: 188 DIKPDNTLASNRIADARIAYGGTGDFDQANQMGWMGRFFNSEWWPL 233


>gi|213648929|ref|ZP_03378982.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
          Length = 211

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 47/199 (23%), Positives = 82/199 (41%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQ 99
                P  G     + S  +S       +  LF+D R  N+GD LT+ ++ +  A   + 
Sbjct: 13  ATTAQPIPGPVPVANGSIFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSS 72

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVT 159
              SR+                       ++   GG + +GKG  + +   +  +   V 
Sbjct: 73  ANASRDGKTSFGFDTVPRYLQGLFGNSRADMEASGGNSFNGKGGANASNTFSGTLTVTVD 132

Query: 160 AILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRT 219
            +L NGNL + G +++ +N     +  +G+V P+ +   NSV   ++A+ARI Y G G  
Sbjct: 133 QVLANGNLHVVGEKQIAINQGTEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYI 192

Query: 220 TELLRPPIGHQLIENLSPL 238
            E        +   NLSP+
Sbjct: 193 NEAQNMGWLQRFFLNLSPM 211


>gi|332558505|ref|ZP_08412827.1| FlgH [Rhodobacter sphaeroides WS8N]
 gi|332276217|gb|EGJ21532.1| FlgH [Rhodobacter sphaeroides WS8N]
          Length = 222

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 56/222 (25%), Positives = 93/222 (41%), Gaps = 19/222 (8%)

Query: 18  CHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALF-KDSR 76
           C + + +                    P   ++      +  +  ++  +   LF  D R
Sbjct: 19  CSTYVEDRASE-------------AWAPVYPVEEAERLDSLPTGGIYSSTSRGLFVSDRR 65

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGG 136
           A  VGDI+TVD      A        SR +     L    +L        +G L+     
Sbjct: 66  AARVGDIVTVDFDEKFSASKSQSASGSRKSDYAIDLPDALTL-----GLDDGVLDNSTDQ 120

Query: 137 ASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVD 196
             SGKG+ S++  L   ++  VT +L  GNL I G + + +N+    + + G+VRP+D+ 
Sbjct: 121 GFSGKGAASQSNSLRGRMSVSVTRVLPGGNLEIMGQKLLTLNNGNEYVRLKGVVRPEDIG 180

Query: 197 AHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
             N V+ D+IA A I Y G G T +  +P    + +  +SPL
Sbjct: 181 PDNVVTSDRIAHAEIKYIGAGDTADTAKPGWLRRGLSVVSPL 222


>gi|126462481|ref|YP_001043595.1| flagellar L-ring protein [Rhodobacter sphaeroides ATCC 17029]
 gi|126104145|gb|ABN76823.1| flagellar L-ring protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 222

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 56/222 (25%), Positives = 93/222 (41%), Gaps = 19/222 (8%)

Query: 18  CHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALF-KDSR 76
           C + + +                    P   ++      +  +  ++  +   LF  D R
Sbjct: 19  CSTYVEDRASE-------------AWAPVYPVEEAERLDSLPTGGIYSSTSRGLFVSDRR 65

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGG 136
           A  VGDI+TVD      A        SR +     L    +L        +G L+     
Sbjct: 66  AARVGDIVTVDFDEKFSASKSQSASGSRKSDYAIDLPDALTL-----GLDDGVLDNSTDQ 120

Query: 137 ASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVD 196
             SGKG+ S++  L   ++  VT +L  GNL I G + + +N+    + + G+VRP+D+ 
Sbjct: 121 GFSGKGAASQSNSLRGRMSVSVTRVLPGGNLEIMGQKLLTLNNGNEYVRLKGVVRPEDIG 180

Query: 197 AHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
             N V+ D+IA A I Y G G T +  +P    + +  +SPL
Sbjct: 181 PDNVVTSDRIAHAEIKYIGAGDTADTAKPGWLRRGLSVVSPL 222


>gi|300936129|ref|ZP_07151068.1| flagellar L-ring protein FlgH [Escherichia coli MS 21-1]
 gi|300458707|gb|EFK22200.1| flagellar L-ring protein FlgH [Escherichia coli MS 21-1]
          Length = 246

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 47/195 (24%), Positives = 83/195 (42%), Gaps = 7/195 (3%)

Query: 46  FLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR 104
                     +  ++  ++   +  +L  D RA  VGDILTV +    Q+    +T   +
Sbjct: 57  APPKTEAPPPADGRAGGVFETGYNWSLTADRRAYRVGDILTVILEESTQSSKQAKTNFGK 116

Query: 105 NNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN 164
           +N++       F        +   + + D      G  +  +   L   I   V A+  N
Sbjct: 117 SNTVDIGAPTIFG-----HTKDKLSGSIDANRDFDGSATSQQQNSLRGEITVSVHAVQPN 171

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           G L I G + + +N     + ++G+VR  D+   NSVS  +IA+ARISY G+G  ++   
Sbjct: 172 GILEIRGEKWLTLNQGDEYIRLSGLVRADDIQNDNSVSSQRIADARISYAGRGALSDANA 231

Query: 225 PPIGHQLIEN-LSPL 238
                +L  + L P+
Sbjct: 232 AGWLTRLFNHPLFPI 246


>gi|161614596|ref|YP_001588561.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161363960|gb|ABX67728.1| hypothetical protein SPAB_02346 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 202

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 47/199 (23%), Positives = 82/199 (41%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQ 99
                P  G     + S  +S       +  LF+D R  N+GD LT+ ++ +  A   + 
Sbjct: 4   ATTAQPIPGPVPVANGSIFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSS 63

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVT 159
              SR+                       ++   GG + +GKG  + +   +  +   V 
Sbjct: 64  ANASRDGKTSFGFDTVPRYLQGLFGNSRADMEASGGNSFNGKGGANASNTFSGTLTVTVD 123

Query: 160 AILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRT 219
            +L NGNL + G +++ +N     +  +G+V P+ +   NSV   ++A+ARI Y G G  
Sbjct: 124 QVLANGNLHVVGEKQIAINQGTEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYI 183

Query: 220 TELLRPPIGHQLIENLSPL 238
            E        +   NLSP+
Sbjct: 184 NEAQNMGWLQRFFLNLSPM 202


>gi|170021357|ref|YP_001726311.1| flagellar basal body L-ring protein [Escherichia coli ATCC 8739]
 gi|169756285|gb|ACA78984.1| flagellar L-ring protein [Escherichia coli ATCC 8739]
          Length = 221

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 47/195 (24%), Positives = 83/195 (42%), Gaps = 7/195 (3%)

Query: 46  FLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR 104
                     +  ++  ++   +  +L  D RA  VGDILTV +    Q+    +T   +
Sbjct: 32  APPKTEAPPPADGRAGGVFETGYNWSLTADRRAYRVGDILTVILEESTQSSKQAKTNFGK 91

Query: 105 NNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN 164
           +N++       F        +   + + D      G  +  +   L   I   V A+  N
Sbjct: 92  SNTVDIGAPTIFG-----HTKDKLSGSIDANRDFDGSATSQQQNSLRGEITVSVHAVQPN 146

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           G L I G + + +N     + ++G+VR  D+   NSVS  +IA+ARISY G+G  ++   
Sbjct: 147 GILEIRGEKWLTLNQGDEYIRLSGLVRADDIQNDNSVSSQRIADARISYAGRGALSDANA 206

Query: 225 PPIGHQLIEN-LSPL 238
                +L  + L P+
Sbjct: 207 AGWLARLFNHPLFPI 221


>gi|17548569|ref|NP_521909.1| flagellar L-ring protein precursor [Ralstonia solanacearum GMI1000]
 gi|17430817|emb|CAD17499.1| probable flagellar l-ring protein precursor (basal body l-ring
           protein) [Ralstonia solanacearum GMI1000]
          Length = 244

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 46/240 (19%), Positives = 88/240 (36%), Gaps = 21/240 (8%)

Query: 4   YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSL 63
                L  +SLL                  M    +   + P          + +++ ++
Sbjct: 19  LRLAALGTASLLAAACG-------------MLPPPEPIVQGPTTARPPMPVMAPRQNGAI 65

Query: 64  WR------DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           ++           +F+D RA  VGD +T+ I  +  A         R+ S    +     
Sbjct: 66  YQEVASGSGGFRGMFEDRRAHMVGDTITIVITENTAASKQTSGSVDRSGSKTTSVPTFAG 125

Query: 118 LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
           +       +   ++         KG+          I   V  +L NGNL++SG +++ V
Sbjct: 126 MNPGVLSLL--GVSASDANKFDSKGANGATNNFTATITVTVVEVLSNGNLVVSGEKQMAV 183

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
                S+  +G+V P  V+  N+V   ++A+AR+ Y G G   E  +     +   ++SP
Sbjct: 184 GQGTESIKFSGVVNPTTVNNQNTVLSTQVADARMEYRGTGYVAEAQQMGWLSRFFLSVSP 243


>gi|167822322|ref|ZP_02453793.1| flagellar basal body L-ring protein [Burkholderia pseudomallei 9]
          Length = 211

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 56/229 (24%), Positives = 88/229 (38%), Gaps = 21/229 (9%)

Query: 11  YSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH-- 68
            +  L GC                     E      +        + +   S++   +  
Sbjct: 1   AALALAGCA----------------QIPREPITQQPMSAMPPMPPAMQAPGSIYNPGYAG 44

Query: 69  AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
             LF+D R  NVGDILT+ I  +  A   +    +R  +    +     L G        
Sbjct: 45  RPLFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLGGLFNK---A 101

Query: 129 NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
           NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ +N     +  +G
Sbjct: 102 NLSAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSG 161

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           IV P  +   NSV   ++A+ARI Y  KG   E        +   N++P
Sbjct: 162 IVNPNTISGQNSVYSTQVADARIEYSAKGYINEAETMGWLQRFFLNIAP 210


>gi|167585197|ref|ZP_02377585.1| flagellar basal body L-ring protein [Burkholderia ubonensis Bu]
          Length = 229

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 55/202 (27%), Positives = 86/202 (42%), Gaps = 5/202 (2%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAV 95
             E      +        S +   S++   +    LF+D R  NVGDILT+ I  +  A 
Sbjct: 30  PREPIIQQPMSAQPPIPPSMQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINAT 89

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
             +    +R  + +  +     L G        NL+  GG   +  G  S A   N  I 
Sbjct: 90  KSSGANTNRAGNTNFDVPTAGFLGGLFAK---ANLSAAGGNKFTATGGASAANTFNGTIT 146

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             VT +L NGNLI+SG +++ +N     +  +G+V P  +   NSV   ++A+A+I Y  
Sbjct: 147 VTVTNVLPNGNLIVSGEKQMLINQGNEFVRFSGVVNPNTISGANSVFSTQVADAKIEYSA 206

Query: 216 KGRTTELLRPPIGHQLIENLSP 237
           KG   E        +   N+SP
Sbjct: 207 KGYINEAETMGWLQRFFLNISP 228


>gi|207728349|ref|YP_002256743.1| flagellar l-ring protein precursor [Ralstonia solanacearum MolK2]
 gi|206591595|emb|CAQ57207.1| flagellar l-ring protein precursor (basal body l-ring protein)
           [Ralstonia solanacearum MolK2]
          Length = 229

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 49/244 (20%), Positives = 91/244 (37%), Gaps = 23/244 (9%)

Query: 1   MYRYSFIVLCYSSLLF-GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M      VL  +SLL   C               M    +   + P          + ++
Sbjct: 1   MRIVRLAVLGTASLLATACG--------------MLPPPEPIVQGPTTARPPMPVMAPRQ 46

Query: 60  SYSLWR------DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS 113
           + ++++           +F+D RA  VGD +T+ I  +  A         R+ S    + 
Sbjct: 47  NGAIYQEVASGSGGFRGMFEDRRAHMVGDTITIVITENTAASKQTSGSVDRSGSKTTSVP 106

Query: 114 GGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
               +       +   ++         KG+          I   V  +L NGNL++SG +
Sbjct: 107 TFAGMNPGVLSLL--GVSASDANKFDSKGANGAQNNFTATITVTVVEVLSNGNLVVSGEK 164

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           ++ V     S+  +G+V P  V+  N+V   ++A+AR+ Y G G   E  +     +   
Sbjct: 165 QMAVGQGTESIKFSGVVNPTTVNNQNTVLSTQVADARMEYRGTGYVAEAQQMGWLSRFFL 224

Query: 234 NLSP 237
           ++SP
Sbjct: 225 SVSP 228


>gi|78485809|ref|YP_391734.1| flagellar L-ring protein [Thiomicrospira crunogena XCL-2]
 gi|110816544|sp|Q31FL3|FLGH_THICR RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|78364095|gb|ABB42060.1| Flagellar L-ring protein FlgH [Thiomicrospira crunogena XCL-2]
          Length = 250

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 57/247 (23%), Positives = 106/247 (42%), Gaps = 25/247 (10%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
           +    V+  S +L GC ++   +             ++ +  P          +  K+ S
Sbjct: 18  KLILGVMVSSIVLSGCSATPERM-------------EKFSYEPNY-PMNIPKKTVPKNGS 63

Query: 63  LWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG------- 114
           L++   A  LF DSRA  VGDI+T+++  +  A   ++    ++N  +  L+G       
Sbjct: 64  LYQSGDAITLFDDSRAHKVGDIITINLAENFDAKKKDEAKYDKSNQQNFGLNGQAAVGSN 123

Query: 115 ---GFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
                             + Y   G+ +GK  + +   L+  IA  V  ++ NGNL+I G
Sbjct: 124 ASVFGGNVSVPGLGSGIGIGYGSDGSFAGKSDVKQKSSLSGSIAVTVVQVISNGNLVIRG 183

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
            + + +++    +   GIVRPQD+   N++  +K+A+ R+ Y   G + +  RP    Q 
Sbjct: 184 EKWITIHEGEEVIRFAGIVRPQDIRPDNTIDSEKVADVRLIYKDTGISGDTNRPGAMTQW 243

Query: 232 IENLSPL 238
           +    PL
Sbjct: 244 LHKYWPL 250


>gi|218708807|ref|YP_002416428.1| flagellar basal body L-ring protein [Vibrio splendidus LGP32]
 gi|254789287|sp|B7VKM5|FLGH_VIBSL RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|218321826|emb|CAV17797.1| Flagellar L-ring protein precursor [Vibrio splendidus LGP32]
          Length = 258

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 42/215 (19%), Positives = 92/215 (42%), Gaps = 15/215 (6%)

Query: 21  SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH-AALFKDSRALN 79
               I G P  +P+     + +                 + SL+  +H  +++ DS+   
Sbjct: 56  RTDPIAGDPAWAPINPKKKQEHYA-------------AATGSLFNANHIGSMYDDSKPRG 102

Query: 80  VGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASS 139
           +GDI+TV +  + +A        S++N    +          +  + N + +       +
Sbjct: 103 IGDIITVALDENTRATKKANADMSKSNDASME-PLAVGGENLELGKYNFSYDLSNTNTFA 161

Query: 140 GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHN 199
           G  S +++  ++  I   V  +L NGNL++ G + + +N     + ++G +RP D+D  N
Sbjct: 162 GDASANQSNSISGYITVEVIEVLANGNLVVRGEKWMTLNTGDEYIRLSGTIRPDDIDFEN 221

Query: 200 SVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           +++ ++++ ARI Y G G   ++  P    +    
Sbjct: 222 TIASNRVSNARIQYSGTGVQKDMQEPGFLARFFNV 256


>gi|323495374|ref|ZP_08100451.1| flagellar basal body L-ring protein [Vibrio brasiliensis LMG 20546]
 gi|323310297|gb|EGA63484.1| flagellar basal body L-ring protein [Vibrio brasiliensis LMG 20546]
          Length = 259

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 49/261 (18%), Positives = 99/261 (37%), Gaps = 31/261 (11%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQ--------------------------MSPM 34
           M R   I L   +++ GC + +      P                           +   
Sbjct: 1   MNR--LIALFALTVVSGC-TMLEPPVETPDVVQGTTTVDAVEGDKSDADSTGIIDTLRGR 57

Query: 35  GSSLDENNRMPFLGIDFKNSDSTKKSYSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQ 93
              +  +     +    +      ++ SL+     ++L+ DS+   +GDI+TV +    +
Sbjct: 58  NDPVAGDPAWAPIHPTHRPEHYAAETGSLFNVAQTSSLYDDSKPRGIGDIITVTLDESTK 117

Query: 94  AVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLL 153
           A   +    S+NN                    N + N     + SG  + +++  ++  
Sbjct: 118 AAKSSDADLSKNNDASMD-PLEVGGQQLNVGDYNFSYNLSNDNSFSGSAAANQSNSISGS 176

Query: 154 IAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISY 213
           I   V  +L NGNL+I G + + +N     + ++G +RP D+D  N+++ ++I+ ARI Y
Sbjct: 177 ITVEVIEVLANGNLVIRGEKWLTLNTGDEYIRLSGTIRPDDIDYDNTIASNRISNARIQY 236

Query: 214 GGKGRTTELLRPPIGHQLIEN 234
            G G   ++  P    +    
Sbjct: 237 SGTGTQQDMQEPGFLARFFNV 257


>gi|312882656|ref|ZP_07742393.1| flagellar basal body L-ring protein [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309369617|gb|EFP97132.1| flagellar basal body L-ring protein [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 259

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 49/261 (18%), Positives = 102/261 (39%), Gaps = 31/261 (11%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSP--------------------------M 34
           M R    V+ + ++L GC S +      P +                             
Sbjct: 1   MKR--LFVIFFVTILSGC-SFLPPPIDTPDIEAGTTTIDAVEGDKLDENSSGILDTLRGR 57

Query: 35  GSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD-SHAALFKDSRALNVGDILTVDIRIDDQ 93
              + ++     +    K      ++ SL+   S ++L+ DS+   +GDI+TV +    +
Sbjct: 58  SDPIPDDPSWAPIHPKHKPQHYAAETGSLFNTVSASSLYDDSKPRGIGDIITVTLNESTK 117

Query: 94  AVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLL 153
           A   +    S+NN+                 + N +       + +G  + +++  L+  
Sbjct: 118 AAKSSDADLSKNNAASMDPLSVGGQELS-IGEYNFSYELSNDNSFTGSAAANQSNSLSGS 176

Query: 154 IAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISY 213
           I   V  +L NGNL+I G + + +N     + ++G +R  D+ + N+++ ++I+ ARI Y
Sbjct: 177 ITVEVIEVLANGNLVIRGEKWLTLNTGDEYIRLSGTIRSDDITSDNTIASNRISNARIQY 236

Query: 214 GGKGRTTELLRPPIGHQLIEN 234
            G G   ++  P    +    
Sbjct: 237 SGTGNQQDMQEPGFLARFFNV 257


>gi|187925758|ref|YP_001897400.1| flagellar basal body L-ring protein [Burkholderia phytofirmans
           PsJN]
 gi|187716952|gb|ACD18176.1| flagellar L-ring protein [Burkholderia phytofirmans PsJN]
          Length = 233

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 54/235 (22%), Positives = 97/235 (41%), Gaps = 21/235 (8%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           + + L   + L GC            + P      +             S       S++
Sbjct: 17  ALVQLTLLAALGGCG-----------LVPKQPITQQPMTALPPMPPSAQSP-----GSIY 60

Query: 65  RDSH--AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ 122
              +    LF+D R  NVGDILT+ I+ +  A   +  G +R+ + +  +     L G  
Sbjct: 61  NPGYAGRPLFEDQRPRNVGDILTIVIQENVNATKSSGAGVNRSGNTNFDVPTAGFLGGLF 120

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
                 NL+ +G    +  G  + +   + +I   VT +L NGNL++SG +++ +N    
Sbjct: 121 GKV---NLSANGANKFAATGGANASNTFSGVITVTVTGVLPNGNLMVSGEKQMLINQGNE 177

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            +  +G+V P  +   N+V   ++A+A+I Y  KG   E        +   N+SP
Sbjct: 178 FVRFSGVVNPNTISNLNAVYSTQVADAKIEYSAKGYIDESENMGFLQRFFLNVSP 232


>gi|146305253|ref|YP_001185718.1| flagellar basal body L-ring protein [Pseudomonas mendocina ymp]
 gi|145573454|gb|ABP82986.1| flagellar L-ring protein [Pseudomonas mendocina ymp]
          Length = 220

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 55/225 (24%), Positives = 89/225 (39%), Gaps = 20/225 (8%)

Query: 16  FGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALFKD 74
            GC S           + M    D ++  P        S     S  L+R  ++ +L  D
Sbjct: 14  GGCAS----------FNEMLPDEDSSHYEPLAL---DYSQPPTTSGGLFRSGYSGSLVGD 60

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
            RA+ VGDILTV +    Q+     T   +++ +   +         Q        + + 
Sbjct: 61  KRAVRVGDILTVVLDESTQSSKSAGTSFGKSSGVSVGIPTVLGKQYDQL-----ESSAEA 115

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
                G    S+   L   IA  V  +L NG L+I G + +R+N     + + G+VR  D
Sbjct: 116 ERDFKGSARSSQQNTLRGSIAVTVHQVLPNGTLLIKGEKALRLNQGDEYIRLVGLVRVDD 175

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSPL 238
           ++  N VS   +A ARISY G+G   +        +   + + PL
Sbjct: 176 INRSNQVSSQNVANARISYAGRGVLNDSNSAGWLTRFFTHPIFPL 220


>gi|86146152|ref|ZP_01064478.1| flagellar L-ring protein precursor [Vibrio sp. MED222]
 gi|85836099|gb|EAQ54231.1| flagellar L-ring protein precursor [Vibrio sp. MED222]
          Length = 258

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 46/259 (17%), Positives = 99/259 (38%), Gaps = 28/259 (10%)

Query: 1   MYRYSFIVLCYSSLLFGCH------------------------SSISEITGIPQMSPMGS 36
           M R   + L     + GC                         S+      I  +     
Sbjct: 1   MKR--IVCLALFLSMTGCAPLAPIETPAQENATTVVDAVEGDKSAQESSGIIDTLRDRTD 58

Query: 37  SLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAV 95
            +  +     +    K       + SL+  +H  +++ DS+   +GDI+TV +  + +A 
Sbjct: 59  PIAGDPAWAPINPKKKQEHYAAATGSLFNANHIGSMYDDSKPRGIGDIITVALDENTRAT 118

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
                  S++N    +          +  + N + +       +G  S +++  ++  I 
Sbjct: 119 KKANADMSKSNDASME-PLAVGGENLELGKYNFSYDLSNTNTFAGDASANQSNSISGYIT 177

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             V  +L NGNL++ G + + +N     + ++G +RP D+D  N+++ ++++ ARI Y G
Sbjct: 178 VEVIEVLANGNLVVRGEKWMTLNTGDEYIRLSGTIRPDDIDFENTIASNRVSNARIQYSG 237

Query: 216 KGRTTELLRPPIGHQLIEN 234
            G   ++  P    +    
Sbjct: 238 TGVQKDMQEPGFLARFFNV 256


>gi|253688969|ref|YP_003018159.1| flagellar L-ring protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251755547|gb|ACT13623.1| flagellar L-ring protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 239

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 45/198 (22%), Positives = 82/198 (41%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQ 99
                P   +    + S  ++       +  +F+D R  N+GD LT+ ++ +  A   + 
Sbjct: 41  PTTAQPASPVLAGPNGSIFQTVQPMNYGYQPMFEDRRPRNIGDTLTIVLQENVSASKSSS 100

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVT 159
              +RN S    ++                L+  G    +GKG  +     +  I   V 
Sbjct: 101 ANAARNGSSTFGVTTTPRYLEGPLGNNRAALDATGTNDFTGKGGANANNTFSGTITVTVG 160

Query: 160 AILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRT 219
            +L NGNL + G +++ +N     +  +G+V P+ +  +NSV   ++A+ARI Y G G  
Sbjct: 161 QVLANGNLQVVGEKQIAINQGTEFIRFSGVVNPRTISGNNSVPSTQVADARIEYVGNGYI 220

Query: 220 TELLRPPIGHQLIENLSP 237
            E        +   N+SP
Sbjct: 221 NEAQNMGWLQRFFLNVSP 238


>gi|54308100|ref|YP_129120.1| flagellar basal body L-ring protein [Photobacterium profundum SS9]
 gi|81615376|sp|Q6LTQ7|FLGH_PHOPR RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|46912526|emb|CAG19318.1| putative flagellar L-ring protein FlgH [Photobacterium profundum
           SS9]
          Length = 256

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 45/257 (17%), Positives = 81/257 (31%), Gaps = 26/257 (10%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSL-------------------DEN 41
           M +   +      LL GC           + +                         D  
Sbjct: 1   MKK--VLAGIVILLLNGCAMDPDLAPSDIEKATTTVDAVEGSTEQDSGLIDMLRRREDPQ 58

Query: 42  NRMPFLGIDFKNSDSTK---KSYSLWRD-SHAALFKDSRALNVGDILTVDIRIDDQAVFD 97
              P        +        + SL+       L+ D++   +GDI+TV +    QA   
Sbjct: 59  AGDPAWNPIRPQAKPEHYATATGSLFSSIQAQDLYDDTKPRGIGDIVTVMLEEKTQAKKS 118

Query: 98  NQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI 157
             +   ++  L                  + +         SG  S  ++  +   I+  
Sbjct: 119 ASSDLDKSTDLSMD-PLVLGGKPLTIGDRDLSYEVANANKFSGTTSADQSNSIKGSISVE 177

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           V  +L NGNL+I G + + +N     + V+G +RP D+   N++   +I  ARI Y G G
Sbjct: 178 VIDVLANGNLMIRGEKWLTLNTGDEYIRVSGTIRPDDISQENTIESTRITNARIQYSGTG 237

Query: 218 RTTELLRPPIGHQLIEN 234
              ++            
Sbjct: 238 NRQDVQEQGWLANFFNV 254


>gi|186477700|ref|YP_001859170.1| flagellar basal body L-ring protein [Burkholderia phymatum STM815]
 gi|184194159|gb|ACC72124.1| flagellar L-ring protein [Burkholderia phymatum STM815]
          Length = 236

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 46/202 (22%), Positives = 82/202 (40%), Gaps = 5/202 (2%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAV 95
             +      +        S +   S++   +    LF+D R  NVGDILT+ I  +  A 
Sbjct: 37  PKQPITQQPMTAVPPAPPSLQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIVISENINAT 96

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
             +    +RN      +     L G        NL+  G       G  + +   +  I 
Sbjct: 97  KSSGANTNRNGETKFGVPTAGFLGGLFGKV---NLDATGANTFKATGGANASNTFSGTIT 153

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             V  +  NGNL++SG +++ +N     +  +G+V P  + + N+V   ++A+A+I Y  
Sbjct: 154 VTVIGVQPNGNLVVSGEKQMLINQGNEFVRFSGVVNPNTISSLNAVYSTQVADAKIEYSA 213

Query: 216 KGRTTELLRPPIGHQLIENLSP 237
           KG   E        +   N++P
Sbjct: 214 KGYIDESQNMSWLQRFFLNVAP 235


>gi|224419002|ref|ZP_03657008.1| flagellar basal body L-ring protein [Helicobacter canadensis MIT
           98-5491]
 gi|253827948|ref|ZP_04870833.1| flagellar L-ring protein precursor [Helicobacter canadensis MIT
           98-5491]
 gi|313142515|ref|ZP_07804708.1| flagellar L-ring protein [Helicobacter canadensis MIT 98-5491]
 gi|253511354|gb|EES90013.1| flagellar L-ring protein precursor [Helicobacter canadensis MIT
           98-5491]
 gi|313131546|gb|EFR49163.1| flagellar L-ring protein [Helicobacter canadensis MIT 98-5491]
          Length = 244

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 60/241 (24%), Positives = 102/241 (42%), Gaps = 22/241 (9%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           +   Y  L  GC ++       PQ+S    +  E           +  D+     S++  
Sbjct: 15  LAFIYGFLFNGCATT------DPQISFKPPAYVEE------LPPKEEEDNFGNPGSIFGR 62

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS--------- 117
               LF D RA+ + D++TV I    QA        + N+S                   
Sbjct: 63  GDNLLFSDRRAMQLNDLVTVIINQTAQASSSANKNLNENSSGTFGGPSLSYAGSSSSIGS 122

Query: 118 -LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            + G       G    +     +G G+ +R E     IAA +  +L+NGN  I GS+EV 
Sbjct: 123 IVNGINNATGFGINLGNNTSTYAGTGTQNRQETFTTTIAARIIKVLQNGNYFIEGSREVL 182

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N E + ++++G+VRP D+  +N++    IA+A+I Y  +G   +      G +LIE++ 
Sbjct: 183 INGEKQIIHLSGVVRPTDIARNNTIESQYIADAKIMYDTQGELKKSTEKGWGTKLIESVW 242

Query: 237 P 237
           P
Sbjct: 243 P 243


>gi|221639492|ref|YP_002525754.1| Flagellar L-ring protein [Rhodobacter sphaeroides KD131]
 gi|221160273|gb|ACM01253.1| Flagellar L-ring protein precursor [Rhodobacter sphaeroides KD131]
          Length = 218

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 56/222 (25%), Positives = 93/222 (41%), Gaps = 19/222 (8%)

Query: 18  CHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALF-KDSR 76
           C + + +                    P   ++      +  +  ++  +   LF  D R
Sbjct: 15  CSTYVEDRASE-------------AWAPVYPVEEAGRLDSLPTGGIYSSTSRGLFVSDRR 61

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGG 136
           A  VGDI+TVD      A        SR +     L    +L        +G L+     
Sbjct: 62  AARVGDIVTVDFDEKFSASKSQSASGSRKSDYAIDLPDALTL-----GLDDGVLDNSTDQ 116

Query: 137 ASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVD 196
             SGKG+ S++  L   ++  VT +L  GNL I G + + +N+    + + G+VRP+D+ 
Sbjct: 117 GFSGKGAASQSNSLRGRMSVSVTRVLPGGNLEIMGQKLLTLNNGNEYVRLKGVVRPEDIG 176

Query: 197 AHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
             N V+ D+IA A I Y G G T +  +P    + +  +SPL
Sbjct: 177 PDNVVTSDRIAHAEIKYIGAGDTADTAKPGWLRRGLSVVSPL 218


>gi|323178491|gb|EFZ64069.1| flagellar L-ring family protein [Escherichia coli 1180]
          Length = 221

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 48/195 (24%), Positives = 84/195 (43%), Gaps = 7/195 (3%)

Query: 46  FLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR 104
                     +  ++  ++   +  +L  D RA  VGDILTV +    Q+    +T   +
Sbjct: 32  APPKTEAPPPADGRAGGVFETGYNWSLTADRRAYRVGDILTVILEESTQSSKQAKTNFGK 91

Query: 105 NNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN 164
           +N++       FS       +   + + D      G  +  +   L   I   V A+  N
Sbjct: 92  SNTVDIGAPTIFS-----HTKDKLSGSIDANRDFDGSATSQQQNSLRGEITVSVHAVQPN 146

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           G L I G + + +N     + ++G+VR  D+   NSVS  +IA+ARISY G+G  ++   
Sbjct: 147 GILEIRGEKWLTLNQGDEYIRLSGLVRADDIQNDNSVSSQRIADARISYAGRGALSDANA 206

Query: 225 PPIGHQLIEN-LSPL 238
                +L  + L P+
Sbjct: 207 AGWLTRLFNHPLFPI 221


>gi|319790432|ref|YP_004152065.1| flagellar L-ring protein [Thermovibrio ammonificans HB-1]
 gi|317114934|gb|ADU97424.1| flagellar L-ring protein [Thermovibrio ammonificans HB-1]
          Length = 231

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 56/236 (23%), Positives = 97/236 (41%), Gaps = 19/236 (8%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
             + +   SL+  C S       +                       +         SL+
Sbjct: 11  VLVGIVILSLVGSCGSD-RNKGSLVAF--------------PAAPPPEIPQPKPSPGSLF 55

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL--SGGFSLFGQQ 122
              ++ LF D +A  VGD++T+ +  +       Q   S+ +S +  +     F      
Sbjct: 56  T-GYSNLFSDPKAHKVGDVVTITVYENLSGSGSVQNDTSKKSSYNLSVSKPILFGRPFPG 114

Query: 123 TPQMNG-NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
             +      +     + +GKGS SR+ KL   I+A V  +  NG+L I G + V++ND+ 
Sbjct: 115 RSKDPLVGFSTAPSKSFAGKGSTSRSAKLIATISARVVKVYPNGDLYIVGKKVVKINDDE 174

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
             L ++GIVRP+D+   N+V   KIA+  + Y GKG   +  RP    + +  + P
Sbjct: 175 EVLRISGIVRPEDIGPDNTVPSSKIADMYVEYNGKGYFNQESRPGWLARFLAKIWP 230


>gi|167717663|ref|ZP_02400899.1| flagellar basal body L-ring protein [Burkholderia pseudomallei
           DM98]
          Length = 210

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 56/228 (24%), Positives = 88/228 (38%), Gaps = 21/228 (9%)

Query: 12  SSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--A 69
           +  L GC                     E      +        + +   S++   +   
Sbjct: 1   ALALAGCA----------------QIPREPITQQPMSAMPPMPPAMQAPGSIYNPGYAGR 44

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN 129
            LF+D R  NVGDILT+ I  +  A   +    +R  +    +     L G        N
Sbjct: 45  PLFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLGGLFNK---AN 101

Query: 130 LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
           L+  G    +  G  S A   N  I   VT +L NGNL++SG +++ +N     +  +GI
Sbjct: 102 LSAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGI 161

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           V P  +   NSV   ++A+ARI Y  KG   E        +   N++P
Sbjct: 162 VNPNTISGQNSVYSTQVADARIEYSAKGYINEAETMGWLQRFFLNIAP 209


>gi|300696916|ref|YP_003747577.1| flagellar protein of basal-body outer-membrane L ring [Ralstonia
           solanacearum CFBP2957]
 gi|299073640|emb|CBJ53160.1| flagellar protein of basal-body outer-membrane L ring [Ralstonia
           solanacearum CFBP2957]
          Length = 244

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 46/243 (18%), Positives = 89/243 (36%), Gaps = 24/243 (9%)

Query: 3   RYSFIVLC--YSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           R   + +    S L   C               M    +   + P          + +++
Sbjct: 17  RIVRLAVLGTASLLAAACG--------------MLPPPEPIVQGPTTARPPMPVMAPRQN 62

Query: 61  YSLWR------DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG 114
            ++++           +F+D RA  VGD +T+ I  +  A         R+ S    +  
Sbjct: 63  GAIYQEVASGSGGFRGMFEDRRAHMVGDTITIVITENTAASKQTSGSVDRSGSKTTSVPT 122

Query: 115 GFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
              +       +   ++         KG+          I   V  +L NGNL++SG ++
Sbjct: 123 FAGMNPGVLSLL--GVSASDANKFDSKGANGAQNNFTATITVTVVEVLSNGNLVVSGEKQ 180

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           + V     S+  +G+V P  V+  N+V   ++A+AR+ Y G G   E  +     +   +
Sbjct: 181 MAVGQGTESIKFSGVVNPTTVNNQNTVLSTQVADARMEYRGTGYVAEAQQMGWLSRFFLS 240

Query: 235 LSP 237
           +SP
Sbjct: 241 VSP 243


>gi|77463649|ref|YP_353153.1| flagellar L-ring protein [Rhodobacter sphaeroides 2.4.1]
 gi|77388067|gb|ABA79252.1| Flagellar L-ring protein [Rhodobacter sphaeroides 2.4.1]
          Length = 222

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 56/222 (25%), Positives = 93/222 (41%), Gaps = 19/222 (8%)

Query: 18  CHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALF-KDSR 76
           C + + +                    P   ++      +  +  ++  +   LF  D R
Sbjct: 19  CSTYVEDRASE-------------AWAPVYPVEEAGRLDSLPTGGIYSSASRGLFVSDRR 65

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGG 136
           A  VGDI+TVD      A        SR +     L    +L        +G L+     
Sbjct: 66  AARVGDIVTVDFDEKFSASKSQSASGSRKSDYAIDLPDALTL-----GLDDGVLDNSTDQ 120

Query: 137 ASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVD 196
             SGKG+ S++  L   ++  VT +L  GNL I G + + +N+    + + G+VRP+D+ 
Sbjct: 121 GFSGKGAASQSNSLRGRMSVSVTRVLPGGNLEIMGQKLLTLNNGNEYVRLKGVVRPEDIG 180

Query: 197 AHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
             N V+ D+IA A I Y G G T +  +P    + +  +SPL
Sbjct: 181 PDNVVTSDRIAHAEIKYIGAGDTADTAKPGWLRRGLSVVSPL 222


>gi|124268251|ref|YP_001022255.1| flagellar basal-body L-ring protein [Methylibium petroleiphilum
           PM1]
 gi|124261026|gb|ABM96020.1| flagellar basal-body L-ring protein [Methylibium petroleiphilum
           PM1]
          Length = 224

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 60/235 (25%), Positives = 99/235 (42%), Gaps = 18/235 (7%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
               L    LLFGC +          M+P     D +  +P   +          + +++
Sbjct: 7   RVAALAPLVLLFGCQA----------MAPKVDIADTSPVLPQAVV-----APPVNNGAIF 51

Query: 65  R-DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT 123
           +  S+  LF+D RA  VGD +TV I     A   + +   +N S++  +S          
Sbjct: 52  QGASYRPLFEDHRARLVGDTITVQIVEKVAASQQSTSSIDKNGSVNGSISALPFFAPNSF 111

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
            + +         A  GKG+ + A   +  I A V  +L NG+L+ISG +++ VN  +  
Sbjct: 112 KRASA--TGSNEQAFEGKGTTASANTFSGTITATVINVLPNGHLVISGEKQIGVNQHVDV 169

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           L  +G V P+ +   NSV+  +IA  RI   G+G   E        +   N+ PL
Sbjct: 170 LRFSGQVDPRAIQPGNSVASAQIANVRIEQRGRGAQAEAQGIGWLGRFFLNVLPL 224


>gi|83747651|ref|ZP_00944687.1| FlgH [Ralstonia solanacearum UW551]
 gi|207739734|ref|YP_002258127.1| flagellar l-ring protein precursor [Ralstonia solanacearum IPO1609]
 gi|83725703|gb|EAP72845.1| FlgH [Ralstonia solanacearum UW551]
 gi|206593116|emb|CAQ60022.1| flagellar l-ring protein precursor (basal body l-ring protein)
           [Ralstonia solanacearum IPO1609]
          Length = 244

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 46/243 (18%), Positives = 89/243 (36%), Gaps = 24/243 (9%)

Query: 3   RYSFIVLC--YSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           R   + +    S L   C               M    +   + P          + +++
Sbjct: 17  RIVRLAVLGTASLLATACG--------------MLPPPEPIVQGPTTARPPMPVMAPRQN 62

Query: 61  YSLWR------DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG 114
            ++++           +F+D RA  VGD +T+ I  +  A         R+ S    +  
Sbjct: 63  GAIYQEVASGSGGFRGMFEDRRAHMVGDTITIVITENTAASKQTSGSVDRSGSKTTSVPT 122

Query: 115 GFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
              +       +   ++         KG+          I   V  +L NGNL++SG ++
Sbjct: 123 FAGMNPGVLSLL--GVSASDANKFDSKGANGAQNNFTATITVTVVEVLSNGNLVVSGEKQ 180

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           + V     S+  +G+V P  V+  N+V   ++A+AR+ Y G G   E  +     +   +
Sbjct: 181 MAVGQGTESIKFSGVVNPTTVNNQNTVLSTQVADARMEYRGTGYVAEAQQMGWLSRFFLS 240

Query: 235 LSP 237
           +SP
Sbjct: 241 VSP 243


>gi|221199742|ref|ZP_03572785.1| flagellar L-ring protein FlgH [Burkholderia multivorans CGD2M]
 gi|221208653|ref|ZP_03581653.1| flagellar L-ring protein FlgH [Burkholderia multivorans CGD2]
 gi|221215574|ref|ZP_03588537.1| flagellar L-ring protein FlgH [Burkholderia multivorans CGD1]
 gi|221164562|gb|EED97045.1| flagellar L-ring protein FlgH [Burkholderia multivorans CGD1]
 gi|221171464|gb|EEE03911.1| flagellar L-ring protein FlgH [Burkholderia multivorans CGD2]
 gi|221179981|gb|EEE12385.1| flagellar L-ring protein FlgH [Burkholderia multivorans CGD2M]
          Length = 229

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 52/202 (25%), Positives = 85/202 (42%), Gaps = 5/202 (2%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAV 95
             E      +        S +   S++   +    LF+D R  N+GDILT+ I  +  A 
Sbjct: 30  PREPIVQQPMTAQPPLPVSMQAPGSIFNPGYAGRPLFEDQRPRNIGDILTIVIAENINAT 89

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
             +    +R  +    +     L G  +     NL+  G    +  G  S A   N  I 
Sbjct: 90  KSSGANTNRQGNTDFNVPTAGFLGGLFSK---ANLSAAGTNKFAATGGASAANTFNGTIT 146

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             VT +L NGNL++SG +++ +N     +  +G+V P  +   NSV   ++A+ARI Y  
Sbjct: 147 VTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGVVNPNTISGSNSVYSTQVADARIEYSA 206

Query: 216 KGRTTELLRPPIGHQLIENLSP 237
           KG   E        +   N++P
Sbjct: 207 KGYINEAETMGWLQRFFLNIAP 228


>gi|161526183|ref|YP_001581195.1| flagellar basal body L-ring protein [Burkholderia multivorans ATCC
           17616]
 gi|189349101|ref|YP_001944729.1| flagellar basal body L-ring protein [Burkholderia multivorans ATCC
           17616]
 gi|226701915|sp|A9ABN1|FLGH_BURM1 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|160343612|gb|ABX16698.1| flagellar L-ring protein [Burkholderia multivorans ATCC 17616]
 gi|189333123|dbj|BAG42193.1| flagellar L-ring protein precursor [Burkholderia multivorans ATCC
           17616]
          Length = 229

 Score =  184 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 52/202 (25%), Positives = 85/202 (42%), Gaps = 5/202 (2%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAV 95
             E      +        S +   S++   +    LF+D R  N+GDILT+ I  +  A 
Sbjct: 30  PREPIVQQPMTAQPPLPVSMQAPGSIFNPGYAGRPLFEDQRPRNIGDILTIVIAENINAT 89

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
             +    +R  +    +     L G  +     NL+  G    +  G  S A   N  I 
Sbjct: 90  KSSGANTNRQGNTDFNVPTAGFLGGLFSK---ANLSAAGTNKFAATGGASAANTFNGTIT 146

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             VT +L NGNL++SG +++ +N     +  +G+V P  +   NSV   ++A+ARI Y  
Sbjct: 147 VTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGVVNPNTISGSNSVYSTQVADARIEYSA 206

Query: 216 KGRTTELLRPPIGHQLIENLSP 237
           KG   E        +   N++P
Sbjct: 207 KGYINEAETMGWLQRFFLNIAP 228


>gi|254251194|ref|ZP_04944512.1| hypothetical protein BDAG_00370 [Burkholderia dolosa AUO158]
 gi|124893803|gb|EAY67683.1| hypothetical protein BDAG_00370 [Burkholderia dolosa AUO158]
          Length = 238

 Score =  184 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 52/202 (25%), Positives = 84/202 (41%), Gaps = 5/202 (2%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAV 95
             E      +        S +   S++   +    LF+D R  N+GDILT+ I  +  A 
Sbjct: 39  PREPIIQQPMTAQPPLPMSMQAPGSIYNPGYAGRPLFEDQRPRNIGDILTIVIAENINAT 98

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
             +    +R  +    +     L G        NL+  G    +  G  S A   N  I 
Sbjct: 99  KSSGANTNRQGNTDFNVPTAGFLGGLFAK---ANLSATGNNKFAATGGASAANTFNGTIT 155

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             VT +L NGNL++SG +++ +N     +  +G+V P  +   NSV   ++A+ARI Y  
Sbjct: 156 VTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGVVNPNTISGSNSVYSTQVADARIEYSA 215

Query: 216 KGRTTELLRPPIGHQLIENLSP 237
           KG   E        +   N++P
Sbjct: 216 KGYINEAETMGWLQRFFLNIAP 237


>gi|227328341|ref|ZP_03832365.1| flagellar basal body L-ring protein [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 237

 Score =  184 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 44/198 (22%), Positives = 83/198 (41%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQ 99
                P   +    + S  ++       +  +F+D R  N+GD LT+ ++ +  A   + 
Sbjct: 39  PTTAQPGSPVLAGPNGSIFQTVQPMNYGYQPMFEDRRPRNIGDTLTIVLQENVSASKSSS 98

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVT 159
              +RN +    ++               +LN  G    +G+G  +     +  I   V 
Sbjct: 99  ANAARNGASTFGVTTVPRYLEGPLGNNRASLNATGTNDFTGQGGANANNTFSGTITVTVG 158

Query: 160 AILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRT 219
            +L NGNL + G +++ +N     +  +G+V P+ +  +NSV   ++A+ARI Y G G  
Sbjct: 159 QVLANGNLQVVGEKQIAINQGTEFIRFSGVVNPRTISGNNSVPSTQVADARIEYVGNGYI 218

Query: 220 TELLRPPIGHQLIENLSP 237
            E        +   N+SP
Sbjct: 219 NEAQNMGWLQRFFLNVSP 236


>gi|330719498|gb|EGG98114.1| Flagellar L-ring protein FlgH [gamma proteobacterium IMCC2047]
          Length = 188

 Score =  184 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 41/187 (21%), Positives = 80/187 (42%), Gaps = 3/187 (1%)

Query: 54  SDSTKKSYSLWRD-SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL 112
             +     ++++     + F D +A +VGDILT+++     A    +T  + + + +   
Sbjct: 1   MPAPSSQGAIYQPTQRVSYFVDRKARHVGDILTINLVERTTASKKAETEIADSTAHNLAT 60

Query: 113 SGG-FSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
               F+ +  +        N  G  + +G     ++  L+  I   VT +L NG L + G
Sbjct: 61  PTLPFTDYTDKLKDYGLATNVAGDNSFTGDAESDQSNSLSGNITVTVTDVLPNGVLRVRG 120

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
            + + +N     + ++G+VR  D+   N V   K+A+ARI+Y G G       P    + 
Sbjct: 121 EKWMTLNTGDEYIRISGMVRLDDIAPDNVVPSTKLADARITYSGTGTFANSNEPGWFSKF 180

Query: 232 IE-NLSP 237
               + P
Sbjct: 181 FFGQVWP 187


>gi|260866416|ref|YP_003232818.1| putative lateral flagellar protein of basal-body outer-membrane L
           ring [Escherichia coli O111:H- str. 11128]
 gi|257762772|dbj|BAI34267.1| predicted lateral flagellar protein of basal-body outer-membrane L
           ring [Escherichia coli O111:H- str. 11128]
          Length = 246

 Score =  184 bits (468), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 48/195 (24%), Positives = 84/195 (43%), Gaps = 7/195 (3%)

Query: 46  FLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR 104
                     +  ++  ++   +  +L  D RA  VGDILTV +    Q+    +T   +
Sbjct: 57  APPKTEAPPPADGRAGGVFETGYNWSLTADRRAYRVGDILTVILEESTQSSKQAKTNFGK 116

Query: 105 NNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN 164
           +N++       FS       +   + + D      G  +  +   L   I   V A+  N
Sbjct: 117 SNTVDIGAPTIFS-----HTKDKLSGSIDANRDFDGSATSQQQNSLRGEITVSVHAVQPN 171

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           G L I G + + +N     + ++G+VR  D+   NSVS  +IA+ARISY G+G  ++   
Sbjct: 172 GILEIRGEKWLTLNQGDEYIRLSGLVRADDIQNDNSVSSQRIADARISYAGRGALSDANA 231

Query: 225 PPIGHQLIEN-LSPL 238
                +L  + L P+
Sbjct: 232 AGWLTRLFNHPLFPI 246


>gi|167813805|ref|ZP_02445485.1| flagellar basal body L-ring protein [Burkholderia pseudomallei 91]
          Length = 209

 Score =  184 bits (467), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 56/227 (24%), Positives = 87/227 (38%), Gaps = 21/227 (9%)

Query: 13  SLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AA 70
             L GC                     E      +        + +   S++   +    
Sbjct: 1   LALAGCA----------------QIPREPITQQPMSAMPPMPPAMQAPGSIYNPGYAGRP 44

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           LF+D R  NVGDILT+ I  +  A   +    +R  +    +     L G        NL
Sbjct: 45  LFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLGGLFNK---ANL 101

Query: 131 NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIV 190
           +  G    +  G  S A   N  I   VT +L NGNL++SG +++ +N     +  +GIV
Sbjct: 102 SAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGIV 161

Query: 191 RPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            P  +   NSV   ++A+ARI Y  KG   E        +   N++P
Sbjct: 162 NPNTISGQNSVYSTQVADARIEYSAKGYINEAETMGWLQRFFLNIAP 208


>gi|94495408|ref|ZP_01301988.1| flagellar L-ring protein precursor [Sphingomonas sp. SKA58]
 gi|94424796|gb|EAT09817.1| flagellar L-ring protein precursor [Sphingomonas sp. SKA58]
          Length = 226

 Score =  184 bits (467), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 45/200 (22%), Positives = 86/200 (43%), Gaps = 5/200 (2%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRD--SHAALFKDSRALNVGDILTVDIRIDDQAVFD 97
           E  R  F         +   + S+++    +  L   +RA  VGDI+T+ +    QA   
Sbjct: 29  EVEREYFAPTVIAQPAAPAANGSIFQTSVGYTPLTSGARATTVGDIITIVLVERTQASKS 88

Query: 98  NQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI 157
           N    SR+ S          L    +P    ++   G    +GKG+ +++  L+  I   
Sbjct: 89  NSADTSRSGSFGLTPPSTGVLSKLFSPS---DVAMGGNNGFTGKGAATQSNALSGEITVT 145

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +  +  NG +++ G + + +N     + ++G+VR  D+   N ++  ++A+A+I Y GKG
Sbjct: 146 IAQVYPNGTMLVKGEKALTLNRGDEFIQISGLVRQADISPDNRIASTRVADAKIIYKGKG 205

Query: 218 RTTELLRPPIGHQLIENLSP 237
                 R     +    +SP
Sbjct: 206 EIANASRQGWLQRFFSAISP 225


>gi|300693341|ref|YP_003749314.1| flagellar protein of basal-body outer-membrane l ring [Ralstonia
           solanacearum PSI07]
 gi|299075378|emb|CBJ34673.1| flagellar protein of basal-body outer-membrane L ring [Ralstonia
           solanacearum PSI07]
          Length = 244

 Score =  184 bits (467), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 42/210 (20%), Positives = 82/210 (39%), Gaps = 8/210 (3%)

Query: 34  MGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR------DSHAALFKDSRALNVGDILTVD 87
           M    +   + P          + +++ ++++           +F+D RA  VGD +T+ 
Sbjct: 36  MLPPPEPIVQGPTSARPPMPVMAQRQNGAIYQEVASGSGGFRGMFEDRRAHMVGDTITIV 95

Query: 88  IRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRA 147
           I  +  A         R+ S    +     +       +   ++         KG+    
Sbjct: 96  ITENTAASKQTSGTVDRSGSKTTSVPTFAGMNPGVLSLL--GVSASDANKFDSKGANGAQ 153

Query: 148 EKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIA 207
                 I   V  +L NGNL++SG +++ V     S+  +G+V P  V+  N+V   ++A
Sbjct: 154 NNFTATITVTVVEVLSNGNLVVSGEKQMAVGQGTESIKFSGVVNPTTVNNQNTVLSTQVA 213

Query: 208 EARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +AR+ Y G G   E  +     +    +SP
Sbjct: 214 DARMEYRGTGYVAEAQQMGWLSRFFLTVSP 243


>gi|126452858|ref|YP_001064567.1| flagellar basal body L-ring protein [Burkholderia pseudomallei
           1106a]
 gi|242316923|ref|ZP_04815939.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 1106b]
 gi|126226500|gb|ABN90040.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 1106a]
 gi|242140162|gb|EES26564.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 1106b]
          Length = 240

 Score =  184 bits (467), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 53/202 (26%), Positives = 84/202 (41%), Gaps = 5/202 (2%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAV 95
             E      +        + +   S++   +    LF+D R  NVGDILT+ I  +  A 
Sbjct: 41  PREPITQQPMSAMPPMPPAMQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINAT 100

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
             +    +R  +    +     L G        NL+  G    +  G  S A   N  I 
Sbjct: 101 KSSGANTNRQGNTSFDVPTAGFLGGLFNK---ANLSAQGANKFAATGGASAANTFNGTIT 157

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             VT +L NGNL++SG +++ +N     +  +GIV P  +   NSV   ++A+ARI Y  
Sbjct: 158 VTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSA 217

Query: 216 KGRTTELLRPPIGHQLIENLSP 237
           KG   E        +   N++P
Sbjct: 218 KGYINEAETMGWLQRFFLNIAP 239


>gi|30248325|ref|NP_840395.1| flagellar basal body L-ring protein [Nitrosomonas europaea ATCC
           19718]
 gi|30138211|emb|CAD84219.1| Flagellar L-ring protein [Nitrosomonas europaea ATCC 19718]
          Length = 264

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 91/239 (38%), Gaps = 24/239 (10%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           +++    ++ GC               +  +      M     D      ++ S  +++ 
Sbjct: 41  VLIVMICVVSGCA--------------ITPTPKVQQPMSVRPPDLPVIPPSQTSGGIYQA 86

Query: 67  --------SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
                    +  LF+D RA ++GD + V +     A     +   R   +   +     L
Sbjct: 87  VFDYQGRGRYIPLFEDRRARSIGDTIIVALNEKTNASKKTGSNAQRAGEIGLSVPSFLGL 146

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
             +   Q + +L         GKG  S        IA  V  IL NGNL++SG +++ +N
Sbjct: 147 PFKSIFQ-DLDLEATSSNKFDGKGESSSNNNFTGTIAVTVLDILPNGNLLVSGEKQIGIN 205

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
                + ++G V       +N+VS  ++A+ARI Y G G   E+       +   ++SP
Sbjct: 206 QGHEFIRLSG-VINPINIINNTVSSIQVADARIEYRGNGYLDEVQTMGWLSRFFLSISP 263


>gi|227112524|ref|ZP_03826180.1| flagellar basal body L-ring protein [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 237

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 46/198 (23%), Positives = 82/198 (41%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQ 99
                P   +    + S  ++       +  +F+D R  NVGD LT+ ++ +  A   + 
Sbjct: 39  PTTAQPGSPVLAGPNGSIFQTVQPMNYGYQPMFEDRRPRNVGDTLTIVLQENVSASKSSS 98

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVT 159
              +RN S     +               +LN  G    +G+G  +     +  I   V 
Sbjct: 99  ANAARNGSSTFGATVVPRYLDGPLGNNRASLNATGTNDFTGQGGANANNTFSGTITVTVG 158

Query: 160 AILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRT 219
            +L NGNL + G +++ +N     +  +G+V P+ +  +NSV   ++A+ARI Y G G  
Sbjct: 159 QVLANGNLQVVGEKQIAINQGTEFIRFSGVVNPRTISGNNSVPSTQVADARIEYVGNGYI 218

Query: 220 TELLRPPIGHQLIENLSP 237
            E        +   N+SP
Sbjct: 219 NEAQNMGWLQRFFLNVSP 236


>gi|83944160|ref|ZP_00956616.1| Flagellar L-ring protein flgH [Sulfitobacter sp. EE-36]
 gi|83955140|ref|ZP_00963796.1| flagellar L-ring protein precursor [Sulfitobacter sp. NAS-14.1]
 gi|83840469|gb|EAP79642.1| flagellar L-ring protein precursor [Sulfitobacter sp. NAS-14.1]
 gi|83845027|gb|EAP82908.1| Flagellar L-ring protein flgH [Sulfitobacter sp. EE-36]
          Length = 245

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 75/214 (35%), Positives = 110/214 (51%), Gaps = 2/214 (0%)

Query: 24  EITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDI 83
                  +SP          +P                SLW +S   LF+D RA +VGD+
Sbjct: 33  PTVSDLTLSPDHMGEVNRVSIPMPLPKAPEQPKRADQASLWSNSTPRLFQDRRAGDVGDL 92

Query: 84  LTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGS 143
           +TV I IDD+A   N TGRSR++S         +     +      +      +S G+GS
Sbjct: 93  VTVLIDIDDRAQLQNATGRSRSSSTGVDDPDILNF--DTSTDSGQLIGLSSSSSSEGEGS 150

Query: 144 ISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSY 203
           I R E + L +AA+V   L NGN +I+G QEV+VN+E+R L + GI+R  D++  N++ Y
Sbjct: 151 IRRNETIRLRVAALVIQTLPNGNFVIAGRQEVKVNNELRELRIAGIIRQSDINVGNTIDY 210

Query: 204 DKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           DKIAEARI+YGG+G+ + +     G   +E   P
Sbjct: 211 DKIAEARITYGGRGQISTVQTARYGQDALEVFLP 244


>gi|323697474|ref|ZP_08109386.1| flagellar L-ring protein [Desulfovibrio sp. ND132]
 gi|323457406|gb|EGB13271.1| flagellar L-ring protein [Desulfovibrio desulfuricans ND132]
          Length = 231

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 52/246 (21%), Positives = 101/246 (41%), Gaps = 25/246 (10%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M RY  +V+    L  GC         +P ++P                 ++  D     
Sbjct: 1   MRRYFLMVMAAILLASGCARKYENE-PMPVLTP---------------PAYEEQDPASNP 44

Query: 61  YSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS------ 113
            SL+  + +  L+ D+RA  VGDI+ V +         ++T   ++N +   +S      
Sbjct: 45  GSLYDTNRSEFLYDDNRASRVGDIVLVQVAETATTKIKSETTADKSNDVDTSVSAMPTTG 104

Query: 114 --GGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
             G   L      +    +  +     SG G   +       +A  +   L    L + G
Sbjct: 105 IVGNVPLAETLGAKAGVGILANQSSKFSGTGETKQESNFEATVATRIVRRLPGNILQVEG 164

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           ++ +RVN+E + L V G++R +D+ + N++    +AEA+I   G+G   +  +P    ++
Sbjct: 165 ARRIRVNNETQFLVVRGLIRERDISSSNTIPSTSLAEAQIEIYGQGVLADKQKPGWLSRI 224

Query: 232 IENLSP 237
           ++N+ P
Sbjct: 225 LDNVFP 230


>gi|283784087|ref|YP_003363952.1| lateral flagellar L-ring protein [Citrobacter rodentium ICC168]
 gi|282947541|emb|CBG87094.1| lateral flagellar L-ring protein [Citrobacter rodentium ICC168]
          Length = 221

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 48/181 (26%), Positives = 82/181 (45%), Gaps = 7/181 (3%)

Query: 60  SYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           +  ++   +  +L  D RA  VGDILTV +    Q+    +T   +NN++       F  
Sbjct: 46  AGGVFETGYNWSLTADRRAYRVGDILTVLLEESTQSSKQAKTNFGKNNTVDIGAPTFFG- 104

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                 + N + + D      G  +  +   L   I   V ++  NG L I G + + +N
Sbjct: 105 ----HTKKNLSGSIDANRDFDGSATSQQQNSLRGEITVSVHSVQPNGILEIRGEKWLTLN 160

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
                + ++G+VR  D+   NSVS  +IA+ARISY G+G  ++        +L  + L P
Sbjct: 161 QGDEYIRLSGLVRADDIQNDNSVSSQRIADARISYAGRGALSDANAAGWLTRLFNHPLFP 220

Query: 238 L 238
           +
Sbjct: 221 I 221


>gi|300716221|ref|YP_003741024.1| flagellar L-ring protein [Erwinia billingiae Eb661]
 gi|299062057|emb|CAX59173.1| Flagellar L-ring protein [Erwinia billingiae Eb661]
          Length = 232

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 48/206 (23%), Positives = 83/206 (40%), Gaps = 7/206 (3%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRD------SHAALFKDSRALNVGDILTVDIRID 91
                           +     + S+++        +  LF+D R  N+GD LT+ ++ +
Sbjct: 27  PRTPLVEGSTTAQPLPASPPVVNGSIFQGLMPMNYGYQPLFEDRRPRNIGDTLTITLQEN 86

Query: 92  DQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLN 151
             A   +     R+ S    L+   SL G        N++  G    +GKG  +      
Sbjct: 87  VSASKSSTASAGRDGSTTLGLTVPSSLTGLLGGD-KTNIDASGKNDFAGKGGATANNTFT 145

Query: 152 LLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARI 211
             I   V  +L NGNL + G +++ +N     +  +G+V P+ +   N+V   ++A+ARI
Sbjct: 146 GTITVTVNQVLPNGNLKVVGEKQIEINQGTEFIRFSGVVNPRTISGSNAVVSTQVADARI 205

Query: 212 SYGGKGRTTELLRPPIGHQLIENLSP 237
            Y G G   E        +   NLSP
Sbjct: 206 EYVGNGYINEAQTMGWLQRFFLNLSP 231


>gi|170694395|ref|ZP_02885549.1| flagellar L-ring protein [Burkholderia graminis C4D1M]
 gi|170140818|gb|EDT08992.1| flagellar L-ring protein [Burkholderia graminis C4D1M]
          Length = 232

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 56/235 (23%), Positives = 94/235 (40%), Gaps = 21/235 (8%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           + + L   + L GC            + P      +             S       S++
Sbjct: 16  ALVQLTLLAALGGCG-----------LVPKQPITQQPMTAMPPMPPQAQSP-----GSIY 59

Query: 65  RDSH--AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ 122
              +    LF+D R  NVGDILT+ I+ +  A   +  G +RN +    +     L G  
Sbjct: 60  NPGYAGRPLFEDQRPRNVGDILTIVIQENVNATKSSGAGVNRNGTTSFDVPTAGFLGGLF 119

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
                 NL+  G    +  G  + +   N  I   VT +L NGNL++SG +++ +N    
Sbjct: 120 GK---ANLSASGANKFTSTGGANASNTFNGTITVTVTGVLPNGNLMVSGEKQMLINQGNE 176

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            +  +G+V P  +   N+V   ++A+A+I Y  KG   E        +   N+SP
Sbjct: 177 FVRFSGVVNPNTISNLNAVYSTQVADAKIEYSAKGYVDEAENMGWLQRFFLNVSP 231


>gi|15616949|ref|NP_240162.1| flagellar basal body L-ring protein [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219681702|ref|YP_002468088.1| flagellar L-ring protein precursor [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|219682257|ref|YP_002468641.1| flagellar L-ring protein precursor [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|257471398|ref|ZP_05635397.1| flagellar basal body L-ring protein [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|11386810|sp|P57425|FLGH_BUCAI RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|254789278|sp|B8D9C9|FLGH_BUCA5 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|254789279|sp|B8D7N1|FLGH_BUCAT RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|25373418|pir||H84969 flagellar L-ring protein precursor [imported] - Buchnera sp.
           (strain APS)
 gi|10039014|dbj|BAB13048.1| flagellar L-ring protein precursor [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219621990|gb|ACL30146.1| flagellar L-ring protein precursor [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|219624545|gb|ACL30700.1| flagellar L-ring protein precursor [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|311086080|gb|ADP66162.1| flagellar basal body L-ring protein [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086652|gb|ADP66733.1| flagellar basal body L-ring protein [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
 gi|311087238|gb|ADP67318.1| flagellar basal body L-ring protein [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
          Length = 238

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 54/246 (21%), Positives = 102/246 (41%), Gaps = 26/246 (10%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
           +  ++   +   +  C S         +  P+ +                N      + S
Sbjct: 9   KKYYLTAIFLLTIQSCASV--------EYKPLVTGATTA--------IAPNIWPKVVNGS 52

Query: 63  LWRD------SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
           L+++       +  LF+D R  N+GD +TV ++ +  A   + +  SR+ S +  L    
Sbjct: 53  LFQEKIPINYGYQPLFEDHRPHNIGDTITVVLQENISASNSSISNMSRDGSANFGLKIAP 112

Query: 117 SLFGQQTP----QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
                           +L+  G    SGKGS S   K   LI   V  +L NGNL + G 
Sbjct: 113 GQLNNILGVNFQDNTTSLDSFGRNNFSGKGSNSANNKFTGLITVTVKRVLPNGNLKVIGE 172

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           ++V +N     +  +G++ P +++ +N +S  +IA+ARI Y   G   ++ +     +L+
Sbjct: 173 KQVSINKGTEFIRFSGVINPTNINKNNFISSTQIADARIEYLSHGGLDDVQKMGWLQKLL 232

Query: 233 ENLSPL 238
             +SP+
Sbjct: 233 LKISPI 238


>gi|239907790|ref|YP_002954531.1| flagellar L-ring protein [Desulfovibrio magneticus RS-1]
 gi|239797656|dbj|BAH76645.1| flagellar L-ring protein [Desulfovibrio magneticus RS-1]
          Length = 241

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 58/255 (22%), Positives = 103/255 (40%), Gaps = 33/255 (12%)

Query: 1   MYRYSFIVLCY-SSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R   I L   ++ + GC  +  +    PQM+P  +        P              
Sbjct: 1   MRRTPLIPLALIAAAVVGCAPATKQAAPAPQMTPPVAKAPPPADNP-------------- 46

Query: 60  SYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS----- 113
             S++  S    LF D+RA  +GDILTV+I    ++    +T   R  S    +      
Sbjct: 47  -GSIYSQSQPTFLFDDTRARRIGDILTVNIVDTSKSDLKAETKNDRTASNELGVQNYFSN 105

Query: 114 -----------GGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAIL 162
                      GG +         +  +  +       KG   R   +   I A +  IL
Sbjct: 106 KNVAGNLSGQLGGPNFGMNGLIGSDPIVKTNTAQKFQSKGETKRESAVTASIGARIVNIL 165

Query: 163 ENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTEL 222
             G + + G+++ RVNDE + + + G+VRP D+  +N+V    +A+ +I Y G+G   + 
Sbjct: 166 PGGVMQVEGARQTRVNDENQIIVIKGLVRPIDIGPNNTVLSTMLADCQIEYYGEGDLADR 225

Query: 223 LRPPIGHQLIENLSP 237
            +     ++++N+ P
Sbjct: 226 QKSGWLTRILDNVWP 240


>gi|148976397|ref|ZP_01813103.1| flagellar L-ring protein precursor H [Vibrionales bacterium SWAT-3]
 gi|145964220|gb|EDK29476.1| flagellar L-ring protein precursor H [Vibrionales bacterium SWAT-3]
          Length = 258

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 42/216 (19%), Positives = 90/216 (41%), Gaps = 15/216 (6%)

Query: 20  SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH-AALFKDSRAL 78
                I G P  +P+       +                 + SL+  +H  +++ DS+  
Sbjct: 55  GRTDPIAGDPAWAPINPKQKPEHYA-------------AATGSLFNVNHIGSMYDDSKPR 101

Query: 79  NVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGAS 138
            +GDI+TV +  + +A        S++N    +             + N + +       
Sbjct: 102 GIGDIITVALDENTRATKKANADMSKSNDASMEPLAVGGQELT-IDKYNFSYDLSNTNTF 160

Query: 139 SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAH 198
           +G  S +++  ++  I   V  +L NGNL++ G + + +N     + ++G +RP D+D  
Sbjct: 161 AGDASANQSNSISGYITVEVIEVLANGNLVVRGEKWMTLNTGDEYIRLSGTIRPDDIDFD 220

Query: 199 NSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           N+++ ++++ ARI Y G G   ++  P    +    
Sbjct: 221 NTIASNRVSNARIQYSGTGVQQDMQEPGFLARFFNV 256


>gi|300817267|ref|ZP_07097485.1| flagellar L-ring protein FlgH [Escherichia coli MS 107-1]
 gi|300530243|gb|EFK51305.1| flagellar L-ring protein FlgH [Escherichia coli MS 107-1]
          Length = 221

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 46/195 (23%), Positives = 82/195 (42%), Gaps = 7/195 (3%)

Query: 46  FLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR 104
                     +  ++  ++   +  +L  D RA  VGDILTV +    Q+    +T   +
Sbjct: 32  APPKTEAPPPADGRAGGVFETGYNWSLTADRRAYRVGDILTVILEESTQSSKQAKTNFGK 91

Query: 105 NNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN 164
           +N++       F        +   + + D      G  +  +   L   I   V A+  N
Sbjct: 92  SNTVDIGAPTIFG-----HTKDKLSGSIDANRDFDGSATSQQQNSLRGEITVSVHAVQPN 146

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           G L I G + + +N     + ++G+ R  D+   NSVS  +IA+ARISY G+G  ++   
Sbjct: 147 GILEIRGEKWLTLNQGDEYIRLSGLARADDIQNDNSVSSQRIADARISYAGRGALSDANA 206

Query: 225 PPIGHQLIEN-LSPL 238
                +L  + L P+
Sbjct: 207 AGWLTRLFNHPLFPI 221


>gi|153840133|ref|ZP_01992800.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AQ3810]
 gi|149746241|gb|EDM57331.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AQ3810]
          Length = 186

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 40/184 (21%), Positives = 80/184 (43%), Gaps = 1/184 (0%)

Query: 52  KNSDSTKKSYSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR 110
           K       + SL+   H   L+ DS+   +GDI+TV +     A        S+ N    
Sbjct: 1   KPEHYAAATGSLFSPEHITDLYDDSKPRGIGDIITVTLDETTSATKSANADLSKTNEAQM 60

Query: 111 KLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
                     +   + N + + +     +G  S  ++  ++  I   V  +L NGNL+I 
Sbjct: 61  DPLQVGGEELKVGGKYNFSYDLNNTNTFAGDSSAKQSNSISGYITVEVIEVLANGNLVIR 120

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ 230
           G + + +N     + ++G +RP D++  N+++ ++++ ARI Y G G + ++  P    +
Sbjct: 121 GEKWMTLNTGDEYIRLSGTIRPDDINFDNTIASNRVSNARIQYSGTGLSQDMQEPGFLAR 180

Query: 231 LIEN 234
               
Sbjct: 181 FFNV 184


>gi|149908756|ref|ZP_01897417.1| flagellar L-ring protein precursor [Moritella sp. PE36]
 gi|149808298|gb|EDM68237.1| flagellar L-ring protein precursor [Moritella sp. PE36]
          Length = 229

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 57/237 (24%), Positives = 98/237 (41%), Gaps = 12/237 (5%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M     + L   +LL GC  +   +              E +         ++  +T   
Sbjct: 1   MLAKWLVKLSVCALLGGCADNAYNVLEA------KPGEAEWSPTITTKPIVRSDTTTLGD 54

Query: 61  YSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL  +S    +F+D RA  VGDILTV +    Q+     +G  +N+      +   S F
Sbjct: 55  GSLLANSSLLNMFQDRRAYKVGDILTVILEEQTQSSKRANSGIKKNSKGGGNYTSNLSSF 114

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                   G+ +     + +G G+ S+   L+  I   V  IL  G L I G + +++N 
Sbjct: 115 -----DATGSFSLGSDRSFNGGGTSSQQNALSGAITVTVAEILPTGALRIRGEKWIKLNQ 169

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
               + +TG+VR  D+D  N +S  ++A+A I+Y G+G   E  +     + I +  
Sbjct: 170 GDEYIRLTGLVRVDDIDKSNRISSRRLADANITYAGRGELAESNQQGWFTRFINSKW 226


>gi|195953749|ref|YP_002122039.1| flagellar L-ring protein [Hydrogenobaculum sp. Y04AAS1]
 gi|195933361|gb|ACG58061.1| flagellar L-ring protein [Hydrogenobaculum sp. Y04AAS1]
          Length = 224

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 54/241 (22%), Positives = 94/241 (39%), Gaps = 26/241 (10%)

Query: 2   YRYSFIVL---CYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
            ++ F+       S LL  C S+   +  +P  +P  +                      
Sbjct: 4   KKFVFLAFNVTMLSLLLNSCASTPHHLKYLPYSTPSQN-------------------LNY 44

Query: 59  KSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
              SL+      A L+ D RA  VGD++ + +     AV        R+++ +  +S  F
Sbjct: 45  VKGSLYVPDSPMANLYSDQRAFAVGDLVHILVSESVNAVESISNQTQRSSTFNDAVSSFF 104

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            L       +    + +    + G  S  ++      I A V  +  NGNL+I G + + 
Sbjct: 105 GLPSSTLRNLGVGASSNNQQKAQGTES--QSGVFTTTITAYVKRVYPNGNLLIEGHKIIY 162

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N+  R + + GIVRPQD+D  ++V    IA   I Y G G      +P    + +  + 
Sbjct: 163 LNNVERVITLRGIVRPQDIDNTDTVPSQDIANLEILYQGHGYLVNGSQPGWLARFLAKIL 222

Query: 237 P 237
           P
Sbjct: 223 P 223


>gi|330818582|ref|YP_004362287.1| flagellar L-ring protein FlgH [Burkholderia gladioli BSR3]
 gi|327370975|gb|AEA62331.1| flagellar L-ring protein FlgH [Burkholderia gladioli BSR3]
          Length = 232

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 50/203 (24%), Positives = 84/203 (41%), Gaps = 6/203 (2%)

Query: 37  SLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQA 94
                 + P   +        +   S++   +    LF+D R  N+GDILT+ I  +  A
Sbjct: 33  PHQPITQQPMTAVPPVPPQ-MQAPGSIYNPGYAGRPLFEDQRPRNIGDILTIMIAENVNA 91

Query: 95  VFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLI 154
              +    +R  S    +     L G        NL+  G    +  G  + A   +  I
Sbjct: 92  TKTSGANANRGGSTDFNVPTAGFLGGLFNK---ANLSASGSNKFTATGGATAANTFSGTI 148

Query: 155 AAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYG 214
              VT +L NGNL++SG +++ +N     +  +G+V P  +   NSV   ++A+ARI Y 
Sbjct: 149 TVTVTNVLPNGNLMVSGEKQMLINQGNEFVRFSGVVNPNSISGANSVYSTQVADARIEYS 208

Query: 215 GKGRTTELLRPPIGHQLIENLSP 237
            KG   E        +   N++P
Sbjct: 209 AKGYINEAETMGWLQRFFLNVAP 231


>gi|294140188|ref|YP_003556166.1| flagellar L-ring protein FlgH [Shewanella violacea DSS12]
 gi|293326657|dbj|BAJ01388.1| flagellar L-ring protein FlgH [Shewanella violacea DSS12]
          Length = 228

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 48/208 (23%), Positives = 85/208 (40%), Gaps = 5/208 (2%)

Query: 32  SPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA-LFKDSRALNVGDILTVDIRI 90
           S      D+    P        +     + S+++ S A+ L+ D +AL VGDI+TV +  
Sbjct: 23  SAHKPIPDDPYYAPVYP--EAPATKIVATGSMYQASQASSLYSDIKALKVGDIITVILME 80

Query: 91  DDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKL 150
             QA         +   L                    +L Y     +  +    ++  L
Sbjct: 81  QTQAKKSASNEIKKGTDLTLD-PIYVGSGNISISGQALDLRYKDSMNTKRESDADQSNSL 139

Query: 151 NLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEAR 210
           +  I+A V  +L NGNL+I G + + +N+    + +TG+VR QD+   N++   ++A AR
Sbjct: 140 SGSISANVMQVLNNGNLVIRGEKWISINNGDEFVRLTGLVRSQDIRPDNTIDSTRVANAR 199

Query: 211 ISYGGKGRTTELLRPPIGHQLIE-NLSP 237
           I Y G G   ++ +          +  P
Sbjct: 200 IQYSGTGTFADVQKVGWLSSFFMGSWWP 227


>gi|260772277|ref|ZP_05881193.1| flagellar L-ring protein FlgH [Vibrio metschnikovii CIP 69.14]
 gi|260611416|gb|EEX36619.1| flagellar L-ring protein FlgH [Vibrio metschnikovii CIP 69.14]
          Length = 260

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 45/260 (17%), Positives = 90/260 (34%), Gaps = 28/260 (10%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEI----------------------TGIPQMSPMGSSL 38
           M +     L + +LL GC    + +                           +  + +  
Sbjct: 1   MMKRIL-SLAFVALLSGCSLLPAPLETADVVQGTTVVDAVEGDRSSDGSTGLLDTLRNRN 59

Query: 39  DENNRMPFLGIDFKNSDS---TKKSYSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQA 94
           D     P        +       ++ SL+      +L+ D++   +GDI+TV +  + +A
Sbjct: 60  DPVAGDPAWAPIHPKAKPEHYAAETGSLFNLARAVSLYSDAKPRGIGDIITVTLNENTKA 119

Query: 95  VFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLI 154
                   ++NN                    N +         SG    ++   L   I
Sbjct: 120 TKSADAKLTKNNDASMDPLSVGGQELT-IGDYNFSYALKNNNQFSGSAQANQNNNLQGSI 178

Query: 155 AAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYG 214
              V  +L NGNL++ G + + +N     + ++G VRP D+   N+++ ++I+  RI Y 
Sbjct: 179 TVEVIDVLSNGNLVVRGEKWLMLNTGDEYIRLSGTVRPDDIGYDNTIASNRISNTRIQYS 238

Query: 215 GKGRTTELLRPPIGHQLIEN 234
             G   ++  P    +    
Sbjct: 239 STGSNQDMQEPGFLARFFNV 258


>gi|171059409|ref|YP_001791758.1| flagellar L-ring protein [Leptothrix cholodnii SP-6]
 gi|170776854|gb|ACB34993.1| flagellar L-ring protein [Leptothrix cholodnii SP-6]
          Length = 233

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 53/248 (21%), Positives = 98/248 (39%), Gaps = 25/248 (10%)

Query: 1   MYRYSF---------IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDF 51
           M R            +++  ++LL  C            + P  + +D     P      
Sbjct: 1   MNRLVTRIGRSARLALLVGSAALLGAC-----------NLMPTVAKVD--VAEPTSARPV 47

Query: 52  KNSDSTKKSYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR 110
                   + S+++   +  LF+D RA  VGD LTV I     A   + +   ++ S+  
Sbjct: 48  AVVTPGVSNGSIFQAGAYRPLFEDHRARLVGDTLTVQIVEKVSASAKSTSTVEKSGSVDA 107

Query: 111 KLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
            L+           ++   +        +GKG    + + +  I   V  +L NG+L+I+
Sbjct: 108 SLTALPYQGVAALGKL--GVGGSSTNKFAGKGGTENSNEFSGTITTTVIEVLPNGHLLIA 165

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ 230
           G +++ VND    L  +G V P+ +   NSV+  +IA  R+   G+G   +  +     +
Sbjct: 166 GEKQIGVNDNADVLRFSGQVDPRSIQPGNSVASAQIANVRVEQRGRGGGADAQKIGWLGR 225

Query: 231 LIENLSPL 238
              NL P+
Sbjct: 226 FFLNLLPI 233


>gi|88911316|sp|Q82XG6|FLGH_NITEU RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
          Length = 234

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 91/239 (38%), Gaps = 24/239 (10%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           +++    ++ GC               +  +      M     D      ++ S  +++ 
Sbjct: 11  VLIVMICVVSGCA--------------ITPTPKVQQPMSVRPPDLPVIPPSQTSGGIYQA 56

Query: 67  --------SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
                    +  LF+D RA ++GD + V +     A     +   R   +   +     L
Sbjct: 57  VFDYQGRGRYIPLFEDRRARSIGDTIIVALNEKTNASKKTGSNAQRAGEIGLSVPSFLGL 116

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
             +   Q + +L         GKG  S        IA  V  IL NGNL++SG +++ +N
Sbjct: 117 PFKSIFQ-DLDLEATSSNKFDGKGESSSNNNFTGTIAVTVLDILPNGNLLVSGEKQIGIN 175

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
                + ++G V       +N+VS  ++A+ARI Y G G   E+       +   ++SP
Sbjct: 176 QGHEFIRLSG-VINPINIINNTVSSIQVADARIEYRGNGYLDEVQTMGWLSRFFLSISP 233


>gi|115311514|sp|Q6D6H3|FLGH_ERWCT RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
          Length = 237

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 46/198 (23%), Positives = 82/198 (41%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQ 99
                P   +    + S  ++       +  +F+D R  N+GD LT+ ++ +  A   + 
Sbjct: 39  PTTAQPGSPVLAGPNGSIFQTVQPMNYGYQPMFEDRRPRNIGDTLTIVLQENVSASKSSS 98

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVT 159
              +RN S    ++                L+  G    SGKG  +     +  I   V 
Sbjct: 99  ANAARNGSSTFGVATTPRYLEGPLGNNRAALDATGTNDFSGKGGANANNTFSGTITVTVG 158

Query: 160 AILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRT 219
            +L NGNL + G +++ +N     +  +G+V P+ +  +NSV   ++A+ARI Y G G  
Sbjct: 159 QVLANGNLNVVGEKQIAINQGTEFIRFSGVVNPRTISGNNSVPSTQVADARIEYVGNGYI 218

Query: 220 TELLRPPIGHQLIENLSP 237
            E        +   N+SP
Sbjct: 219 NEAQNMGWLQRFFLNVSP 236


>gi|187478188|ref|YP_786212.1| flagellar basal body L-ring protein [Bordetella avium 197N]
 gi|115422774|emb|CAJ49302.1| flagellar L-ring protein [Bordetella avium 197N]
          Length = 229

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 50/236 (21%), Positives = 87/236 (36%), Gaps = 18/236 (7%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
             +      L  GC               +                   + + + + S++
Sbjct: 8   RLMSGLLLILSAGCA--------------LIPPEPVVIGPTTAAPPMPAAPAGRPNGSIY 53

Query: 65  RD---SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           +     +  LF+D R  NVGDI+TV +     A     T  SR+      ++        
Sbjct: 54  QPTAYGNYPLFEDRRPRNVGDIVTVMLEEKTNAAKGVATNTSRSGGAKLGVAAAPKFMDG 113

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
                  + +  G   + G G+ S        I   V  +L NGNL I+G +++ +N   
Sbjct: 114 VVNN-KLDTDITGDNTAKGTGNSSANNSFTGSITTTVVGVLPNGNLQIAGEKQIAINRGS 172

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
             + ++G+V P+ +   NSVS  ++A+ARI Y  KG   E+       +     SP
Sbjct: 173 EYVRLSGVVDPRSITGTNSVSSTRVADARIEYRSKGVMDEVQTMGWLQRFFLIASP 228


>gi|53717917|ref|YP_106903.1| flagellar basal body L-ring protein [Burkholderia pseudomallei
           K96243]
 gi|126440336|ref|YP_001057325.1| flagellar basal body L-ring protein [Burkholderia pseudomallei 668]
 gi|237810464|ref|YP_002894915.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei MSHR346]
 gi|254182137|ref|ZP_04888734.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 1655]
 gi|81380628|sp|Q63YB2|FLGH_BURPS RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|52208331|emb|CAH34264.1| flagellar L-ring protein precursor [Burkholderia pseudomallei
           K96243]
 gi|126219829|gb|ABN83335.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 668]
 gi|184212675|gb|EDU09718.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 1655]
 gi|237503889|gb|ACQ96207.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei MSHR346]
          Length = 240

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 53/202 (26%), Positives = 84/202 (41%), Gaps = 5/202 (2%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAV 95
             E      +        + +   S++   +    LF+D R  NVGDILT+ I  +  A 
Sbjct: 41  PREPITQQPMSAMPPMPPAMQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINAT 100

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
             +    +R  +    +     L G        NL+  G    +  G  S A   N  I 
Sbjct: 101 KSSGANTNRQGNTSFDVPTAGFLGGLFNK---ANLSAQGANKFAATGGASAANTFNGTIT 157

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             VT +L NGNL++SG +++ +N     +  +GIV P  +   NSV   ++A+ARI Y  
Sbjct: 158 VTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSA 217

Query: 216 KGRTTELLRPPIGHQLIENLSP 237
           KG   E        +   N++P
Sbjct: 218 KGYINEAETMGWLQRFFLNIAP 239


>gi|121599856|ref|YP_994294.1| flagellar basal body L-ring protein [Burkholderia mallei SAVP1]
 gi|162210053|ref|YP_331882.2| flagellar basal body L-ring protein [Burkholderia pseudomallei
           1710b]
 gi|167001540|ref|ZP_02267335.1| flagellar L-ring protein FlgH [Burkholderia mallei PRL-20]
 gi|217424924|ref|ZP_03456420.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 576]
 gi|226199862|ref|ZP_03795413.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei Pakistan
           9]
 gi|254175119|ref|ZP_04881780.1| flagellar L-ring protein FlgH [Burkholderia mallei ATCC 10399]
 gi|254196301|ref|ZP_04902725.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei S13]
 gi|254259034|ref|ZP_04950088.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 1710a]
 gi|254295817|ref|ZP_04963274.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 406e]
 gi|254359735|ref|ZP_04976006.1| flagellar L-ring protein FlgH [Burkholderia mallei 2002721280]
 gi|121228666|gb|ABM51184.1| flagellar L-ring protein FlgH [Burkholderia mallei SAVP1]
 gi|148028949|gb|EDK86881.1| flagellar L-ring protein FlgH [Burkholderia mallei 2002721280]
 gi|157805743|gb|EDO82913.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 406e]
 gi|160696164|gb|EDP86134.1| flagellar L-ring protein FlgH [Burkholderia mallei ATCC 10399]
 gi|169653044|gb|EDS85737.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei S13]
 gi|217391944|gb|EEC31970.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 576]
 gi|225928213|gb|EEH24249.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei Pakistan
           9]
 gi|243062741|gb|EES44927.1| flagellar L-ring protein FlgH [Burkholderia mallei PRL-20]
 gi|254217723|gb|EET07107.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 1710a]
          Length = 240

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 53/202 (26%), Positives = 84/202 (41%), Gaps = 5/202 (2%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAV 95
             E      +        + +   S++   +    LF+D R  NVGDILT+ I  +  A 
Sbjct: 41  PREPITQQPMSAMPPMPPAMQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINAT 100

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
             +    +R  +    +     L G        NL+  G    +  G  S A   N  I 
Sbjct: 101 KSSGANTNRQGNTSFDVPTAGFLGGLFNK---ANLSAQGANKFAATGGASAANTFNGTIT 157

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             VT +L NGNL++SG +++ +N     +  +GIV P  +   NSV   ++A+ARI Y  
Sbjct: 158 VTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSA 217

Query: 216 KGRTTELLRPPIGHQLIENLSP 237
           KG   E        +   N++P
Sbjct: 218 KGYINEAETMGWLQRFFLNIAP 239


>gi|124385970|ref|YP_001028057.1| flagellar basal body L-ring protein [Burkholderia mallei NCTC
           10229]
 gi|126448432|ref|YP_001082864.1| flagellar basal body L-ring protein [Burkholderia mallei NCTC
           10247]
 gi|124293990|gb|ABN03259.1| flagellar L-ring protein FlgH [Burkholderia mallei NCTC 10229]
 gi|126241302|gb|ABO04395.1| flagellar L-ring protein FlgH [Burkholderia mallei NCTC 10247]
          Length = 238

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 53/202 (26%), Positives = 84/202 (41%), Gaps = 5/202 (2%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAV 95
             E      +        + +   S++   +    LF+D R  NVGDILT+ I  +  A 
Sbjct: 39  PREPITQQPMSAMPPMPPAMQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINAT 98

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
             +    +R  +    +     L G        NL+  G    +  G  S A   N  I 
Sbjct: 99  KSSGANTNRQGNTSFDVPTAGFLGGLFNK---ANLSAQGANKFAATGGASAANTFNGTIT 155

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             VT +L NGNL++SG +++ +N     +  +GIV P  +   NSV   ++A+ARI Y  
Sbjct: 156 VTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSA 215

Query: 216 KGRTTELLRPPIGHQLIENLSP 237
           KG   E        +   N++P
Sbjct: 216 KGYINEAETMGWLQRFFLNIAP 237


>gi|283834452|ref|ZP_06354193.1| flagellar L-ring protein FlgH [Citrobacter youngae ATCC 29220]
 gi|291069999|gb|EFE08108.1| flagellar L-ring protein FlgH [Citrobacter youngae ATCC 29220]
          Length = 248

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 48/195 (24%), Positives = 85/195 (43%), Gaps = 7/195 (3%)

Query: 46  FLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR 104
                     +  ++  ++   +  +L  D RA  VGDILTV +    Q+    +T   +
Sbjct: 59  APPKTEAPPTADGRAGGVFETGYNWSLTADRRAYRVGDILTVMLEESTQSSKQAKTNFGK 118

Query: 105 NNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN 164
           NN++       F        + N + + D     +G  +  +   L   I   V ++  N
Sbjct: 119 NNTVDIGAPTLFG-----HTKDNLSASVDANRDFNGTATSQQQNSLRGEITVSVHSVQSN 173

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           G L I G + + +N     + ++G+VR  D+   NSVS  +IA+ARISY G+G  ++   
Sbjct: 174 GILEIRGEKWLTLNQGDEYIRLSGLVRADDIQNDNSVSSQRIADARISYAGRGALSDANA 233

Query: 225 PPIGHQLIEN-LSPL 238
                +L  + L P+
Sbjct: 234 AGWLTRLFNHPLFPI 248


>gi|50120642|ref|YP_049809.1| flagellar basal body L-ring protein [Pectobacterium atrosepticum
           SCRI1043]
 gi|49611168|emb|CAG74614.1| flagellar L-ring protein [Pectobacterium atrosepticum SCRI1043]
          Length = 239

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 46/198 (23%), Positives = 82/198 (41%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQ 99
                P   +    + S  ++       +  +F+D R  N+GD LT+ ++ +  A   + 
Sbjct: 41  PTTAQPGSPVLAGPNGSIFQTVQPMNYGYQPMFEDRRPRNIGDTLTIVLQENVSASKSSS 100

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVT 159
              +RN S    ++                L+  G    SGKG  +     +  I   V 
Sbjct: 101 ANAARNGSSTFGVATTPRYLEGPLGNNRAALDATGTNDFSGKGGANANNTFSGTITVTVG 160

Query: 160 AILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRT 219
            +L NGNL + G +++ +N     +  +G+V P+ +  +NSV   ++A+ARI Y G G  
Sbjct: 161 QVLANGNLNVVGEKQIAINQGTEFIRFSGVVNPRTISGNNSVPSTQVADARIEYVGNGYI 220

Query: 220 TELLRPPIGHQLIENLSP 237
            E        +   N+SP
Sbjct: 221 NEAQNMGWLQRFFLNVSP 238


>gi|134283676|ref|ZP_01770375.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 305]
 gi|134245085|gb|EBA45180.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 305]
          Length = 232

 Score =  182 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 53/202 (26%), Positives = 84/202 (41%), Gaps = 5/202 (2%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAV 95
             E      +        + +   S++   +    LF+D R  NVGDILT+ I  +  A 
Sbjct: 33  PREPITQQPMSAMPPMPPAMQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINAT 92

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
             +    +R  +    +     L G        NL+  G    +  G  S A   N  I 
Sbjct: 93  KSSGANTNRQGNTSFDVPTAGFLGGLFNK---ANLSAQGANKFAATGGASAANTFNGTIT 149

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             VT +L NGNL++SG +++ +N     +  +GIV P  +   NSV   ++A+ARI Y  
Sbjct: 150 VTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSA 209

Query: 216 KGRTTELLRPPIGHQLIENLSP 237
           KG   E        +   N++P
Sbjct: 210 KGYINEAETMGWLQRFFLNIAP 231


>gi|144224|gb|AAA23035.1| basal body L-ring protein precursor [Caulobacter vibrioides]
          Length = 242

 Score =  182 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 73/225 (32%), Positives = 111/225 (49%), Gaps = 8/225 (3%)

Query: 19  HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA-LFKDSRA 77
            S++ E    P ++P+G                + +        L         F D RA
Sbjct: 19  CSTVKEAVKGPDLAPVGYPAPLAPMQQQYVSAREPAPQRF--GQLAVAGRGPAFFNDQRA 76

Query: 78  LNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNY----- 132
             VGDI+TV I IDD A     T  SR  ++   +     +       + G  +      
Sbjct: 77  SRVGDIVTVMIDIDDSARTKKPTNSSRTANMKAGVRHLLGMESSLGKFLPGGFDPASALE 136

Query: 133 DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRP 192
                ++     SR+EK++L IAA+V+ +L NGN++I G+QEVR N E+R L V GIVRP
Sbjct: 137 TNSTTTNAGSGGSRSEKISLTIAAVVSQLLPNGNMVIQGTQEVRTNAELRQLTVAGIVRP 196

Query: 193 QDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +D+ + N++ + +IAEARISYGG+G  + + + P G  L+E  SP
Sbjct: 197 EDISSANTIRHTQIAEARISYGGRGDISRVQKTPAGQSLVEKFSP 241


>gi|83718865|ref|YP_440804.1| flagellar basal body L-ring protein [Burkholderia thailandensis
           E264]
 gi|257140545|ref|ZP_05588807.1| flagellar basal body L-ring protein [Burkholderia thailandensis
           E264]
 gi|83652690|gb|ABC36753.1| flagellar L-ring protein FlgH [Burkholderia thailandensis E264]
          Length = 240

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 52/202 (25%), Positives = 84/202 (41%), Gaps = 5/202 (2%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAV 95
             E      +        + +   S++   +    LF+D R  NVGDILT+ I  +  A 
Sbjct: 41  PREPITQQPMSAMPPMPPAMQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINAT 100

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
             +    +R  +    +     L G        NL+  G    +  G  S A   N  I 
Sbjct: 101 KSSGANTNRQGNTSFDVPTAGFLGGLFNK---ANLSAQGANKFAATGGASAANTFNGTIT 157

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             VT +L NGNL++SG +++ +N     +  +G+V P  +   NSV   ++A+ARI Y  
Sbjct: 158 VTVTNVLPNGNLVVSGQKQMLINQGNEFVRFSGVVNPNTISGQNSVYSTQVADARIEYSA 217

Query: 216 KGRTTELLRPPIGHQLIENLSP 237
           KG   E        +   N++P
Sbjct: 218 KGYINEAETMGWLQRFFLNIAP 239


>gi|315125987|ref|YP_004067990.1| lateral flagellar L-ring protein, LfgH [Pseudoalteromonas sp.
           SM9913]
 gi|315014501|gb|ADT67839.1| lateral flagellar L-ring protein, LfgH [Pseudoalteromonas sp.
           SM9913]
          Length = 240

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 57/229 (24%), Positives = 103/229 (44%), Gaps = 12/229 (5%)

Query: 15  LFGCHSSISEITGI------PQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH 68
           + GC ++ S+   +       ++    ++  ++ +   +  D       ++  SL++D++
Sbjct: 14  VAGCSNTPSKTQMVECEVVYGEVKCPQNTTQKSVQDYEISQDAYAQGLNQQDGSLFQDNY 73

Query: 69  A-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
             +L+ D RA  VGDILTV +    Q+     +   ++  L   +              +
Sbjct: 74  MFSLYADKRAYRVGDILTVVLNERTQSSKSADSSLDKSTDLDVSVPV-----AGALNVAD 128

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            NL         G+ S S+   L+  I   V  +L NG+L+I G +++++N     + + 
Sbjct: 129 FNLGIGSSAKFDGESSASQQNFLSGAITVRVNHVLSNGSLVIKGRKQIKLNQGDEYIEIE 188

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           G+VRP D+D  N VS  +IAEA+ISY GKG   +  RP     L     
Sbjct: 189 GLVRPGDIDVSNRVSSLRIAEAQISYTGKGTLADANRPGWFTTLFTRFL 237


>gi|224825167|ref|ZP_03698273.1| flagellar L-ring protein [Lutiella nitroferrum 2002]
 gi|224602838|gb|EEG09015.1| flagellar L-ring protein [Lutiella nitroferrum 2002]
          Length = 227

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 57/242 (23%), Positives = 92/242 (38%), Gaps = 21/242 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M     ++   +  L GC                        + P          +   +
Sbjct: 1   MKAIFGVMAMLAVALSGCAV----------------PEPPIVQQPMSARPQPAPQALPGN 44

Query: 61  YSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            S+++   +  +F D     VGD LTV I          QT   R +SL   +  G  L 
Sbjct: 45  GSIFQAGSYQPIFADRVPARVGDTLTVTIEEKTTTAASEQTTGKRTSSLSNSMGAGLQLP 104

Query: 120 GQQT----PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
                        +L+ DG   S GKG+   +      I   V  +L NGNL++SG ++V
Sbjct: 105 FVPDYLEKKLAGASLSADGSATSGGKGTNQASSSFVSSITVTVIDVLANGNLMVSGEKQV 164

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
           R+N +   + ++G+V P+D+   N+VS  K+A+ARI    KG       P    +    +
Sbjct: 165 RLNGDTEYIRLSGVVNPRDIKTGNTVSSTKVADARIEQQSKGNNRSFAEPGWLTKFFMTV 224

Query: 236 SP 237
            P
Sbjct: 225 LP 226


>gi|84388094|ref|ZP_00990990.1| flagellar L-ring protein precursor [Vibrio splendidus 12B01]
 gi|84377161|gb|EAP94031.1| flagellar L-ring protein precursor [Vibrio splendidus 12B01]
          Length = 258

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 41/216 (18%), Positives = 90/216 (41%), Gaps = 15/216 (6%)

Query: 20  SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH-AALFKDSRAL 78
                + G P  +P+       +                 + SL+  +H  +++ DS+  
Sbjct: 55  GRTDPVAGDPAWAPINPKEKPEHYA-------------AATGSLFNVNHIGSMYDDSKPR 101

Query: 79  NVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGAS 138
            +GDI+TV +  + +A        S++N    +             + N + +       
Sbjct: 102 GIGDIITVALDENTRATKKANADMSKSNDASMEPLAVGGQELT-IDKYNFSYDLSNTNTF 160

Query: 139 SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAH 198
           +G  S +++  ++  I   V  +L NGNL++ G + + +N     + ++G +RP D+D  
Sbjct: 161 AGDASANQSNSISGYITVEVIEVLANGNLVVRGEKWMTLNTGDEYIRLSGTIRPDDIDFE 220

Query: 199 NSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           N+++ ++++ ARI Y G G   ++  P    +    
Sbjct: 221 NTIASNRVSNARIQYSGTGVQKDMQEPGFLARFFNV 256


>gi|261821156|ref|YP_003259262.1| flagellar basal body L-ring protein [Pectobacterium wasabiae
           WPP163]
 gi|261605169|gb|ACX87655.1| flagellar L-ring protein [Pectobacterium wasabiae WPP163]
          Length = 237

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 44/198 (22%), Positives = 83/198 (41%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQ 99
                P   +    + S  ++       +  +F+D R  N+GD LT+ ++ +  A   + 
Sbjct: 39  PTTAQPGSPVLAGPNGSIFQTVQPMNYGYQPMFEDRRPRNIGDTLTIVLQENVSASKSSS 98

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVT 159
              +RN +    ++               +LN  G    +G+G  +     +  I   V 
Sbjct: 99  ANAARNGASTFGVTATPRYLEGPLGNNRASLNATGTNDFTGQGGANANNTFSGTITVTVG 158

Query: 160 AILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRT 219
            +L NGNL + G +++ +N     +  +G+V P+ +  +NSV   ++A+ARI Y G G  
Sbjct: 159 QVLANGNLNVVGEKQIAINQGTEFIRFSGVVNPRTISGNNSVPSTQVADARIEYVGNGYI 218

Query: 220 TELLRPPIGHQLIENLSP 237
            E        +   N+SP
Sbjct: 219 NEAQNMGWLQRFFLNVSP 236


>gi|327478812|gb|AEA82122.1| flagellar basal body L-ring protein [Pseudomonas stutzeri DSM 4166]
          Length = 222

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 49/203 (24%), Positives = 83/203 (40%), Gaps = 7/203 (3%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVF 96
           L + +   +  ++   S        L+R  +  +L  D RA+ VGDILT+ +    Q+  
Sbjct: 25  LPDEDSSEYEPLELDYSLPPTTGGGLFRSGYGGSLVSDKRAVRVGDILTIVLDESTQSSK 84

Query: 97  DNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAA 156
              T   + +S+   +              +           SG    S+   L   IA 
Sbjct: 85  SAGTSFGKQSSIGVGVPTVLGKTYP-----DVETAASAERDFSGSAKSSQQNTLRGSIAV 139

Query: 157 IVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGK 216
            V  +L NG L++ G + +R+N     + + G+VR  D++  N VS   +A ARISY G+
Sbjct: 140 TVHRVLPNGTLLVKGEKALRLNQGDEYIRLAGLVRMDDINRFNQVSSQNVANARISYAGR 199

Query: 217 GRTTELLRPPIGHQLIEN-LSPL 238
           G   +        +   + L PL
Sbjct: 200 GVLNDSNSAGWLTRFFAHPLFPL 222


>gi|254511221|ref|ZP_05123288.1| flagellar L-ring protein FlgH [Rhodobacteraceae bacterium KLH11]
 gi|221534932|gb|EEE37920.1| flagellar L-ring protein FlgH [Rhodobacteraceae bacterium KLH11]
          Length = 174

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 76/173 (43%), Positives = 104/173 (60%), Gaps = 6/173 (3%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT------P 124
           +  D RA+  GDILTV I +D++A   N T RSR  S    +   F L  +         
Sbjct: 1   MLGDQRAMKKGDILTVVIELDEKAEISNDTNRSRAGSESLAVPDLFGLPQRAGERLPEGA 60

Query: 125 QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
            ++  ++ D    S GKGS+ R EKL L +AA V  +L NG L ISGSQE+RVN E+R L
Sbjct: 61  SLDEAVSIDSASVSKGKGSVKRKEKLTLRVAATVVDVLPNGVLSISGSQELRVNFELREL 120

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            V G VRPQD+   N ++YDKIA AR+SYGG+G+ T++ +P  G Q+++ L P
Sbjct: 121 LVAGYVRPQDISRQNEITYDKIASARVSYGGRGQITDVQQPRYGQQILDTLLP 173


>gi|167892414|ref|ZP_02479816.1| flagellar basal body L-ring protein [Burkholderia pseudomallei
           7894]
          Length = 213

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 53/202 (26%), Positives = 84/202 (41%), Gaps = 5/202 (2%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAV 95
             E      +        + +   S++   +    LF+D R  NVGDILT+ I  +  A 
Sbjct: 14  PREPITQQPMSAMPPMPPAMQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINAT 73

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
             +    +R  +    +     L G        NL+  G    +  G  S A   N  I 
Sbjct: 74  KSSGANTNRQGNTSFDVPTAGFLGGLFNK---ANLSAQGANKFAATGGASAANTFNGTIT 130

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             VT +L NGNL++SG +++ +N     +  +GIV P  +   NSV   ++A+ARI Y  
Sbjct: 131 VTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSA 190

Query: 216 KGRTTELLRPPIGHQLIENLSP 237
           KG   E        +   N++P
Sbjct: 191 KGYINEAETMGWLQRFFLNIAP 212


>gi|319787118|ref|YP_004146593.1| flagellar L-ring protein [Pseudoxanthomonas suwonensis 11-1]
 gi|317465630|gb|ADV27362.1| flagellar L-ring protein [Pseudoxanthomonas suwonensis 11-1]
          Length = 229

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 45/206 (21%), Positives = 90/206 (43%), Gaps = 2/206 (0%)

Query: 34  MGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDD 92
           + +            +      +   + +++      +L+ D  A +VGD+LT+++    
Sbjct: 23  VAAGDVRPYPPMAPVVPVMPVQAAPTAGAIYAGGQGLSLYGDRIARDVGDLLTINLVEST 82

Query: 93  QAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNL 152
            A     T  S+++ L   ++  F        +   + + +G     G+G  S++ +L  
Sbjct: 83  TAQTSATTQVSKDSELSTGVTSLFGGPVTYKGRDILSASANGERDFDGQGKSSQSNRLQG 142

Query: 153 LIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARIS 212
            +   V   L NGNL++ G + +R+N     + + GIVRPQD+   N+V   ++ EARI 
Sbjct: 143 SVTVSVIQRLPNGNLVVQGQKNLRLNQGDELVQIQGIVRPQDISRDNTVPSSRVGEARIV 202

Query: 213 YGGKGRTTELLRPPIGHQLIEN-LSP 237
           YGG+G   +        +   + + P
Sbjct: 203 YGGRGAIAQANAMGWLGRFFNSRIYP 228


>gi|167568426|ref|ZP_02361300.1| flagellar basal body L-ring protein [Burkholderia oklahomensis
           C6786]
          Length = 216

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 52/202 (25%), Positives = 85/202 (42%), Gaps = 5/202 (2%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAV 95
             E      + +      + +   S++   +    LF+D R  N+GDILT+ I  +  A 
Sbjct: 17  PREPITQQPMSVMPPMPPAMQAPGSIYNPGYAGRPLFEDQRPRNIGDILTIVIAENINAT 76

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
             +    +R  +    +     L G        NL+  G    +  G  S A   N  I 
Sbjct: 77  KSSGANTNRQGNTSFDVPTAGFLGGLFNK---ANLSAQGANKFAATGGASAANTFNGTIT 133

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             VT +L NGNL++SG +++ +N     +  +GIV P  +   NSV   ++A+ARI Y  
Sbjct: 134 VTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSA 193

Query: 216 KGRTTELLRPPIGHQLIENLSP 237
           KG   E        +   N++P
Sbjct: 194 KGYINEAETMGWLQRFFLNIAP 215


>gi|167561207|ref|ZP_02354123.1| flagellar basal body L-ring protein [Burkholderia oklahomensis
           EO147]
          Length = 212

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 52/202 (25%), Positives = 85/202 (42%), Gaps = 5/202 (2%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAV 95
             E      + +      + +   S++   +    LF+D R  N+GDILT+ I  +  A 
Sbjct: 13  PREPITQQPMSVMPPMPPAMQAPGSIYNPGYAGRPLFEDQRPRNIGDILTIVIAENINAT 72

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
             +    +R  +    +     L G        NL+  G    +  G  S A   N  I 
Sbjct: 73  KSSGANTNRQGNTSFDVPTAGFLGGLFNK---ANLSAQGANKFAATGGASAANTFNGTIT 129

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             VT +L NGNL++SG +++ +N     +  +GIV P  +   NSV   ++A+ARI Y  
Sbjct: 130 VTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSA 189

Query: 216 KGRTTELLRPPIGHQLIENLSP 237
           KG   E        +   N++P
Sbjct: 190 KGYINEAETMGWLQRFFLNIAP 211


>gi|107023950|ref|YP_622277.1| flagellar basal body L-ring protein [Burkholderia cenocepacia AU
           1054]
 gi|116691037|ref|YP_836660.1| flagellar basal body L-ring protein [Burkholderia cenocepacia
           HI2424]
 gi|170734371|ref|YP_001766318.1| flagellar basal body L-ring protein [Burkholderia cenocepacia
           MC0-3]
 gi|123071887|sp|Q1BSV1|FLGH_BURCA RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|166214816|sp|A0KB90|FLGH_BURCH RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|105894139|gb|ABF77304.1| flagellar L-ring protein [Burkholderia cenocepacia AU 1054]
 gi|116649126|gb|ABK09767.1| flagellar L-ring protein [Burkholderia cenocepacia HI2424]
 gi|169817613|gb|ACA92196.1| flagellar L-ring protein [Burkholderia cenocepacia MC0-3]
          Length = 229

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 52/203 (25%), Positives = 85/203 (41%), Gaps = 6/203 (2%)

Query: 37  SLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQA 94
             D   + P          S +   S++   +    LF+D R  N+GDILT+ I  +  A
Sbjct: 30  PRDPIIQQPMTA-QPPMPMSMQAPGSIYNPGYAGRPLFEDQRPRNIGDILTIMIAENINA 88

Query: 95  VFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLI 154
              +    +R  +    +     L G        NL+  G    +  G  S A   N  I
Sbjct: 89  TKSSGANTNRQGNTDFNVPTAGFLGGLFAK---ANLSATGANKFAATGGASAANTFNGTI 145

Query: 155 AAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYG 214
              VT +L NGNL++SG +++ +N     +  +G+V P  +   NSV   ++A+A+I Y 
Sbjct: 146 TVTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGVVNPNTISGANSVYSTQVADAKIEYS 205

Query: 215 GKGRTTELLRPPIGHQLIENLSP 237
            KG   E        +   N++P
Sbjct: 206 SKGYINEAETMGWLQRFFLNIAP 228


>gi|15606795|ref|NP_214175.1| flagellar L-ring protein FlgH [Aquifex aeolicus VF5]
 gi|6225345|sp|O67609|FLGH_AQUAE RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|2984027|gb|AAC07570.1| flagellar L-ring protein FlgH [Aquifex aeolicus VF5]
          Length = 216

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 46/233 (19%), Positives = 84/233 (36%), Gaps = 20/233 (8%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW- 64
             +      +  C + +          P     ++  R                  SL+ 
Sbjct: 2   LYLFFALIFIISCSTKVESKKKYTYSFPKTYKEEKPTR-----------------GSLFK 44

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP 124
               A L+   RA  VGD++ + +     A+    T   R+ S    +S  F +      
Sbjct: 45  SPQSAYLYGSVRASEVGDVIYIRVIESINAIESVSTNVGRSTSFSNAISSFFGVHPATLK 104

Query: 125 QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
            +             G     ++  L   +A  V  +  NG +++   + + VN   R  
Sbjct: 105 NLGAGGKSSFAS--KGGSKFQQSGVLTTTLAGRVVKVFPNGTMLVEAKKYIEVNGVKREF 162

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            + GIVRP+D+D++N+V+ DKIA+  I + G+G       P    ++   L P
Sbjct: 163 LLRGIVRPEDIDSNNTVTSDKIADMEIFFEGRGYIVRGGEPGWLAKIFAILFP 215


>gi|170682469|ref|YP_001742376.1| flagellar basal body L-ring protein [Escherichia coli SMS-3-5]
 gi|188494218|ref|ZP_03001488.1| flagellar L-ring protein FlgH [Escherichia coli 53638]
 gi|306813300|ref|ZP_07447493.1| flagellar basal body L-ring protein [Escherichia coli NC101]
 gi|170520187|gb|ACB18365.1| lateral flagellar L-ring protein LfgH [Escherichia coli SMS-3-5]
 gi|188489417|gb|EDU64520.1| flagellar L-ring protein FlgH [Escherichia coli 53638]
 gi|305854063|gb|EFM54502.1| flagellar basal body L-ring protein [Escherichia coli NC101]
          Length = 221

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 47/181 (25%), Positives = 81/181 (44%), Gaps = 7/181 (3%)

Query: 60  SYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           +  ++   +  +L  D RA  VGDILTV +    Q+    +T   ++N++       F  
Sbjct: 46  AGGVFETGYNWSLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKSNTVDIGAPTIFG- 104

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                 +   + + D      G  +  +   L   I   V A+  NG L I G + + +N
Sbjct: 105 ----HTKDKLSGSIDANRDFDGSATSQQQNSLRGEITVSVHAVQPNGILEIRGEKWLTLN 160

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
                + ++G+VR  D+   NSVS  +IA+ARISY G+G  ++        +L  + L P
Sbjct: 161 QGDEYIRLSGLVRADDIQNDNSVSSQRIADARISYAGRGALSDANAAGWLTRLFNHPLFP 220

Query: 238 L 238
           +
Sbjct: 221 I 221


>gi|166712059|ref|ZP_02243266.1| flagellar basal body L-ring protein [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 212

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 51/226 (22%), Positives = 94/226 (41%), Gaps = 17/226 (7%)

Query: 14  LLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALF 72
           +L GC ++  ++     M+P+   +    +                + +++       L+
Sbjct: 1   MLGGCVAAG-DVRPYAAMAPIVPVVAPTVQ--------------PTAGAIYAAGPGLNLY 45

Query: 73  KDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNY 132
            D RA +VGD+LT+ +     A     T  S+ ++                         
Sbjct: 46  GDRRARDVGDLLTITLIESTTASSSANTSTSKKDATTMASPTLLGAPLTVAGLDVLQNTL 105

Query: 133 DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRP 192
            G  A  GKG+ +++ ++   +   V   L NGNL++ G + +R+N     + V GIVR 
Sbjct: 106 KGDRAFDGKGNTAQSNRMQGSVTVTVIQRLPNGNLVVQGQKNLRLNQGDELVQVQGIVRA 165

Query: 193 QDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
            D+   N++   K+AEARI+YGG+G   +        +   + LSP
Sbjct: 166 ADIAPDNTIPSSKVAEARIAYGGRGAIAQSNAMGWLSRFFNSRLSP 211


>gi|171321841|ref|ZP_02910742.1| flagellar L-ring protein [Burkholderia ambifaria MEX-5]
 gi|171092879|gb|EDT38131.1| flagellar L-ring protein [Burkholderia ambifaria MEX-5]
          Length = 229

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 52/203 (25%), Positives = 86/203 (42%), Gaps = 6/203 (2%)

Query: 37  SLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQA 94
             D   + P          S +   S++   +    LF+D R  N+GDILT+ I  +  A
Sbjct: 30  PRDPIIQQPMTA-QPPMPMSMQAPGSIYNPGYAGRPLFEDQRPRNIGDILTIMIAENINA 88

Query: 95  VFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLI 154
              +    +R  +    +     L G        NL+  G    +  G  S A   N  I
Sbjct: 89  TKSSGANTNRQGNTDFSVPTAAFLGGLFAK---ANLSAAGANKFAATGGASAANTFNGTI 145

Query: 155 AAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYG 214
              VT++L NGNL++SG +++ +N     +  +G+V P  +   NSV   ++A+A+I Y 
Sbjct: 146 TVTVTSVLPNGNLVVSGEKQMLINQGNEFVRFSGVVNPNTISGANSVYSTQVADAKIEYS 205

Query: 215 GKGRTTELLRPPIGHQLIENLSP 237
            KG   E        +   N++P
Sbjct: 206 SKGYINEAETMGWLQRFFLNIAP 228


>gi|78067834|ref|YP_370603.1| flagellar basal body L-ring protein [Burkholderia sp. 383]
 gi|110816526|sp|Q39C57|FLGH_BURS3 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|77968579|gb|ABB09959.1| Flagellar L-ring protein [Burkholderia sp. 383]
          Length = 230

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 53/203 (26%), Positives = 85/203 (41%), Gaps = 6/203 (2%)

Query: 37  SLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQA 94
             D   + P          S +   S++   +    LF+D R  NVGDILT+ I  +  A
Sbjct: 31  PRDPIIQQPMTA-QPPTPMSMQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIMIAENINA 89

Query: 95  VFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLI 154
              +    +R  +    +     L G        NL+  G    +  G  S A   N  I
Sbjct: 90  TKSSGANTNRQGNTDFNVPTAGFLGGLFAK---ANLSATGNNKFAATGGASAANTFNGTI 146

Query: 155 AAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYG 214
              VT +L NGNL++SG +++ +N     +  +G+V P  +   NSV   ++A+A+I Y 
Sbjct: 147 TVTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGVVNPNTISGANSVYSTQVADAKIEYS 206

Query: 215 GKGRTTELLRPPIGHQLIENLSP 237
            KG   E        +   N++P
Sbjct: 207 AKGYINEAETMGWLQRFFLNIAP 229


>gi|197122911|ref|YP_002134862.1| flagellar L-ring protein [Anaeromyxobacter sp. K]
 gi|226701912|sp|B4UG41|FLGH_ANASK RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|196172760|gb|ACG73733.1| flagellar L-ring protein [Anaeromyxobacter sp. K]
          Length = 229

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 55/204 (26%), Positives = 87/204 (42%), Gaps = 7/204 (3%)

Query: 36  SSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQ 93
           +      R   +            + S WR+  AA  L+ D+RAL V D++ V I     
Sbjct: 30  AGHVPKRRDYAVPDAAGQEAQAASAGSTWREGRAASMLYTDARALRVNDLVVVRIEEIAD 89

Query: 94  AVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLL 153
           A     T  +R + L+  +    +            L         G GS +R E+L   
Sbjct: 90  AKRSADTDLTRRSELNASIEAFLTSL-----DAPYALKGGATTGFKGLGSTARTERLTAT 144

Query: 154 IAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISY 213
           + A+V  +L NGNL I G + V VN E +   ++G+VRP D+D  N V    +A+A I +
Sbjct: 145 VPAVVRKVLPNGNLFIEGHRVVLVNAEEQHFYISGVVRPIDIDQENGVKSSMVADAEIEF 204

Query: 214 GGKGRTTELLRPPIGHQLIENLSP 237
            G+G  ++  R     +L+    P
Sbjct: 205 TGRGVLSDNQRQGWLSRLLGWFWP 228


>gi|53724568|ref|YP_104801.1| flagellar basal body L-ring protein [Burkholderia mallei ATCC
           23344]
 gi|67641541|ref|ZP_00440318.1| flagellar L-ring protein FlgH [Burkholderia mallei GB8 horse 4]
 gi|254207233|ref|ZP_04913584.1| flagellar L-ring protein FlgH [Burkholderia mallei JHU]
 gi|81603729|sp|Q62ES7|FLGH_BURMA RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|110816525|sp|Q3JX21|FLGH_BURP1 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|52427991|gb|AAU48584.1| flagellar L-ring protein FlgH [Burkholderia mallei ATCC 23344]
 gi|76580178|gb|ABA49653.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 1710b]
 gi|147752775|gb|EDK59841.1| flagellar L-ring protein FlgH [Burkholderia mallei JHU]
 gi|238522492|gb|EEP85936.1| flagellar L-ring protein FlgH [Burkholderia mallei GB8 horse 4]
          Length = 222

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 53/202 (26%), Positives = 84/202 (41%), Gaps = 5/202 (2%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAV 95
             E      +        + +   S++   +    LF+D R  NVGDILT+ I  +  A 
Sbjct: 23  PREPITQQPMSAMPPMPPAMQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINAT 82

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
             +    +R  +    +     L G        NL+  G    +  G  S A   N  I 
Sbjct: 83  KSSGANTNRQGNTSFDVPTAGFLGGLFNK---ANLSAQGANKFAATGGASAANTFNGTIT 139

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             VT +L NGNL++SG +++ +N     +  +GIV P  +   NSV   ++A+ARI Y  
Sbjct: 140 VTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSA 199

Query: 216 KGRTTELLRPPIGHQLIENLSP 237
           KG   E        +   N++P
Sbjct: 200 KGYINEAETMGWLQRFFLNIAP 221


>gi|167835115|ref|ZP_02461998.1| flagellar basal body L-ring protein [Burkholderia thailandensis
           MSMB43]
          Length = 209

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 54/227 (23%), Positives = 88/227 (38%), Gaps = 21/227 (9%)

Query: 13  SLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AA 70
           + L GC                     E      +        + +   S++   +    
Sbjct: 1   AALAGCA----------------QIPREPITQQPMSAPPPMPPAMQAPGSIYNPGYAGRP 44

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           LF+D R  NVGDILT+ I  +  A   +    +R  +    +     L G        NL
Sbjct: 45  LFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLGGLFNK---ANL 101

Query: 131 NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIV 190
           +  G    +  G  S A   N  I   VT +L NGNL++SG +++ +N     +  +G+V
Sbjct: 102 SAQGANKFASTGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGVV 161

Query: 191 RPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            P  +   NSV   ++A+A+I Y  KG   E        +   N++P
Sbjct: 162 NPNTISGQNSVYSTQVADAKIEYSAKGYINEAETMGWLQRFFLNIAP 208


>gi|323158100|gb|EFZ44199.1| flagellar L-ring family protein [Escherichia coli EPECa14]
          Length = 221

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 47/195 (24%), Positives = 83/195 (42%), Gaps = 7/195 (3%)

Query: 46  FLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR 104
                     +  ++  ++   +  +L  D RA  VGDILTV +    Q+    +T   +
Sbjct: 32  APPKTEAPPPADGRAGGVFETGYNWSLTADRRAYRVGDILTVILEESTQSSKQAKTNFGK 91

Query: 105 NNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN 164
           +N++       FS       +   + + D      G  +  +   L   I   V A+  N
Sbjct: 92  SNTVDIGAPTIFS-----HTKDKLSGSIDANRDFDGSATSQQQNSLRGEITVSVHAVQPN 146

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           G L I G + + +N     + ++G+VR  D+   NSVS  +IA+A ISY G+G  ++   
Sbjct: 147 GILEIRGEKWLTLNQGDEYIRLSGLVRADDIQNDNSVSSQRIADACISYAGRGALSDANA 206

Query: 225 PPIGHQLIEN-LSPL 238
                +L  + L P+
Sbjct: 207 AGWLTRLFNHPLFPI 221


>gi|309779450|ref|ZP_07674211.1| flagellar L-ring protein FlgH [Ralstonia sp. 5_7_47FAA]
 gi|308921691|gb|EFP67327.1| flagellar L-ring protein FlgH [Ralstonia sp. 5_7_47FAA]
          Length = 232

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 48/227 (21%), Positives = 86/227 (37%), Gaps = 10/227 (4%)

Query: 11  YSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA 70
            + L   C         +P  +P+        R P   +  + S +  +  +        
Sbjct: 15  AALLATAC-------GMLPPPAPIVQG-PTTARPPMPVMAPRQSGAIYQEVASGSGGFRG 66

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           +F+D RA  VGD +T+ I  +  A        +R  SL   +     +       +   +
Sbjct: 67  MFEDRRAHMVGDTITIVITENTAASKQTSGSVNRTGSLTASVPTFAGMNPGVLSLL--GV 124

Query: 131 NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIV 190
           +         KG+          I   V  +L NGNL++SG ++  V     S+  +G+V
Sbjct: 125 SASDANKFDSKGANGAQNNFTATITVTVVEVLSNGNLVVSGEKQTAVGQGTESVKFSGVV 184

Query: 191 RPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            P  V+  N+V   ++A+AR+ Y G G   E  +     +    +SP
Sbjct: 185 NPTTVNNQNTVLSTQVADARMEYRGTGYVAESQQMGWLSRFFLTVSP 231


>gi|224373239|ref|YP_002607611.1| flagellar L-ring protein FlgH [Nautilia profundicola AmH]
 gi|223589417|gb|ACM93153.1| flagellar L-ring protein FlgH [Nautilia profundicola AmH]
          Length = 237

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 56/247 (22%), Positives = 101/247 (40%), Gaps = 21/247 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +Y            GC S   +    P ++       E            N       
Sbjct: 1   MKKYIIFGSLLVLFFTGCASHSMD----PTINMKPPKYVEQ------MPSQDNDFPQNNP 50

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS-----LHRKLSGG 115
            SL+ +    LF D++A+ V DI+TV I  + +         S  N+         +SGG
Sbjct: 51  GSLFTNG-DNLFSDTKAMKVNDIVTVIITEEVKQSTQASKKLSETNADNGGLFDATVSGG 109

Query: 116 FSLFGQQTPQMNGNLNYDG-----GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
            S+ G+        L+ +        +  G G+  R E     I+A +  +L+NGN  I 
Sbjct: 110 VSINGKDHTFGKTGLSLNFPSMNSNRSFQGSGTQQRNETFQTTISARIVKVLKNGNYFIM 169

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ 230
           G++E+ V+ + + + ++G++RPQD+ A N++    IA+A+I+Y  +G            +
Sbjct: 170 GTREIYVDGQKQLIQISGVIRPQDIAADNTIDSKYIADAKIAYKTEGDIKRYTEQNWFAK 229

Query: 231 LIENLSP 237
               ++P
Sbjct: 230 FWSAIAP 236


>gi|115353115|ref|YP_774954.1| flagellar basal body L-ring protein [Burkholderia ambifaria AMMD]
 gi|123128059|sp|Q0BB53|FLGH_BURCM RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|115283103|gb|ABI88620.1| flagellar L-ring protein [Burkholderia ambifaria AMMD]
          Length = 229

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 51/203 (25%), Positives = 85/203 (41%), Gaps = 6/203 (2%)

Query: 37  SLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQA 94
             D   + P          S +   S++   +    LF+D R  N+GDILT+ I  +  A
Sbjct: 30  PRDPIIQQPMTA-QPPMPMSMQAPGSIYNPGYAGRPLFEDQRPRNIGDILTIMIAENINA 88

Query: 95  VFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLI 154
              +    +R  +    +     L G        N++  G    +  G  S A   N  I
Sbjct: 89  TKSSGANTNRQGNTDFSVPTAGFLGGLFAK---ANMSAAGANKFAATGGASAANTFNGTI 145

Query: 155 AAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYG 214
              VT +L NGNL++SG +++ +N     +  +G+V P  +   NSV   ++A+A+I Y 
Sbjct: 146 TVTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGVVNPNTISGANSVYSTQVADAKIEYS 205

Query: 215 GKGRTTELLRPPIGHQLIENLSP 237
            KG   E        +   N++P
Sbjct: 206 SKGYINEAETMGWLQRFFLNIAP 228


>gi|134297195|ref|YP_001120930.1| flagellar basal body L-ring protein [Burkholderia vietnamiensis G4]
 gi|166214817|sp|A4JIJ2|FLGH_BURVG RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|134140352|gb|ABO56095.1| flagellar L-ring protein [Burkholderia vietnamiensis G4]
          Length = 229

 Score =  181 bits (460), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 54/203 (26%), Positives = 84/203 (41%), Gaps = 6/203 (2%)

Query: 37  SLDENNRMPFLGIDFKNSDSTKKSYSLWRDS--HAALFKDSRALNVGDILTVDIRIDDQA 94
             D   + P          + +   S++        LF+D R  NVGDILT+ I  +  A
Sbjct: 30  PRDPIIQQPMTA-QPPMPIAMQAPGSIFNPGFAGRPLFEDQRPRNVGDILTIVIAENINA 88

Query: 95  VFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLI 154
              +    +R  +    +     L G        NL+  G    +  G  S A   N  I
Sbjct: 89  TKSSGANTNRQGNTDFNVPTAAFLGGLFAK---ANLSATGANKFAATGGASAANTFNGTI 145

Query: 155 AAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYG 214
              VT +L NGNL++SG +++ +N     +  +G+V P  +   NSV   ++A+ARI Y 
Sbjct: 146 TVTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGVVNPNTISGANSVYSTQVADARIEYS 205

Query: 215 GKGRTTELLRPPIGHQLIENLSP 237
            KG   E        +   NL+P
Sbjct: 206 AKGYINEAETMGWLQRFFLNLAP 228


>gi|213026918|ref|ZP_03341365.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. 404ty]
          Length = 187

 Score =  181 bits (460), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 44/186 (23%), Positives = 81/186 (43%), Gaps = 6/186 (3%)

Query: 59  KSYSLWRD------SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL 112
            + S+++        +  LF+D R  N+GD LT+ ++ +  A   +    SR+       
Sbjct: 2   ANGSIFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGF 61

Query: 113 SGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
                           ++   GG + +GKG  + +   +  +   V  +L NGNL + G 
Sbjct: 62  DTVPRYLQGLFGNSRADMEASGGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGE 121

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           +++ +N     +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +  
Sbjct: 122 KQIAINQGTEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFF 181

Query: 233 ENLSPL 238
            NLSP+
Sbjct: 182 LNLSPM 187


>gi|269103187|ref|ZP_06155884.1| flagellar L-ring protein FlgH [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163085|gb|EEZ41581.1| flagellar L-ring protein FlgH [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 259

 Score =  181 bits (460), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 40/242 (16%), Positives = 85/242 (35%), Gaps = 24/242 (9%)

Query: 18  CHSSISEITGIPQ----------------------MSPMGSSLDENNRMPFLGIDFKNSD 55
           C S+        +                      +      +  +     +        
Sbjct: 19  CASTPDVPQSDIEKGTTTVDAVEGDQSESKGLIDKLRHREDPVAGDPAWGPVRPPVPAEH 78

Query: 56  STKKSYSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG 114
               + SL+  +H   L+ D+R  ++GDI+T+ +     A     +   ++  ++ K   
Sbjct: 79  YVAATGSLFNQTHVQDLYDDTRPHSIGDIVTILLEEKTAAKKSATSELDKSADMNMK-PI 137

Query: 115 GFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
                       + + ++      SG  +  ++  +   I+  V  IL NGNL+I G + 
Sbjct: 138 ALGGKPVTIHDYSLSYDFSNDNTFSGSSTADQSNSIKGSISVEVIDILANGNLVIRGEKW 197

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           + +N     + V+G +RP D+   N++   +I+ ARI Y G G   ++       +    
Sbjct: 198 LTLNSGDEFIRVSGHIRPDDISQDNTIPSTRISNARIQYSGTGDRQDVQDQNWLSRFFNV 257

Query: 235 LS 236
             
Sbjct: 258 AF 259


>gi|172061969|ref|YP_001809621.1| flagellar basal body L-ring protein [Burkholderia ambifaria MC40-6]
 gi|226701913|sp|B1YPA0|FLGH_BURA4 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|171994486|gb|ACB65405.1| flagellar L-ring protein [Burkholderia ambifaria MC40-6]
          Length = 229

 Score =  181 bits (459), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 53/203 (26%), Positives = 85/203 (41%), Gaps = 6/203 (2%)

Query: 37  SLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQA 94
             D   + P          S +   S++   +    LF+D R  NVGDILT+ I  +  A
Sbjct: 30  PRDPIIQQPMTA-QPPMPMSMQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIMIAENINA 88

Query: 95  VFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLI 154
              +    +R  +    +     L G        N++  G    +  G  S A   N  I
Sbjct: 89  TKSSGANTNRQGNTDFSVPTAGFLGGLFAK---ANMSAAGANKFAATGGASAANTFNGTI 145

Query: 155 AAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYG 214
              VT +L NGNL++SG +++ +N     +  +G+V P  +   NSV   ++A+A+I Y 
Sbjct: 146 TVTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGVVNPNTISGANSVYSTQVADAKIEYS 205

Query: 215 GKGRTTELLRPPIGHQLIENLSP 237
            KG   E        +   NL+P
Sbjct: 206 SKGYINEAETMGWLQRFFLNLAP 228


>gi|332187866|ref|ZP_08389599.1| flagellar L-ring family protein [Sphingomonas sp. S17]
 gi|332012027|gb|EGI54099.1| flagellar L-ring family protein [Sphingomonas sp. S17]
          Length = 231

 Score =  181 bits (459), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 49/233 (21%), Positives = 89/233 (38%), Gaps = 15/233 (6%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR- 65
           +VL  + L               Q S  G      +      +          + S+++ 
Sbjct: 11  LVLALAVLATA----------PAQASLFGKKKPAEDFTTTRPLPVAAQPVAPANGSIFQA 60

Query: 66  -DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP 124
            D +AAL++  RA  VGD LT+ +     A     +       L         L      
Sbjct: 61  ADGYAALYEGWRARRVGDPLTIVLVERTAASKSANSKLGSKGDLGINPPTTGPLGSLL-- 118

Query: 125 QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
             + ++   G    +G G+  ++  L+  I+  V  +  NG +++ G + V +N     +
Sbjct: 119 -KSTDIGMGGSRNFNGSGAADQSNSLSGEISVTVAQVFPNGTMLVQGQKRVTLNRGDEFI 177

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            + G+VR  DV   N V   ++A+A+I+Y GKG      R     +  + +SP
Sbjct: 178 QIKGLVRMADVGIDNRVPSTRVADAQIAYTGKGDVARASRQGWLSRFFQAVSP 230


>gi|317492425|ref|ZP_07950854.1| flagellar L-ring protein [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316919764|gb|EFV41094.1| flagellar L-ring protein [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 250

 Score =  181 bits (459), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 48/184 (26%), Positives = 80/184 (43%), Gaps = 6/184 (3%)

Query: 60  SYSLWRD------SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS 113
           + S+++        +  LF+D R  NVGD LT+ ++ +  A   +    SRN     +++
Sbjct: 66  NGSIFQSVQPMNYGYQPLFEDRRPRNVGDTLTISLQENVSASKSSSANASRNGKSSFEVA 125

Query: 114 GGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                          ++N  G     GKG  +     N  I   V  +L NGNL + G +
Sbjct: 126 TAPRYLEGLLGNARADMNMSGDNEFGGKGGANANNTFNGTITVTVAEVLANGNLKVVGEK 185

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           ++ +N     +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +   
Sbjct: 186 QIAINQGTEFIRFSGVVNPRTISGSNSVVSTQVADARIEYVGSGYINEAQNMGWLQRFFL 245

Query: 234 NLSP 237
           NLSP
Sbjct: 246 NLSP 249


>gi|323498417|ref|ZP_08103413.1| flagellar basal body L-ring protein [Vibrio sinaloensis DSM 21326]
 gi|323316490|gb|EGA69505.1| flagellar basal body L-ring protein [Vibrio sinaloensis DSM 21326]
          Length = 260

 Score =  181 bits (459), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 44/215 (20%), Positives = 87/215 (40%), Gaps = 12/215 (5%)

Query: 20  SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALN 79
                + G P  +P+       +     G  F  S S+             L+ DS+   
Sbjct: 56  GRNDPVAGDPAWAPIHPKHKPEHYAAETGSLFSASQSSS------------LYDDSKPRG 103

Query: 80  VGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASS 139
           +GDI+TV +  + +A        S+ N    +         +     N + + +     +
Sbjct: 104 IGDIITVTLDENTKAAKSANADMSKTNDSSMEPLFVGGQELKVGGDYNFSYDLNNTNTFA 163

Query: 140 GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHN 199
           G  S +++  L+  I   V  +L NGNL+I G + + +N     + ++G +RP D+   N
Sbjct: 164 GDASANQSNSLSGSITVEVIEVLGNGNLVIRGEKWLTLNTGDEYIRLSGTIRPDDISFDN 223

Query: 200 SVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           +++ ++++ ARI Y G G   ++  P    +    
Sbjct: 224 TIASNRVSNARIRYSGTGNQQDMQEPGFLARFFNV 258


>gi|167579491|ref|ZP_02372365.1| flagellar basal body L-ring protein [Burkholderia thailandensis
           TXDOH]
          Length = 220

 Score =  181 bits (459), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 52/202 (25%), Positives = 84/202 (41%), Gaps = 5/202 (2%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAV 95
             E      +        + +   S++   +    LF+D R  NVGDILT+ I  +  A 
Sbjct: 21  PREPITQQPMSAMPPMPPAMQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINAT 80

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
             +    +R  +    +     L G        NL+  G    +  G  S A   N  I 
Sbjct: 81  KSSGANTNRQGNTSFDVPTAGFLGGLFNK---ANLSAQGANKFAATGGASAANTFNGTIT 137

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             VT +L NGNL++SG +++ +N     +  +G+V P  +   NSV   ++A+ARI Y  
Sbjct: 138 VTVTNVLPNGNLVVSGQKQMLINQGNEFVRFSGVVNPNTISGQNSVYSTQVADARIEYSA 197

Query: 216 KGRTTELLRPPIGHQLIENLSP 237
           KG   E        +   N++P
Sbjct: 198 KGYINEAETMGWLQRFFLNIAP 219


>gi|260853469|ref|YP_003227360.1| putative lateral flagellar protein of basal-body outer-membrane L
           ring [Escherichia coli O26:H11 str. 11368]
 gi|257752118|dbj|BAI23620.1| predicted lateral flagellar protein of basal-body outer-membrane L
           ring [Escherichia coli O26:H11 str. 11368]
          Length = 246

 Score =  181 bits (459), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 47/195 (24%), Positives = 83/195 (42%), Gaps = 7/195 (3%)

Query: 46  FLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR 104
                     +  ++  ++   +  +L  D RA  VGDILTV +    Q+    +T   +
Sbjct: 57  APPKTEAPPPADGRAGGVFETGYNWSLTADRRAYRVGDILTVILEESTQSSKQAKTNFGK 116

Query: 105 NNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN 164
           +N++       FS       +   + + D      G  +  +   L   I   V A+  N
Sbjct: 117 SNTVDIGAPTIFS-----HTKDKLSGSIDANRDFDGSATSQQQNSLRGEITVSVHAVQPN 171

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           G L I G + + +N     + ++G+VR  D+   NSVS  +IA+A ISY G+G  ++   
Sbjct: 172 GILEIRGEKWLTLNQGDEYIRLSGLVRADDIQNDNSVSSQRIADACISYAGRGALSDANA 231

Query: 225 PPIGHQLIEN-LSPL 238
                +L  + L P+
Sbjct: 232 AGWLTRLFNHPLFPI 246


>gi|149927801|ref|ZP_01916052.1| Flagellar L-ring protein [Limnobacter sp. MED105]
 gi|149823423|gb|EDM82654.1| Flagellar L-ring protein [Limnobacter sp. MED105]
          Length = 201

 Score =  181 bits (459), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 51/182 (28%), Positives = 79/182 (43%), Gaps = 2/182 (1%)

Query: 57  TKKSYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG 115
              + SL+  + +  LF+D RA  +GD LT+ I     A   N    SR++S    +   
Sbjct: 20  AAPTGSLYSPATYRPLFEDQRARFLGDTLTIQIIEQINAAQTNSMSASRSDSASIDVPLI 79

Query: 116 FSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
              FG +  +     +       SG+GS   A  L   I   V ++L NGNL + G +++
Sbjct: 80  QGFFGSRDLRAING-SASSDKDFSGEGSSRAANTLTGSITVTVASVLPNGNLQVVGEKQI 138

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
             N E+  L  +G+V P  +   N V   K+A+ARI Y GKG            +    +
Sbjct: 139 GTNREVEYLKFSGVVNPITILPGNVVPSTKVADARIEYRGKGALDSATAMGWLSRFFLTV 198

Query: 236 SP 237
            P
Sbjct: 199 LP 200


>gi|170703099|ref|ZP_02893919.1| flagellar L-ring protein [Burkholderia ambifaria IOP40-10]
 gi|170131996|gb|EDT00504.1| flagellar L-ring protein [Burkholderia ambifaria IOP40-10]
          Length = 229

 Score =  181 bits (458), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 52/203 (25%), Positives = 85/203 (41%), Gaps = 6/203 (2%)

Query: 37  SLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQA 94
             D   + P          S +   S++   +    LF+D R  N+GDILT+ I  +  A
Sbjct: 30  PRDPIIQQPMTA-QPPMPMSMQAPGSIYNPGYAGRPLFEDQRPRNIGDILTIMIAENINA 88

Query: 95  VFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLI 154
              +    +R  +    +     L G        N++  G    +  G  S A   N  I
Sbjct: 89  TKSSGANTNRQGNTDFSVPTAGFLGGLFAK---ANMSAAGANKFAATGGASAANTFNGTI 145

Query: 155 AAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYG 214
              VT +L NGNL++SG +++ +N     +  +G+V P  +   NSV   ++A+A+I Y 
Sbjct: 146 TVTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGVVNPNTISGANSVYSTQVADAKIEYS 205

Query: 215 GKGRTTELLRPPIGHQLIENLSP 237
            KG   E        +   NL+P
Sbjct: 206 SKGYINEAETMGWLQRFFLNLAP 228


>gi|167900911|ref|ZP_02488116.1| flagellar basal body L-ring protein [Burkholderia pseudomallei NCTC
           13177]
          Length = 198

 Score =  181 bits (458), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 53/200 (26%), Positives = 84/200 (42%), Gaps = 5/200 (2%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAVFD 97
           E      +        + +   S++   +    LF+D R  NVGDILT+ I  +  A   
Sbjct: 1   EPITQQPMSAMPPMPPAMQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINATKS 60

Query: 98  NQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI 157
           +    +R  +    +     L G        NL+  G    +  G  S A   N  I   
Sbjct: 61  SGANTNRQGNTSFDVPTAGFLGGLFNK---ANLSAQGANKFAATGGASAANTFNGTITVT 117

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           VT +L NGNL++SG +++ +N     +  +GIV P  +   NSV   ++A+ARI Y  KG
Sbjct: 118 VTNVLPNGNLVVSGEKQMLINQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSAKG 177

Query: 218 RTTELLRPPIGHQLIENLSP 237
              E        +   N++P
Sbjct: 178 YINEAETMGWLQRFFLNIAP 197


>gi|119947174|ref|YP_944854.1| flagellar basal body L-ring protein [Psychromonas ingrahamii 37]
 gi|119865778|gb|ABM05255.1| flagellar L-ring protein [Psychromonas ingrahamii 37]
          Length = 232

 Score =  181 bits (458), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 52/200 (26%), Positives = 87/200 (43%), Gaps = 6/200 (3%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVF 96
               N   F       S    ++ SL++ + + +LF D RA +VGDIL V +  +  +  
Sbjct: 35  PPAPNDAAFAPPLLDYSQPKTRNGSLFKPTQSFSLFTDIRAYDVGDILMVYLNEETSSKK 94

Query: 97  DNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAA 156
              T   +++S         S         N + +  G    SG  S S+  KL+  I  
Sbjct: 95  AAGTEFGKSSSAEISAPTFGSSVLD-----NYSASVAGERDFSGSASSSQGNKLSGSITV 149

Query: 157 IVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGK 216
            V  +L NG L I G + + +N     + +TG VR +D+++ N++   +IA+ARI+Y GK
Sbjct: 150 TVYEVLPNGVLHIRGEKWITLNQGDEFIRLTGNVRVEDINSDNAIGSQRIADARITYSGK 209

Query: 217 GRTTELLRPPIGHQLIENLS 236
           G   +        Q   +  
Sbjct: 210 GALADSNAAGWLMQFFTSPW 229


>gi|206558971|ref|YP_002229731.1| flagellar basal body L-ring protein [Burkholderia cenocepacia
           J2315]
 gi|226701914|sp|B4E8L3|FLGH_BURCJ RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|198035008|emb|CAR50880.1| flagellar L-ring protein precursor (basal body L-ring protein)
           [Burkholderia cenocepacia J2315]
          Length = 229

 Score =  181 bits (458), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 52/203 (25%), Positives = 84/203 (41%), Gaps = 6/203 (2%)

Query: 37  SLDENNRMPFLGIDFKNSDSTKKSYSLWRDS--HAALFKDSRALNVGDILTVDIRIDDQA 94
             D   + P          S +   S++        LF+D R  N+GDILT+ I  +  A
Sbjct: 30  PRDPIIQQPMTA-QPPMPMSMQAPGSIYNPGFAGRPLFEDQRPRNIGDILTIMIAENINA 88

Query: 95  VFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLI 154
              +    +R  +    +     L G        NL+  G    +  G  S A   N  I
Sbjct: 89  TKSSGANTNRQGNTDFNVPTAGFLGGLFAK---ANLSATGANKFAATGGASAANTFNGTI 145

Query: 155 AAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYG 214
              VT +L NGNL++SG +++ +N     +  +G+V P  +   NSV   ++A+A+I Y 
Sbjct: 146 TVTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGVVNPNTISGANSVYSTQVADAKIEYS 205

Query: 215 GKGRTTELLRPPIGHQLIENLSP 237
            KG   E        +   N++P
Sbjct: 206 SKGYINEAETMGWLQRFFLNIAP 228


>gi|14548030|sp|P58205|FLGH_RHOSH RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|11095161|gb|AAG29750.1|AF205139_2 flagellar L-ring protein [Rhodobacter sphaeroides]
          Length = 222

 Score =  181 bits (458), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 55/222 (24%), Positives = 91/222 (40%), Gaps = 19/222 (8%)

Query: 18  CHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALF-KDSR 76
           C + + +                    P   ++      +  +  ++  +   LF  D R
Sbjct: 19  CSTYVEDRASE-------------AWAPVYPVEEAERLDSLPTGGIYSSTSRGLFVSDRR 65

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGG 136
           A  VGDI+TVD      A        SR +     L    +L        +G L+     
Sbjct: 66  AARVGDIVTVDFDEKFSASKSQSASGSRKSDYAIDLPDALTL-----GLDDGVLDNSTDQ 120

Query: 137 ASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVD 196
             SGKG+ S++  L   ++  VT +L  GNL I G + + +N+    + + G+VRP+D+ 
Sbjct: 121 GFSGKGAASQSNSLRGRMSVSVTRVLPGGNLEIMGQKLLTLNNGNEYVRLKGVVRPEDIG 180

Query: 197 AHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
             N V+ D+IA A I Y G G T +        + +  +SPL
Sbjct: 181 PDNVVTSDRIAHAEIKYIGAGDTADTANAGWLRRGLSVVSPL 222


>gi|167917167|ref|ZP_02504258.1| flagellar basal body L-ring protein [Burkholderia pseudomallei
           BCC215]
          Length = 201

 Score =  181 bits (458), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 53/202 (26%), Positives = 84/202 (41%), Gaps = 5/202 (2%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAV 95
             E      +        + +   S++   +    LF+D R  NVGDILT+ I  +  A 
Sbjct: 2   PREPITQQPMSAMPPMPPAMQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINAT 61

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
             +    +R  +    +     L G        NL+  G    +  G  S A   N  I 
Sbjct: 62  KSSGANTNRQGNTSFDVPTAGFLGGLFNK---ANLSAQGANKFAATGGASAANTFNGTIT 118

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             VT +L NGNL++SG +++ +N     +  +GIV P  +   NSV   ++A+ARI Y  
Sbjct: 119 VTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSA 178

Query: 216 KGRTTELLRPPIGHQLIENLSP 237
           KG   E        +   N++P
Sbjct: 179 KGYINEAETMGWLQRFFLNIAP 200


>gi|331645421|ref|ZP_08346525.1| flagellar L-ring protein FlgH [Escherichia coli M605]
 gi|331045583|gb|EGI17709.1| flagellar L-ring protein FlgH [Escherichia coli M605]
          Length = 246

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 47/181 (25%), Positives = 81/181 (44%), Gaps = 7/181 (3%)

Query: 60  SYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           +  ++   +  +L  D RA  VGDILTV +    Q+    +T   ++N++       F  
Sbjct: 71  AGGVFETGYNWSLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKSNTVDIGAPTIFG- 129

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                 +   + + D      G  +  +   L   I   V A+  NG L I G + + +N
Sbjct: 130 ----HTKDKLSGSIDANRDFDGSATSQQQNSLRGEITVSVHAVQPNGILEIRGEKWLTLN 185

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP 237
                + ++G+VR  D+   NSVS  +IA+ARISY G+G  ++        +L  + L P
Sbjct: 186 QGDEYIRLSGLVRADDIQNDNSVSSQRIADARISYAGRGALSDANAAGWLTRLFNHPLFP 245

Query: 238 L 238
           +
Sbjct: 246 I 246


>gi|167736706|ref|ZP_02409480.1| flagellar basal body L-ring protein [Burkholderia pseudomallei 14]
          Length = 179

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 52/181 (28%), Positives = 80/181 (44%), Gaps = 5/181 (2%)

Query: 59  KSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
              S++   +    LF+D R  NVGDILT+ I  +  A   +    +R  +    +    
Sbjct: 1   APGSIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAG 60

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            L G        NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ 
Sbjct: 61  FLGGLFNK---ANLSAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQML 117

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N     +  +GIV P  +   NSV   ++A+ARI Y  KG   E        +   N++
Sbjct: 118 INQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSAKGYINEAETMGWLQRFFLNIA 177

Query: 237 P 237
           P
Sbjct: 178 P 178


>gi|167843912|ref|ZP_02469420.1| flagellar basal body L-ring protein [Burkholderia pseudomallei
           B7210]
 gi|167909131|ref|ZP_02496222.1| flagellar basal body L-ring protein [Burkholderia pseudomallei 112]
          Length = 203

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 53/202 (26%), Positives = 84/202 (41%), Gaps = 5/202 (2%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAV 95
             E      +        + +   S++   +    LF+D R  NVGDILT+ I  +  A 
Sbjct: 4   PREPITQQPMSAMPPMPPAMQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINAT 63

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
             +    +R  +    +     L G        NL+  G    +  G  S A   N  I 
Sbjct: 64  KSSGANTNRQGNTSFDVPTAGFLGGLFNK---ANLSAQGANKFAATGGASAANTFNGTIT 120

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             VT +L NGNL++SG +++ +N     +  +GIV P  +   NSV   ++A+ARI Y  
Sbjct: 121 VTVTNVLPNGNLVVSGEKQMLINQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSA 180

Query: 216 KGRTTELLRPPIGHQLIENLSP 237
           KG   E        +   N++P
Sbjct: 181 KGYINEAETMGWLQRFFLNIAP 202


>gi|220917703|ref|YP_002493007.1| flagellar L-ring protein [Anaeromyxobacter dehalogenans 2CP-1]
 gi|254789276|sp|B8JD92|FLGH_ANAD2 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|219955557|gb|ACL65941.1| flagellar L-ring protein [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 229

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 54/204 (26%), Positives = 86/204 (42%), Gaps = 7/204 (3%)

Query: 36  SSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQ 93
           +      R   +            + S WR+  AA  L+ D+RAL   D++ V I     
Sbjct: 30  AGHVPKRRDYAVPDAAGQEAQVASAGSTWREGRAASMLYTDARALRENDLVVVRIEEIAD 89

Query: 94  AVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLL 153
           A     T  +R + L+  +    +            L         G GS +R E+L   
Sbjct: 90  AKRSADTDLTRRSELNASIEAFLTSL-----DTPYALKGGATTGFKGLGSTARTERLTAT 144

Query: 154 IAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISY 213
           + A+V  +L NGNL I G + V VN E +   ++G+VRP D+D  N V    +A+A I +
Sbjct: 145 VPAVVRKVLPNGNLFIEGHRVVLVNAEEQHFYISGVVRPIDIDQENGVKSSMVADAEIEF 204

Query: 214 GGKGRTTELLRPPIGHQLIENLSP 237
            G+G  ++  R     +L+    P
Sbjct: 205 TGRGVLSDNQRQGWLSRLLGWFWP 228


>gi|322832567|ref|YP_004212594.1| flagellar L-ring protein [Rahnella sp. Y9602]
 gi|321167768|gb|ADW73467.1| flagellar L-ring protein [Rahnella sp. Y9602]
          Length = 243

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 46/186 (24%), Positives = 81/186 (43%), Gaps = 6/186 (3%)

Query: 59  KSYSLWRD------SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL 112
            + S+++        +  LF+D R  NVGD LT+ ++ +  A   +    SRN +     
Sbjct: 58  PNGSIFQSVQPMNYGYQPLFEDRRPRNVGDTLTIVLQENVSASKSSSANASRNGATSFGA 117

Query: 113 SGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
           +               +L+  G    +GKG  +     +  +   V  +L NGNL + G 
Sbjct: 118 ATAPRYLEGLFGNARADLDMTGANTFAGKGGAAANNTFSGTLTVTVGEVLANGNLKVVGE 177

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           +++ +N     +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +  
Sbjct: 178 KQIEINQGTEFIRFSGVVNPRTISGSNAVISTQVADARIEYVGNGYINEAQNMGWLQRFF 237

Query: 233 ENLSPL 238
            NLSPL
Sbjct: 238 LNLSPL 243


>gi|307731360|ref|YP_003908584.1| flagellar L-ring protein [Burkholderia sp. CCGE1003]
 gi|307585895|gb|ADN59293.1| flagellar L-ring protein [Burkholderia sp. CCGE1003]
          Length = 232

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 49/200 (24%), Positives = 86/200 (43%), Gaps = 5/200 (2%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAVFD 97
           +      +          +   S++   +    LF+D R  NVGDILT+ I+ +  A   
Sbjct: 35  QPITQQPMTAMPPMPPQAQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIVIQENVNATKS 94

Query: 98  NQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI 157
           +    +RN +    +     L G        NL+ +G    +  G  + +   N  I   
Sbjct: 95  SGANVNRNGTTSFDVPTAGFLGGLFGK---ANLSANGANKFTAAGGANASNTFNGTITVT 151

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           VT +L NGNL++SG +++ +N     +  +G+V P  +   N+V   ++A+A+I Y  KG
Sbjct: 152 VTGVLPNGNLMVSGEKQMLINQGNEFVRFSGVVNPNTISNLNAVYSTQVADAKIEYSAKG 211

Query: 218 RTTELLRPPIGHQLIENLSP 237
              E        +   N+SP
Sbjct: 212 YVDEAQNLGWLQRFFLNVSP 231


>gi|167617588|ref|ZP_02386219.1| flagellar basal body L-ring protein [Burkholderia thailandensis
           Bt4]
          Length = 202

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 52/202 (25%), Positives = 84/202 (41%), Gaps = 5/202 (2%)

Query: 38  LDENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAV 95
             E      +        + +   S++   +    LF+D R  NVGDILT+ I  +  A 
Sbjct: 3   PREPITQQPMSAMPPMPPAMQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINAT 62

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
             +    +R  +    +     L G        NL+  G    +  G  S A   N  I 
Sbjct: 63  KSSGANTNRQGNTSFDVPTAGFLGGLFNK---ANLSAQGANKFAATGGASAANTFNGTIT 119

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             VT +L NGNL++SG +++ +N     +  +G+V P  +   NSV   ++A+ARI Y  
Sbjct: 120 VTVTNVLPNGNLVVSGQKQMLINQGNEFVRFSGVVNPNTISGQNSVYSTQVADARIEYSA 179

Query: 216 KGRTTELLRPPIGHQLIENLSP 237
           KG   E        +   N++P
Sbjct: 180 KGYINEAETMGWLQRFFLNIAP 201


>gi|242278486|ref|YP_002990615.1| flagellar basal body L-ring protein [Desulfovibrio salexigens DSM
           2638]
 gi|242121380|gb|ACS79076.1| flagellar L-ring protein [Desulfovibrio salexigens DSM 2638]
          Length = 232

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 47/246 (19%), Positives = 92/246 (37%), Gaps = 24/246 (9%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M + +   +   ++  GC              P+  +      M          +     
Sbjct: 1   MKKTTLATMLLLAICAGCS-------------PVKQAPTPMPVMTPPAQY--EPEPMNNP 45

Query: 61  YSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            SL+  S    LF D+RA  +GDI+ V +    +    + +   + N     ++   +  
Sbjct: 46  GSLFAASDSEYLFDDNRARRIGDIVVVTVSETSKGKHTSDSKAEKKNDTSLAVTNFSAGL 105

Query: 120 GQ--------QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
                             +        S  G       L   +A  V  IL    + + G
Sbjct: 106 ATAVDPFNMKGGAGDTPLIGSATSNKFSSTGETKNESTLTASVACRVVRILPGNVMQVEG 165

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           +++VR+NDE + L V G++R +D+   N+V+ + +A+A I   G+G   +  RP    ++
Sbjct: 166 ARQVRINDETQVLVVRGLLRHRDIGPSNTVASNYLADAHIEVYGRGILADKQRPGWLSRI 225

Query: 232 IENLSP 237
           ++N+ P
Sbjct: 226 LDNVWP 231


>gi|160896076|ref|YP_001561658.1| flagellar L-ring protein [Delftia acidovorans SPH-1]
 gi|160361660|gb|ABX33273.1| flagellar L-ring protein [Delftia acidovorans SPH-1]
          Length = 235

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 51/233 (21%), Positives = 95/233 (40%), Gaps = 15/233 (6%)

Query: 8   VLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD- 66
            L  +++L GC +                 +D  +  P +         +  + SL+   
Sbjct: 14  CLALAAVLSGCTTLND-----------PPPVDMPSTAPPVLPQPAPVAGSP-TGSLFNAA 61

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
           S+   F++ RA  VGD++TV I     A   + +G  R+N     +S      G     +
Sbjct: 62  SYRPGFENRRARLVGDLVTVQIVERVTASQKSDSGLKRSNKTTAGISALPLFSGNALANL 121

Query: 127 NG--NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
               N+ ++     +G GS S        I+  V  +L NG+L+I+G +++ VN  +  L
Sbjct: 122 KDRSNIGFNNNNDYTGSGSTSSDNTFTGAISTTVVDVLPNGHLVIAGEKQIGVNHNVDVL 181

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
             TG V P+ +   + V+  ++A  R+    +G+  E        +   N+ P
Sbjct: 182 RFTGTVDPRTMQPGSLVASTQVANVRVESRSRGQAGEAQSIGWLSRFFLNVMP 234


>gi|224825780|ref|ZP_03698884.1| flagellar L-ring protein [Lutiella nitroferrum 2002]
 gi|224602004|gb|EEG08183.1| flagellar L-ring protein [Lutiella nitroferrum 2002]
          Length = 215

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 48/198 (24%), Positives = 81/198 (40%), Gaps = 7/198 (3%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDN 98
              R  F       S +      ++    A +L  DSRA  VGD LTV +    QA    
Sbjct: 21  PPPRAEFEPPLPPKSAARGVGGGVYTAGGAWSLVTDSRAYRVGDALTVVLEETTQASKKA 80

Query: 99  QTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIV 158
                + +    + +         +  +N  +  D      G  S ++   L+  ++ IV
Sbjct: 81  GALLDKKSGASIQPTIL------GSKTINTKVGIDADRTFDGSSSSTQQNALSGALSVIV 134

Query: 159 TAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGR 218
             +L NG L++ G +++ +N     L + G VR  D+D  N VS  +IA ARI+Y G+G 
Sbjct: 135 HQVLPNGLLLVKGEKQLTLNQGEEYLQLAGYVRVDDIDTDNRVSSQRIANARIAYSGRGV 194

Query: 219 TTELLRPPIGHQLIENLS 236
            ++   P    +   +  
Sbjct: 195 LSDANAPGWLTRFFTSPW 212


>gi|307313516|ref|ZP_07593137.1| flagellar L-ring protein [Escherichia coli W]
 gi|306906684|gb|EFN37195.1| flagellar L-ring protein [Escherichia coli W]
 gi|315059545|gb|ADT73872.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli W]
 gi|323379896|gb|ADX52164.1| flagellar L-ring protein [Escherichia coli KO11]
          Length = 247

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 46/195 (23%), Positives = 82/195 (42%), Gaps = 7/195 (3%)

Query: 46  FLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR 104
                     +  ++  ++   +  +L  D RA  VGDILTV +    Q+    +T   +
Sbjct: 58  APPKTEAPPPADGRAGGVFETGYNWSLTADRRAYRVGDILTVILEESTQSSKQAKTNFGK 117

Query: 105 NNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN 164
           +N++       F        +   + + D      G  +  +   L   I   V A+  N
Sbjct: 118 SNTVDIGAPTIFG-----HTKDKLSGSIDANRDFDGSATSQQQNSLRGEITVSVHAVQPN 172

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           G L I G + + +N     + ++G+VR  D+   NSVS  +IA+ARISY  +G  ++   
Sbjct: 173 GILEIRGEKWLTLNQGDEYIRLSGLVRADDIQNDNSVSSQRIADARISYAVRGALSDANA 232

Query: 225 PPIGHQLIEN-LSPL 238
                +L  + L P+
Sbjct: 233 AGWLTRLFNHPLFPI 247


>gi|78776932|ref|YP_393247.1| flagellar basal body L-ring protein [Sulfurimonas denitrificans DSM
           1251]
 gi|110816546|sp|Q30SL9|FLGH_SULDN RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|78497472|gb|ABB44012.1| Flagellar L-ring protein [Sulfurimonas denitrificans DSM 1251]
          Length = 240

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 53/249 (21%), Positives = 106/249 (42%), Gaps = 22/249 (8%)

Query: 1   MYR---YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDST 57
           M R     F+ +     L GC +++S+        P     +            +++   
Sbjct: 1   MIRNFLLFFMPIYAILFLSGCTANLSD--PEIDFEPPAYVEE--------MPSKEDNKDF 50

Query: 58  KKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
               S++      LF D +A++V DI+TV I  + Q+        S ++SL+       S
Sbjct: 51  TSVGSVFGQGENPLFSDHKAMHVNDIVTVIISENTQSSNSGSKQISESDSLNLGGGAFTS 110

Query: 118 LF---------GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLI 168
                       +     N         A  G+GS ++       ++A +  +L+NGN  
Sbjct: 111 AGTNSAVNSAVSKLNGIANLGFGSTSDSAYKGQGSATKDASFTTTVSARIVKVLQNGNYF 170

Query: 169 ISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIG 228
           ISG +E+ V+++ + + + G++RP D+D  N ++  +++EA+I Y  +G          G
Sbjct: 171 ISGKREILVDNQKQIIQIGGVIRPYDIDQGNRINSSQMSEAKILYKTQGDVERATDRGWG 230

Query: 229 HQLIENLSP 237
            ++I+++ P
Sbjct: 231 TKIIQSVWP 239


>gi|289679020|ref|ZP_06499910.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           syringae FF5]
          Length = 185

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 45/184 (24%), Positives = 84/184 (45%), Gaps = 8/184 (4%)

Query: 61  YSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            ++++      L+ D +A  +GDI+T+ +     A     +  S+N++    L+  F   
Sbjct: 1   GAIYQAGFEQNLYGDRKAFRIGDIITITLSERMAASKAATSAMSKNSNNSIGLTSLFGSG 60

Query: 120 GQ-----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
                      ++ N  Y+G   + G G  +++  L   +   V  +L NG L + G + 
Sbjct: 61  LTTNNPIGGNDLSLNAGYNGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGILAVRGEKW 120

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           + +N     + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P    +    
Sbjct: 121 MTLNTGDELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGWFDRFF-- 178

Query: 235 LSPL 238
           LSPL
Sbjct: 179 LSPL 182


>gi|317153842|ref|YP_004121890.1| flagellar L-ring protein [Desulfovibrio aespoeensis Aspo-2]
 gi|316944093|gb|ADU63144.1| flagellar L-ring protein [Desulfovibrio aespoeensis Aspo-2]
          Length = 236

 Score =  179 bits (454), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 56/251 (22%), Positives = 108/251 (43%), Gaps = 30/251 (11%)

Query: 1   MYRYSFIVLCYSSLLF-----GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSD 55
           M RY  I +    L       GC +   E+  +P ++P                 ++  +
Sbjct: 1   MRRYFLIAVAAVMLASLVLTAGCANKYEEM-PMPVLTP---------------PVYEEQN 44

Query: 56  STKKSYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS- 113
                 SL+  + +  L+ D+RA  VGDI+ V +  +  +   ++T   R+NS    +S 
Sbjct: 45  PAANPGSLFDSNRSEFLYDDNRASRVGDIVLVQVAEESNSRIKSETKAKRDNSNTLSVSA 104

Query: 114 -------GGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGN 166
                  G   L G    ++  +L+          G   +  +   ++A  +   L    
Sbjct: 105 MPETGLIGNLPLAGTLGAKVGTSLDTSTVSDLKSNGETKQESEFEAIVATRIVRKLPGNL 164

Query: 167 LIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPP 226
           L + G++ +RVN+E + L V G++R +D+ + N++    +AEA+I   G+G   +  RP 
Sbjct: 165 LQVEGARRIRVNNETQFLVVRGLIRQRDISSSNTIPSTSLAEAQIEIFGQGVLADKQRPG 224

Query: 227 IGHQLIENLSP 237
              ++I+N+ P
Sbjct: 225 WLSRIIDNIYP 235


>gi|74317649|ref|YP_315389.1| flagellar L-ring protein FlgH [Thiobacillus denitrificans ATCC
           25259]
 gi|110816545|sp|Q3SIE4|FLGH_THIDA RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|74057144|gb|AAZ97584.1| flagellar L-ring protein precursor FlgH [Thiobacillus denitrificans
           ATCC 25259]
          Length = 222

 Score =  179 bits (454), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 40/205 (19%), Positives = 94/205 (45%), Gaps = 3/205 (1%)

Query: 35  GSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQ 93
           G++       P        +     + ++++ + +  LF+D RA +VGD+LT+ I    +
Sbjct: 20  GTTPSTIVERPTTARPQAPAAVPATNGAIYQAATYRPLFEDRRARHVGDVLTIVINERTR 79

Query: 94  AVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLL 153
           A  +  +  S+ +++   + G   L  +    +   +N +       + ++  +   +  
Sbjct: 80  AGKEASSSASKTSAVDASVGGVAKLPLKMFQGL--GINAEASAEYEDESALDSSNTFSGN 137

Query: 154 IAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISY 213
           +   V  +L NGNL+++G +++ ++     + ++G+V+P  + A N+VS  K+A+ARI Y
Sbjct: 138 VTVTVIEVLPNGNLVVAGEKQIGLDKGTEYIRLSGVVQPDTIQAGNTVSSAKVADARIEY 197

Query: 214 GGKGRTTELLRPPIGHQLIENLSPL 238
               +  +        +   +  PL
Sbjct: 198 RSSAKFDKAEVMNWLGRFFLSFIPL 222


>gi|323527710|ref|YP_004229863.1| flagellar L-ring protein [Burkholderia sp. CCGE1001]
 gi|323384712|gb|ADX56803.1| flagellar L-ring protein [Burkholderia sp. CCGE1001]
          Length = 232

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 49/200 (24%), Positives = 86/200 (43%), Gaps = 5/200 (2%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAVFD 97
           +      +          +   S++   +    LF+D R  NVGDILT+ I+ +  A   
Sbjct: 35  QPITQQPMTAMPPMPPQAQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIVIQENVNATKS 94

Query: 98  NQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI 157
           +  G +R+ +    +     L G        NL+  G    +  G  + +   N  I   
Sbjct: 95  SGAGVNRSGNTSFDVPTAGFLGGLFGK---ANLSASGANKFASTGGANASNTFNGTITVT 151

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           VT +L NGNL++SG +++ +N     +  +G+V P  +   N+V   ++A+A+I Y  KG
Sbjct: 152 VTGVLPNGNLMVSGEKQMLINQGNEFVRFSGVVNPNTISNLNAVYSTQVADAKIEYSAKG 211

Query: 218 RTTELLRPPIGHQLIENLSP 237
              E        +   N+SP
Sbjct: 212 YVDEAENMGWLQRFFLNVSP 231


>gi|84514830|ref|ZP_01002193.1| Flagellar L-ring protein [Loktanella vestfoldensis SKA53]
 gi|84510989|gb|EAQ07443.1| Flagellar L-ring protein [Loktanella vestfoldensis SKA53]
          Length = 215

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 51/236 (21%), Positives = 96/236 (40%), Gaps = 25/236 (10%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M+ +  +     S+L GC + + +     Q  P+      N              S   +
Sbjct: 1   MFIFRVLTPFALSILAGCSTYVEDEASA-QFQPVLPDSTYN--------------SGPSN 45

Query: 61  YSLWRDSHAALFK-DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            S++    + LF  + RA  VGD+LTV +    QA         ++++    L    S  
Sbjct: 46  GSIYHPGVSGLFAVEQRASKVGDVLTVALNESFQATKSQTATADKSDTTTANLPRFIS-- 103

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                    +  +    + +G G+  ++     L+   V  +  NGNL I G +++ +N 
Sbjct: 104 -------PNDPEFGMTQSFAGSGAAEQSNTFTGLVTVSVVRVFPNGNLQILGQKKLTLNS 156

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
               + V+GIVR  D+   N VS +++A A I+Y G G   +  +  +  + + +L
Sbjct: 157 GDEYVRVSGIVRRSDISPANIVSSNRLANAEITYTGAGDIADTAKRGLFSRAVSSL 212


>gi|330501140|ref|YP_004378009.1| flagellar basal body L-ring protein [Pseudomonas mendocina NK-01]
 gi|328915426|gb|AEB56257.1| flagellar basal body L-ring protein [Pseudomonas mendocina NK-01]
          Length = 223

 Score =  179 bits (453), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 54/225 (24%), Positives = 86/225 (38%), Gaps = 20/225 (8%)

Query: 16  FGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALFKD 74
            GC S           + M    D ++  P        S        L+R  ++ +L  D
Sbjct: 17  GGCAS----------FNEMLPDEDSSHYEPLAL---DYSVPPTTGGGLFRSGYSGSLIGD 63

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
            RA+ VGDILTV +    Q+     T   +  +    +         +        +   
Sbjct: 64  KRAVRVGDILTVVLDESTQSSKSAGTSFGKTANAAIGIPTVLGKTYDRL-----ESSASA 118

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
               +G    S+   L   IA  V  +L NG L+I G + +R+N     + + G+VR  D
Sbjct: 119 ERDFNGSARSSQQNTLRGSIAVTVHQVLPNGTLLIKGEKALRLNQGDEYIRLVGLVRMDD 178

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSPL 238
           ++  N VS   +A ARISY G+G   +        +   + L PL
Sbjct: 179 INRANQVSSQNVANARISYAGRGVLNDSNSAGWLTRFFTSPLFPL 223


>gi|188576759|ref|YP_001913688.1| flagellar basal body L-ring protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188576951|ref|YP_001913880.1| flagellar basal body L-ring protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188521211|gb|ACD59156.1| flagellar L-ring protein FlgH [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188521403|gb|ACD59348.1| flagellar L-ring protein FlgH [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 207

 Score =  179 bits (453), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 47/206 (22%), Positives = 83/206 (40%), Gaps = 2/206 (0%)

Query: 34  MGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDD 92
           M +            +          + +++       L+ D RA +VGD+LT+ +    
Sbjct: 1   MAAGDVRPYAAMAPIVPVVAPTVQPTAGAIYAAGPGLNLYGDRRARDVGDLLTITLIEST 60

Query: 93  QAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNL 152
            A     T  S+ ++                          G  A  GKG+ +++ ++  
Sbjct: 61  TASSSANTSTSKKDATTMASPTLLGAPLTVAGLDVLQNTLKGDRAFDGKGNTAQSNRMQG 120

Query: 153 LIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARIS 212
            +   V   L NGNL++ G + +R+N     + V GIVR  D+   N++   K+AEARI+
Sbjct: 121 SVTVTVIQRLPNGNLVVQGQKNLRLNQGDELVQVQGIVRDADIAPDNTIPSSKVAEARIA 180

Query: 213 YGGKGRTTELLRPPIGHQLIEN-LSP 237
           YGG+G   +        +   + LSP
Sbjct: 181 YGGRGAIAQSNAMGWLSRFFNSRLSP 206


>gi|241761148|ref|ZP_04759237.1| flagellar L-ring protein [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|260752889|ref|YP_003225782.1| flagellar L-ring protein [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|241374767|gb|EER64228.1| flagellar L-ring protein [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|258552252|gb|ACV75198.1| flagellar L-ring protein [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 228

 Score =  179 bits (453), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 44/241 (18%), Positives = 87/241 (36%), Gaps = 23/241 (9%)

Query: 2   YRYSFIVLCYSSLLFGCH---SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
            + SF  +  +  +       +        P  +           +P             
Sbjct: 5   MKPSFSAMLIAVAVLAVSPLHARKKVTQPDPNFAATYPDDPRPEVVP------------- 51

Query: 59  KSYSLWRD--SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
            + ++++    +  +   +RA +VGD++T+ +     A     T  SR+           
Sbjct: 52  -NGAIFQPSYGYMPIISGARASHVGDMVTITLVESFAASKSANTTTSRSGGASIIPPTT- 109

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
              G  +     +          G G+  ++  L+  I A V  +  +G ++I G + + 
Sbjct: 110 ---GPLSFFKATDATASSSHNFKGTGTTGQSNSLSGEITATVARVFPDGTMLIRGEKIMT 166

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N     + ++G+VRP D+D  N V   +I +ARISY G G      R        + +S
Sbjct: 167 INRGDEHIRISGLVRPWDIDGTNHVLSTRIGDARISYTGTGDVARASRMGWLGHFFQMIS 226

Query: 237 P 237
           P
Sbjct: 227 P 227


>gi|319764542|ref|YP_004128479.1| flagellar l-ring protein [Alicycliphilus denitrificans BC]
 gi|330826758|ref|YP_004390061.1| flagellar L-ring protein [Alicycliphilus denitrificans K601]
 gi|317119103|gb|ADV01592.1| flagellar L-ring protein [Alicycliphilus denitrificans BC]
 gi|329312130|gb|AEB86545.1| flagellar L-ring protein [Alicycliphilus denitrificans K601]
          Length = 227

 Score =  179 bits (453), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 45/223 (20%), Positives = 91/223 (40%), Gaps = 15/223 (6%)

Query: 16  FGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW-RDSHAALFKD 74
            GC +                   +        +      +   + SL+   S+   F+D
Sbjct: 18  TGCATLNP------------PPPVDLLPTAPPPVAATPRPTGPATGSLFHAASYRPAFED 65

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
            RA  VGDI+T+ I     A  ++ +   R+ +    +S    +   +  ++  +L    
Sbjct: 66  RRARMVGDIVTIQIVEQVTAKQNSTSSIDRSANTSAGISAFPFIGAGKLGKL--DLGAKS 123

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
               SGKG    +      I A V  +L NG+L+++G +++ VN+ +  L  +G V P+ 
Sbjct: 124 ANQFSGKGGTESSNTFTGTITATVIEVLPNGHLVVAGEKQIGVNENVDVLRFSGTVDPRS 183

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +   + V+  ++A AR+   G+G  +E        +   +++P
Sbjct: 184 LQPGSVVASTQVANARLQSRGRGAQSEAQAMGWLSRAFNSVAP 226


>gi|86157775|ref|YP_464560.1| flagellar L-ring protein [Anaeromyxobacter dehalogenans 2CP-C]
 gi|110816523|sp|Q2IQP0|FLGH_ANADE RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|85774286|gb|ABC81123.1| flagellar L-ring protein [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 229

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 54/204 (26%), Positives = 86/204 (42%), Gaps = 7/204 (3%)

Query: 36  SSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQ 93
           +      R   +            + S WR+  AA  L+ D+RAL   D++ V I     
Sbjct: 30  AGYVPKRRDYAVPDASGQDTQAASAGSTWREGRAASMLYTDARALRENDLVVVRIEEIAD 89

Query: 94  AVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLL 153
           A     T  +R + L+  +    +            L         G GS +R E+L   
Sbjct: 90  AKRSADTDLTRRSELNASIEAFLTSLST-----PYALKGGADSGFKGLGSTARTERLTAT 144

Query: 154 IAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISY 213
           + A+V  +L NGNL I G + V VN E +   ++G+VRP D+D  N V    +A+A I +
Sbjct: 145 VPAVVRKVLPNGNLFIEGHRVVLVNAEEQHFYISGVVRPIDIDQENGVKSSMVADAEIEF 204

Query: 214 GGKGRTTELLRPPIGHQLIENLSP 237
            G+G  ++  R     +L+    P
Sbjct: 205 TGRGVLSDNQRQGWLSRLLGWFWP 228


>gi|311087757|gb|ADP67836.1| flagellar basal body L-ring protein [Buchnera aphidicola str. JF98
           (Acyrthosiphon pisum)]
          Length = 254

 Score =  178 bits (452), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 52/242 (21%), Positives = 98/242 (40%), Gaps = 26/242 (10%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
           +  ++   +   +  C S         +  P+ +                N      + S
Sbjct: 9   KKYYLTAIFLLTIQSCASV--------EYKPLVTGATT--------AIAPNIWPKVVNGS 52

Query: 63  LWRD------SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
           L+++       +  LF+D R  N+GD +TV ++ +  A   + +  SR+ S +  L    
Sbjct: 53  LFQEKIPINYGYQPLFEDHRPHNIGDTITVVLQENISASNSSISNMSRDGSANFGLKIAP 112

Query: 117 SLFGQQTP----QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
                           +L+  G    SGKGS S   K   LI   V  +L NGNL + G 
Sbjct: 113 GQLNNILGVNFQDNTTSLDSFGRNNFSGKGSNSANNKFTGLITVTVKRVLPNGNLKVIGE 172

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           ++V +N     +  +G++ P +++ +N +S  +IA+ARI Y   G   ++ +     +L+
Sbjct: 173 KQVSINKGTEFIRFSGVINPTNINKNNFISSTQIADARIEYLSHGGLDDVQKMGWLQKLL 232

Query: 233 EN 234
             
Sbjct: 233 LK 234


>gi|295678055|ref|YP_003606579.1| flagellar L-ring protein [Burkholderia sp. CCGE1002]
 gi|295437898|gb|ADG17068.1| flagellar L-ring protein [Burkholderia sp. CCGE1002]
          Length = 215

 Score =  178 bits (452), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 55/231 (23%), Positives = 93/231 (40%), Gaps = 21/231 (9%)

Query: 9   LCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH 68
           L   + L GC            + P      +                 +   S++   +
Sbjct: 3   LTLLAALGGCA-----------LVPKQPITQQPMTA-----LPPVPPQAQAPGSIYNPGY 46

Query: 69  --AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
               LF+D R  NVGDI+T+ I  +  A  ++    SRN S +  +     L G      
Sbjct: 47  AGRPLFEDQRPRNVGDIITIVIAENINATKNSGANASRNGSTNLSVPTAGFLSGLFAK-- 104

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             NL+  G    +G G  + +   N  I   VT +  NGNLI+SG +++ +N     +  
Sbjct: 105 -TNLSAAGANGFAGTGGANASNTFNGTITVTVTGVQANGNLIVSGEKQMLINQGNEFVRF 163

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +G+V P  + + N+V   ++A+A+I Y  KG   E        +   N++P
Sbjct: 164 SGVVNPNTISSLNAVYSTQVADAKIEYSAKGYINEAETMGWLQRFFLNVAP 214


>gi|209521592|ref|ZP_03270290.1| flagellar L-ring protein [Burkholderia sp. H160]
 gi|209497975|gb|EDZ98132.1| flagellar L-ring protein [Burkholderia sp. H160]
          Length = 233

 Score =  178 bits (452), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 49/200 (24%), Positives = 85/200 (42%), Gaps = 5/200 (2%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAVFD 97
           +      +          +   S++   +    LF+D R  NVGDI+T+ I  +  A   
Sbjct: 36  QPITQQPMTALPPIPPQAQAPGSIYNPGYAGRPLFEDQRPRNVGDIITIVIAENINATKS 95

Query: 98  NQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI 157
           +    +RN S    +     L G        NL+  G    +G G  + +   N  I   
Sbjct: 96  SGANANRNGSTKFDVPTAGFLGGLFAK---TNLSATGTNGFAGTGGANASNTFNGTITVT 152

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           VT +  NGNLI+SG +++ +N     +  +G+V P  + + N+V   ++A+A+I Y  KG
Sbjct: 153 VTGVQPNGNLIVSGEKQMLINQGNEFVRFSGVVNPNTISSLNAVYSTQVADAKIEYSAKG 212

Query: 218 RTTELLRPPIGHQLIENLSP 237
              E        +   N++P
Sbjct: 213 YIDEAENMGWLQRFFLNVAP 232


>gi|283856290|ref|YP_162343.2| flagellar L-ring protein [Zymomonas mobilis subsp. mobilis ZM4]
 gi|292495079|sp|Q9Z5T8|FLGH_ZYMMO RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|283775286|gb|AAV89232.2| flagellar L-ring protein [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 228

 Score =  178 bits (451), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 44/241 (18%), Positives = 87/241 (36%), Gaps = 23/241 (9%)

Query: 2   YRYSFIVLCYSSLLFGCH---SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
            + SF  +  +  +       +        P  +           +P             
Sbjct: 5   MKPSFSAMLIAVTVLAVSPLHARKKVTQPDPNFAATYPDDPRPEVVP------------- 51

Query: 59  KSYSLWRD--SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
            + ++++    +  +   +RA +VGD++T+ +     A     T  SR+           
Sbjct: 52  -NGAIFQPSYGYMPIISGARASHVGDMVTITLVESFAASKSANTTTSRSGGASIIPPTT- 109

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
              G  +     +          G G+  ++  L+  I A V  +  +G ++I G + + 
Sbjct: 110 ---GPLSFFKATDATASSSHNFKGTGTTGQSNSLSGEITATVARVFPDGTMLIRGEKIMT 166

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N     + ++G+VRP D+D  N V   +I +ARISY G G      R        + +S
Sbjct: 167 INRGDEHIRISGLVRPWDIDGTNHVLSTRIGDARISYTGTGDVARASRMGWLGHFFQMIS 226

Query: 237 P 237
           P
Sbjct: 227 P 227


>gi|308186396|ref|YP_003930527.1| Flagellar L-ring protein precursor [Pantoea vagans C9-1]
 gi|308056906|gb|ADO09078.1| Flagellar L-ring protein precursor [Pantoea vagans C9-1]
          Length = 195

 Score =  178 bits (451), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 50/194 (25%), Positives = 85/194 (43%), Gaps = 8/194 (4%)

Query: 53  NSDSTKKSYSLWRD------SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNN 106
            S     + S+++        +  LF+D R  N+GD LT+ ++ +  A   +    SR+ 
Sbjct: 2   PSAPPVVNGSIFQGVAPLNYGYQPLFEDRRPRNIGDTLTITLQENVSASKSSSASASRDG 61

Query: 107 SLHRKLSGGFSLFGQQTPQMN--GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN 164
           S    +SG  +             NL+ +G    +GKG  S        I   V  +L N
Sbjct: 62  SNSFGVSGVPTGLAGLVGAGGEKANLSAEGKNDFAGKGGASANNTFTGTITVTVDQVLSN 121

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           GNL + G +++ +N     +  +G+V P+ + A N+V    +A+ARI Y G G   E   
Sbjct: 122 GNLHVVGEKQIAINQGTEFIRFSGVVNPRTISASNAVLSTAVADARIEYVGNGYINEAQT 181

Query: 225 PPIGHQLIENLSPL 238
                +   N+SP+
Sbjct: 182 MGWFQRFFLNISPM 195


>gi|307721385|ref|YP_003892525.1| flagellar L-ring protein [Sulfurimonas autotrophica DSM 16294]
 gi|306979478|gb|ADN09513.1| flagellar L-ring protein [Sulfurimonas autotrophica DSM 16294]
          Length = 240

 Score =  178 bits (451), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 53/249 (21%), Positives = 112/249 (44%), Gaps = 22/249 (8%)

Query: 1   MYRY---SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDST 57
           M +    +FI+L    +  GC +++++    P+++    +  E           ++    
Sbjct: 1   MNKIKLTTFILLLSVVVFSGCTANLTD----PEINFEPPAYVEQ------MPAKEDQQDF 50

Query: 58  KKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
             + S++      LF D +A++V DI+TV I    ++        S N++         S
Sbjct: 51  ASTGSIFGQGENPLFSDHKAMHVSDIVTVVISEAAKSSNTGSKQLSENDTSALGGGLFSS 110

Query: 118 LF---------GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLI 168
                             N   N +   A  G GS ++       I+A +  IL+NGN  
Sbjct: 111 TGVNSAMNSKVADINGFSNVGFNSNSSSAYKGSGSATKDASFTTTISARIVKILKNGNYY 170

Query: 169 ISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIG 228
           ISG +E+ ++D+ + + ++G++RP D+D +N ++  +I++A+I Y  +G      +   G
Sbjct: 171 ISGKREILIDDQKQIVQLSGVIRPYDIDQYNKINSSQISDAKILYKTEGDMDRATQQGWG 230

Query: 229 HQLIENLSP 237
            ++++++ P
Sbjct: 231 TKIVQSIWP 239


>gi|242309080|ref|ZP_04808235.1| flagellar L-ring protein [Helicobacter pullorum MIT 98-5489]
 gi|239524504|gb|EEQ64370.1| flagellar L-ring protein [Helicobacter pullorum MIT 98-5489]
          Length = 228

 Score =  177 bits (450), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 59/236 (25%), Positives = 100/236 (42%), Gaps = 22/236 (9%)

Query: 12  SSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAAL 71
             L  GC ++       PQ+S    +  E           +  D+     S++      L
Sbjct: 4   GFLFNGCANT------DPQISFKPPAYVEE------LPPKEEEDNFGNPGSIFGRGDNLL 51

Query: 72  FKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF----------SLFGQ 121
           F D RA+ + D++TV I    QA        + N+S                    + G 
Sbjct: 52  FSDRRAMQLNDLVTVIINQTAQASSSANKNLNENSSGTLGGPSLTYAGSSSSINSIVNGI 111

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
                 G    +     +G G+ +R E     IAA +  +L+NGN  I GS+EV +N E 
Sbjct: 112 NNATGFGINLGNNTSTYAGTGTQNRQETFTTTIAARIIKVLQNGNYFIEGSREVLINGEK 171

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           + ++++G+VRP D+  +N++    IA+A+I Y  +G   +      G +LIE++ P
Sbjct: 172 QIIHLSGVVRPTDIARNNTIESQYIADAKIMYDTQGELKKNTEKGWGTKLIESIWP 227


>gi|89902480|ref|YP_524951.1| flagellar L-ring protein [Rhodoferax ferrireducens T118]
 gi|89347217|gb|ABD71420.1| flagellar L-ring protein [Rhodoferax ferrireducens T118]
          Length = 243

 Score =  177 bits (449), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 50/232 (21%), Positives = 91/232 (39%), Gaps = 12/232 (5%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           + L     L  C S            P   ++D         +    + S   S SL++ 
Sbjct: 22  LTLVLGLTLSACGS-----------LPQPVNVDFVQADTAPPMAAAPAASQAASGSLFQK 70

Query: 67  -SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
            S+   F+D RA  +GD++T+ I  +  A   +++  +R  S    +S    +       
Sbjct: 71  VSYRPSFEDPRARMIGDVVTIRIVENVAASQVSKSTANRTTSGAASISAFPLVSPADLLN 130

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
           +   +        SGKG    A      I A V  +L NG+L+++G +++ VN  +  L 
Sbjct: 131 LKAGVGTSSANDFSGKGGTESANTFTGTITATVVRVLPNGHLVVTGDKQIGVNQNVDVLR 190

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            +G + P  +   N ++  ++A ARI   G+G   E        +   +  P
Sbjct: 191 FSGTIDPHLIQPGNLINSSQVANARIESKGRGAQAEAQTVGWLTRFFFSFLP 242


>gi|291288377|ref|YP_003505193.1| flagellar L-ring protein [Denitrovibrio acetiphilus DSM 12809]
 gi|290885537|gb|ADD69237.1| flagellar L-ring protein [Denitrovibrio acetiphilus DSM 12809]
          Length = 239

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 69/248 (27%), Positives = 122/248 (49%), Gaps = 21/248 (8%)

Query: 1   MY-RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M  R   +++  + +  GC          P      +   +N+    L    K  ++ K 
Sbjct: 1   MKVRILLMMIATALVFTGCA-------KKPDF---NNDALKNSYQKELEEYKKQQEARKP 50

Query: 60  SYSLWRDSHA--ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           S SLW ++ A  +LF D +  +VGDI+ ++I     A   N T  S++ S    L+    
Sbjct: 51  SPSLWMEASAKGSLFLDYKGRHVGDIIIINIVESTSASNSNSTSTSKSQSASSTLTNLMG 110

Query: 118 LFGQQT--------PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLII 169
           L               ++ N + D   + +G GS ++A+ +   IAA VT +L +GNL+I
Sbjct: 111 LPANLGVTNLLGTGNALDLNNSLDSSSSFAGNGSKTKADTIQGTIAARVTDVLPSGNLVI 170

Query: 170 SGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGH 229
            G +E+ V++E +++ ++GIVR +D+DA N+VS   IA+A+I+Y G+G  ++  +P    
Sbjct: 171 EGHRELIVDNEKQTITLSGIVRQKDLDASNTVSSTSIADAKIAYSGQGMLSDSNKPGWLM 230

Query: 230 QLIENLSP 237
            L   + P
Sbjct: 231 TLFNWIMP 238


>gi|254462235|ref|ZP_05075651.1| flagellar L-ring protein FlgH [Rhodobacterales bacterium HTCC2083]
 gi|206678824|gb|EDZ43311.1| flagellar L-ring protein FlgH [Rhodobacteraceae bacterium HTCC2083]
          Length = 216

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 43/231 (18%), Positives = 87/231 (37%), Gaps = 25/231 (10%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
                    L  C + + +        P+    +E                     S++ 
Sbjct: 7   VFAALMLCALGACSTYVEDEASH-AFQPVMPEANERT--------------GPADGSIYH 51

Query: 66  DSHAALFK-DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP 124
            + + LF  + RA  VGDILT+ +    QA        ++++SL   +    ++      
Sbjct: 52  ANASGLFAVEQRASKVGDILTIALNESFQATKSQTASAAKSDSLSLSVPNLLNVPV---- 107

Query: 125 QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
                 +        G G+  ++     L+   V  ++ NGNL + G +++ +N+    +
Sbjct: 108 -----ASTGSAQNFEGNGAAEQSNSFTGLVTVSVVRVMSNGNLEVLGQKKLTLNNGDEYV 162

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
            V+G+VR  D+   N V+ +++A A I+Y G G   +  +     +    L
Sbjct: 163 RVSGLVRQSDISPTNVVNSNRLANAEITYIGAGDLADTAKRGWIPKAFSAL 213


>gi|152997579|ref|YP_001342414.1| flagellar L-ring protein [Marinomonas sp. MWYL1]
 gi|150838503|gb|ABR72479.1| flagellar L-ring protein [Marinomonas sp. MWYL1]
          Length = 283

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 44/214 (20%), Positives = 87/214 (40%), Gaps = 6/214 (2%)

Query: 22  ISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA-LFKDSRALNV 80
           + +         +  S+  ++           + S   +  +++ S     F D +A  V
Sbjct: 70  VPDPNDPLNGPNISQSIQSDDPYYAPVYPNGMNPSQAPTGGIYQTSMGDVFFGDQKASKV 129

Query: 81  GDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSG 140
           GDILT+++     +   N    S+++S   +         +    +        G   SG
Sbjct: 130 GDILTINLNETTTSTKANAATVSKSSSATIENPTVLGQELKMDTTLP-----QQGTDFSG 184

Query: 141 KGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNS 200
             S ++   L+  I+  V     NG L + G + +R+N     +  +GIVR QD+  +N+
Sbjct: 185 NASANQNNSLSGTISVTVYRAYPNGLLAVRGEKWLRLNQGDEYIRFSGIVRKQDISPNNT 244

Query: 201 VSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           V  +++A+ARI+Y G G            +L+ +
Sbjct: 245 VESERVADARITYSGTGDVAAGSEQGWVSRLLNS 278


>gi|238796907|ref|ZP_04640411.1| Flagellar L-ring protein [Yersinia mollaretii ATCC 43969]
 gi|238719167|gb|EEQ10979.1| Flagellar L-ring protein [Yersinia mollaretii ATCC 43969]
          Length = 189

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 45/188 (23%), Positives = 79/188 (42%)

Query: 50  DFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLH 109
               + S  ++       +  +F+D R  NVGD LT+ ++ +  A   +    +R  S  
Sbjct: 1   MAVANGSVFQTGQAMSYGYQPMFEDRRPRNVGDTLTIVLQENVSASKSSSANANRGGSTG 60

Query: 110 RKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLII 169
                              N    G    +GKG  +     +  I   V  +L+NGNL +
Sbjct: 61  LSFDAVPGAMSGLFGGDKANAAISGSSDFTGKGGAAAKNTFSGTITVTVQQLLQNGNLKV 120

Query: 170 SGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGH 229
            G +++ +N     +  +G+V P+ + + NSV   ++++ARI Y G G   E  +     
Sbjct: 121 VGEKQIAINQGTEFIRFSGVVNPRTISSSNSVISTQVSDARIEYVGNGYINEAQQMGWLQ 180

Query: 230 QLIENLSP 237
           +L  NLSP
Sbjct: 181 RLFLNLSP 188


>gi|254459364|ref|ZP_05072785.1| flagellar L-ring protein FlgH [Campylobacterales bacterium GD 1]
 gi|207083977|gb|EDZ61268.1| flagellar L-ring protein FlgH [Campylobacterales bacterium GD 1]
          Length = 240

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 48/249 (19%), Positives = 101/249 (40%), Gaps = 22/249 (8%)

Query: 1   MYRYSFIVLC---YSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDST 57
           M +   I          L GC ++++E    P+++    +  E           ++    
Sbjct: 1   MIKLILIFFMSFYAILFLSGCTANLTE----PEINFEPPAYVEQ------MPSKEDKQDY 50

Query: 58  KKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL----- 112
               S++      LF D +A++V DI+ V I  + Q+        S  ++          
Sbjct: 51  TSIGSIFGQGDNPLFSDHKAMHVNDIVRVVISENAQSSSTAAKDLSEADTSALGGGTFAA 110

Query: 113 ----SGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLI 168
                   S   +     N            G GS ++       ++A +  +++NGN  
Sbjct: 111 TGGNPAVSSYANKLNGLSNIGFTGTSTSTYQGAGSATKDASFTTTVSARIVKVMQNGNYF 170

Query: 169 ISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIG 228
           ISG +E+ V+++ + + ++G++RP D+D +N +   +++EA+I Y  +G      +   G
Sbjct: 171 ISGKREILVDEQKQIIQISGVIRPYDIDQYNKIDSAQMSEAKILYQTQGDVDRATKQGWG 230

Query: 229 HQLIENLSP 237
            ++I+   P
Sbjct: 231 TKIIQAAWP 239


>gi|170737041|ref|YP_001778301.1| flagellar L-ring protein [Burkholderia cenocepacia MC0-3]
 gi|169819229|gb|ACA93811.1| flagellar L-ring protein [Burkholderia cenocepacia MC0-3]
          Length = 221

 Score =  175 bits (444), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 52/233 (22%), Positives = 91/233 (39%), Gaps = 19/233 (8%)

Query: 4   YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSL 63
               +    +LL GC +   +   +P           + R                   L
Sbjct: 5   RFVAMGGVLALLGGCATGPFDR-SLPDFDDSMPDTVFDVRR------------GTAGGVL 51

Query: 64  WRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT 123
             D   +L  D RA   GD+LTVD+    QA   + T   +++SL  K    F       
Sbjct: 52  VPDQAWSLTSDVRAFRAGDVLTVDLEESTQASKKSGTQVGKDSSLSAKKPSLFG------ 105

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
             +            +G GS S+   L   +  +V  ++ NG L + G + + +N    +
Sbjct: 106 KALPVEAELGTKSGFNGAGSSSQQNTLRGSVTVVVQRVMPNGLLQVRGEKRLVLNQGEEN 165

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           + + G VR  D+D++N VS  ++A ARI+Y G+G   +  +P +  +   +  
Sbjct: 166 VRLAGYVRAADIDSNNRVSSQRVANARITYAGRGSLADASQPGMLTRFFNSPW 218


>gi|152980334|ref|YP_001353114.1| FlgH flagellar basal body L-ring protein [Janthinobacterium sp.
           Marseille]
 gi|151280411|gb|ABR88821.1| FlgH flagellar basal body L-ring protein [Janthinobacterium sp.
           Marseille]
          Length = 222

 Score =  175 bits (444), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 47/239 (19%), Positives = 94/239 (39%), Gaps = 18/239 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M      ++ +++LL GC      +   P                       +S +   +
Sbjct: 1   MKFKLSALMMFAALLAGCGGMPETVVQTP---------------LTAKPQSASSITPPMN 45

Query: 61  YSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            ++++  S+  +F+D RA  +GD +T+ I     A     +  S+  ++       F LF
Sbjct: 46  GAIFQTASYRPMFEDRRARLIGDTITITINERSSAGKQAGSSGSKTGTVAAAAPSIFGLF 105

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
           G  T   + + +        G   ++        +   V  +L NGNL+++G ++V ++ 
Sbjct: 106 GNVTDNFSASASSASKYEDKGV--VTSGNNFVSTLTVTVIDVLSNGNLVVAGEKQVALDK 163

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
               +  +G+V P  V   N VS  ++A+ARI Y    R        +  +   ++ PL
Sbjct: 164 GGEFIRFSGVVDPATVGPGNVVSSTRVADARIEYRTNARIDAAEVMSMLARFFLSVMPL 222


>gi|121607558|ref|YP_995365.1| flagellar L-ring protein [Verminephrobacter eiseniae EF01-2]
 gi|121552198|gb|ABM56347.1| flagellar L-ring protein [Verminephrobacter eiseniae EF01-2]
          Length = 249

 Score =  175 bits (443), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 45/226 (19%), Positives = 85/226 (37%), Gaps = 12/226 (5%)

Query: 12  SSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAAL 71
             L  GC S          ++P+   +D  +                        S+   
Sbjct: 35  LLLCAGCTS----------LAPVPPPVDILSTTAPALAAAAQGPRPVTGGLFHNASYRPA 84

Query: 72  FKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLN 131
           F+D RA  VGD +T+ I  +  A   + +   R + +   +     +    T +++  L 
Sbjct: 85  FEDRRARMVGDSVTIQIVENVTASQKSSSTVDRQSQVSAGVQALPFIGKTLTGKLS--LG 142

Query: 132 YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVR 191
                  SGKG    A   +  I   V  +L NG+L+++G +++ VN  +  L  +G V 
Sbjct: 143 TSADNTFSGKGGTESANTFSGAITTTVVEVLPNGHLVVTGEKQIGVNQNVDVLRFSGTVD 202

Query: 192 PQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           P  +   + ++   +A  R+   G+G  TE        +    ++P
Sbjct: 203 PSALQPGSIIASTLVANVRVESRGRGAQTEAQAMGWLGRFFNTVAP 248


>gi|315930292|gb|EFV09394.1| flagellar L-ring family protein [Campylobacter jejuni subsp. jejuni
           305]
          Length = 207

 Score =  175 bits (443), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 54/205 (26%), Positives = 89/205 (43%), Gaps = 7/205 (3%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQ 99
           +           ++++      SL+      LF D +A+NV D++TV I+          
Sbjct: 2   KPPAYVEELAPKQSNNIESAPGSLFGKGDNPLFSDKKAMNVNDLVTVVIQESTTQSTQAN 61

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNG-------NLNYDGGGASSGKGSISRAEKLNL 152
              SR N+ +          G     +N            +     +G GS SR E  N 
Sbjct: 62  KATSRTNTSNLGGGALTGSSGVVANALNKVNAYSNIGFQTNSSNNYTGTGSQSRNESFNT 121

Query: 153 LIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARIS 212
            I+  V  IL NGN  I GS+E+ +N E + + ++G++RP D+   N++    IA+A+I 
Sbjct: 122 TISTRVIKILSNGNYFIEGSRELLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKIL 181

Query: 213 YGGKGRTTELLRPPIGHQLIENLSP 237
           Y  +G      R P G ++IE + P
Sbjct: 182 YKTEGEVDRSTRKPWGSKVIEAIWP 206


>gi|90415315|ref|ZP_01223249.1| flagellar L-ring protein FlgH [marine gamma proteobacterium
           HTCC2207]
 gi|90332638|gb|EAS47808.1| flagellar L-ring protein FlgH [marine gamma proteobacterium
           HTCC2207]
          Length = 217

 Score =  174 bits (442), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 53/212 (25%), Positives = 89/212 (41%), Gaps = 10/212 (4%)

Query: 35  GSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALN-----VGDILTVDIR 89
            +                 +  T+ + +++ +    LF D R+       VGD++TV + 
Sbjct: 6   TAPNLMPTAEFAPVQPAPAAPKTQATGAIFNNG-MGLFGDLRSYQGGDLKVGDLVTVLLS 64

Query: 90  IDDQAVFDNQTGRSRNNSLHRKL----SGGFSLFGQQTPQMNGNLNYDGGGASSGKGSIS 145
              QA   +    SR ++                G+ T   +      G   S G G+  
Sbjct: 65  ETTQASRSSDISTSRASTNDVVTEAQKDSVLDKIGRGTGFFSDFKLDGGTVTSDGTGTAD 124

Query: 146 RAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDK 205
           +A  L   I+A+V  +L NGNL+I G +++ + +    + V GI+RP D+   N+V   +
Sbjct: 125 QAASLTGSISAMVVEVLSNGNLVILGEKQLALTEGSEFIRVKGIIRPADIQPDNTVLSRR 184

Query: 206 IAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           IA A+ISY G G   +  +P  G  LI    P
Sbjct: 185 IANAQISYRGTGDLAKASKPGWGTGLIFKFWP 216


>gi|317051357|ref|YP_004112473.1| flagellar L-ring protein [Desulfurispirillum indicum S5]
 gi|316946441|gb|ADU65917.1| flagellar L-ring protein [Desulfurispirillum indicum S5]
          Length = 221

 Score =  174 bits (441), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 47/190 (24%), Positives = 99/190 (52%), Gaps = 5/190 (2%)

Query: 50  DFKNSDSTKKSYSLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS 107
           +    D + ++ SLW D++     F D +A  + DI+TV +     A        SR++S
Sbjct: 34  EVAPDDRSVQNGSLWSDTNVTSIYFLDQKARRINDIITVRVVESSSASNSGNVATSRDSS 93

Query: 108 LHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
           ++  ++       ++   +N  +  + G + +G G + +A+ +   ++  +  +L NGN+
Sbjct: 94  VNMGVTSVLG---KERGSLNPAVQANAGNSFAGSGQLQKADNITATVSTRIVKVLNNGNM 150

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
           ++ G +E+ +++E + L V+G++RP+D+DA N+V    +A+A+I Y G G      +P  
Sbjct: 151 VLRGKREIMIDNEKQMLFVSGVIRPEDIDADNTVMSSALADAQIMYTGSGALAASRKPGW 210

Query: 228 GHQLIENLSP 237
           G   +  + P
Sbjct: 211 GTTFLNTIWP 220


>gi|205355529|ref|ZP_03222300.1| putative flagellar L ring protein precursor [Campylobacter jejuni
           subsp. jejuni CG8421]
 gi|205346763|gb|EDZ33395.1| putative flagellar L ring protein precursor [Campylobacter jejuni
           subsp. jejuni CG8421]
          Length = 207

 Score =  174 bits (441), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 54/205 (26%), Positives = 89/205 (43%), Gaps = 7/205 (3%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQ 99
           +           ++++      SL+      LF D +A+NV D++TV I+          
Sbjct: 2   KPPAYVEELAPKQSNNIESAPGSLFGKGDNPLFSDKKAMNVNDLVTVVIQESTTQSTQAN 61

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNG-------NLNYDGGGASSGKGSISRAEKLNL 152
              SR N+ +          G     +N            +     +G GS SR E  N 
Sbjct: 62  KATSRTNTSNLGGGALTGSSGVVANALNKVNAYSNIGFQTNSSNNYTGTGSQSRNESFNT 121

Query: 153 LIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARIS 212
            I+  V  IL NGN  I GS+E+ +N E + + ++G++RP D+   N++    IA+A+I 
Sbjct: 122 TISTRVIKILSNGNYFIEGSRELLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKIL 181

Query: 213 YGGKGRTTELLRPPIGHQLIENLSP 237
           Y  +G      R P G ++IE + P
Sbjct: 182 YKTEGEVDRSTRKPWGGKVIEAIWP 206


>gi|218513038|ref|ZP_03509878.1| flagellar basal body L-ring protein [Rhizobium etli 8C-3]
          Length = 213

 Score =  174 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 108/195 (55%), Positives = 136/195 (69%), Gaps = 4/195 (2%)

Query: 17  GCH--SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKD 74
           GC   +++SEI   P MSP+GS L    + P + +  K   +  + YSLW DS AALF+D
Sbjct: 21  GCQSPTAVSEIGRAPAMSPIGSGL-AYGQTPQMALYPKQPRAVAQGYSLWSDSQAALFED 79

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
           +RALNVGDILTVDI+I+D+A FDN+T RSR NS          +FG  TP+   +L Y  
Sbjct: 80  ARALNVGDILTVDIQINDKASFDNETNRSRKNSSGMNWDVNAQIFG-WTPESKTDLTYGS 138

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
             ++ GKG I R +KL LL+AA+VT ILENGNL+ISGSQEVR+N E+R LNV GIVRPQD
Sbjct: 139 DTSTDGKGKIERTDKLTLLVAAVVTGILENGNLVISGSQEVRLNQELRILNVAGIVRPQD 198

Query: 195 VDAHNSVSYDKIAEA 209
           V+A N +SYDKIAEA
Sbjct: 199 VNAENQISYDKIAEA 213


>gi|332525063|ref|ZP_08401243.1| flagellar basal-body L-ring protein [Rubrivivax benzoatilyticus
           JA2]
 gi|332108352|gb|EGJ09576.1| flagellar basal-body L-ring protein [Rubrivivax benzoatilyticus
           JA2]
          Length = 227

 Score =  174 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 41/207 (19%), Positives = 81/207 (39%), Gaps = 3/207 (1%)

Query: 34  MGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR-DSHAALFKDSRALNVGDILTVDIRIDD 92
           M  ++               +     + ++++   +  LF+D RA   GD L V I    
Sbjct: 22  MYPTVQFEQPTGADTPPPVVAAEAPSTGAIFQTSQYRPLFEDHRARQAGDTLQVRIVEKI 81

Query: 93  QAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNL 152
            A   + +   +   L   ++    +    T      ++ +   + +GKGS   +     
Sbjct: 82  SATAKSTSSLDKTTDLSGGITALPGI-NAATALRRAAVSANSENSFAGKGSTQNSNDFQG 140

Query: 153 LIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARIS 212
            I   V  +L NG+L+++G +++ VN  +  L  +G V P+ ++  N V   +IA  R+ 
Sbjct: 141 TITVTVRGVLPNGHLLVAGEKQIGVNANVDVLRFSGQVDPRAIEPGNVVQSTRIANVRLE 200

Query: 213 YGGKGRTTELLRPPIGHQ-LIENLSPL 238
             G+G   +        +     L PL
Sbjct: 201 QRGRGAQADTNAVGWLSRVFFSVLWPL 227


>gi|148554186|ref|YP_001261768.1| flagellar L-ring protein [Sphingomonas wittichii RW1]
 gi|148499376|gb|ABQ67630.1| flagellar L-ring protein [Sphingomonas wittichii RW1]
          Length = 227

 Score =  174 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 44/194 (22%), Positives = 91/194 (46%), Gaps = 6/194 (3%)

Query: 46  FLGIDFKNSDSTKKSYSLWRD--SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRS 103
           +  +       ++ + ++++    ++AL   +RA  +GDI+T+ +    QA   N     
Sbjct: 37  YSPVFAAEPLPSQANGAIYQAANGYSALTNGARAAMIGDIVTITLVERTQAAKSNSASTD 96

Query: 104 RNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILE 163
           R+  L           G  +     ++   GG   +GKG+ +++ +LN  I+  +  +  
Sbjct: 97  RSGELGLTPPTT----GPLSLFKPTDVGASGGSTFTGKGAAAQSNQLNGEISVSIVRVYP 152

Query: 164 NGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELL 223
           NG +++ G + + +N    ++ +TG++R  D+   N V   ++A+ARI+Y GKG      
Sbjct: 153 NGTMLVRGEKLLTLNRGDENIAITGLIRAADIGPDNRVPSTRVADARITYSGKGEIARGS 212

Query: 224 RPPIGHQLIENLSP 237
           R    ++    LSP
Sbjct: 213 RQGWLNRFFSILSP 226


>gi|255605341|ref|XP_002538377.1| Flagellar L-ring protein precursor, putative [Ricinus communis]
 gi|223512459|gb|EEF24006.1| Flagellar L-ring protein precursor, putative [Ricinus communis]
          Length = 334

 Score =  174 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 46/190 (24%), Positives = 81/190 (42%), Gaps = 6/190 (3%)

Query: 50  DFKNSDSTKKSYSLWR--DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS 107
               +     +  +++  D +AAL++  RA  VGD LT+ +     A     T       
Sbjct: 148 PAPVAVQPPANGGIFQAGDGYAALYEGMRARRVGDPLTILLVEKTAASKSAGTKLDSGGG 207

Query: 108 LHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
                       G  +     + +  G    +G G+  +A  L+  I+  V A+  NG +
Sbjct: 208 FGLTPPTT----GALSLFKESDASVSGKRNFNGTGTADQANALSGEISVTVAAVYPNGTM 263

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
           ++ G + V +N     + + G+VR  D+DA+N V   ++A+ARI+Y GKG      R   
Sbjct: 264 LVQGQKRVTLNRGDEFVQIKGLVRTADIDANNRVLSTRVADARIAYTGKGDVARASRQGW 323

Query: 228 GHQLIENLSP 237
             +    +SP
Sbjct: 324 LSRFFSAISP 333


>gi|294013089|ref|YP_003546549.1| flagellar L-ring protein precursor FlgH [Sphingobium japonicum
           UT26S]
 gi|292676419|dbj|BAI97937.1| flagellar L-ring protein precursor FlgH [Sphingobium japonicum
           UT26S]
          Length = 219

 Score =  174 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 44/180 (24%), Positives = 84/180 (46%), Gaps = 5/180 (2%)

Query: 60  SYSLWRD--SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           + S+++    +  L   +RA +VGDI+T+ +    QA   N    SR+ S+         
Sbjct: 42  NGSIFQASMGYTPLTSGARATSVGDIITIVLVERTQATKSNSADTSRDGSIALTPPSTGP 101

Query: 118 LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
           L    +     ++   G  A +GKG+ +++  LN  I   + A   NG +++ G + + +
Sbjct: 102 LSKIFSAS---DIGSSGSNAFTGKGAATQSNALNGEITVTIAATYPNGTMLVKGEKALTL 158

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N     + ++G+VR  D+   N ++  ++A+A+I Y GKG      R     +    +SP
Sbjct: 159 NRGDEYIQISGLVRQADIGPDNRIASTRVADAKIIYTGKGEIARASRQGWLQRFFSMISP 218


>gi|260774941|ref|ZP_05883842.1| flagellar L-ring protein FlgH [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609196|gb|EEX35354.1| flagellar L-ring protein FlgH [Vibrio coralliilyticus ATCC BAA-450]
          Length = 259

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 46/246 (18%), Positives = 91/246 (36%), Gaps = 27/246 (10%)

Query: 15  LFGCH-------------------------SSISEITGIPQMSPMGSSLDENNRMPFLGI 49
           L GC                          S       +  +      +  +     +  
Sbjct: 13  LSGCSMLEAPIETSDVVQGTTTVDAVEGDKSQDESSGIVDTLRGRTDPVAGDPAWAPIHP 72

Query: 50  DFKNSDSTKKSYSLWRD-SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSL 108
             +      ++ SL+     ++L+ DS+   VGDI+TV +  + +A   +    S+NN  
Sbjct: 73  KHQPEHYAAETGSLFNTVQASSLYDDSKPRGVGDIITVTLDENTKAAKSSDADLSKNNDA 132

Query: 109 HRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLI 168
                             N + N       SG  + +++  ++  I   V  +L NGNL+
Sbjct: 133 SMD-PLEVGGQQLNIGDYNFSYNLSNDNKFSGSAAANQSNSISGSITVEVVEVLANGNLV 191

Query: 169 ISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIG 228
           I G + + +N     + ++G +RP D+   N+++ ++I+ ARI Y G G   ++  P   
Sbjct: 192 IRGEKWLTLNTGDEYIRLSGTIRPDDISYENTIASNRISNARIRYSGTGTQQDMQEPGFL 251

Query: 229 HQLIEN 234
            +    
Sbjct: 252 ARFFNV 257


>gi|87119673|ref|ZP_01075570.1| flagellar L-ring protein FlgH [Marinomonas sp. MED121]
 gi|86165149|gb|EAQ66417.1| flagellar L-ring protein FlgH [Marinomonas sp. MED121]
          Length = 280

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 41/215 (19%), Positives = 83/215 (38%), Gaps = 6/215 (2%)

Query: 20  SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA-LFKDSRAL 78
           + + E +       M      ++      I ++   +   +  +++       F    A 
Sbjct: 65  AYVPEESDPFNAPDMNYGPRSDDPYYAPVIKYEAQPAQNVTGGIYKVGMGDVFFGSQTAS 124

Query: 79  NVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGAS 138
            VGDILT+++     +   N    S+++S   +              +        G   
Sbjct: 125 RVGDILTINLSETTSSSKSNDATLSKSSSAEVQNPRVVGTEVNIDSVLPDG-----GTNF 179

Query: 139 SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAH 198
           +G    +++  LN  I   V  +  NG L I G + V +N     + +TGI+R +D+  +
Sbjct: 180 AGSAGANQSNSLNGTITVTVYDVYPNGVLAIRGEKWVTLNRGDEYIRLTGIIRKRDIKPN 239

Query: 199 NSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           N++   ++A+ARI+Y G G            +L+ 
Sbjct: 240 NTIDSSRVADARITYSGSGEIASGSEQGWVTRLLN 274


>gi|82702456|ref|YP_412022.1| flagellar basal body L-ring protein [Nitrosospira multiformis ATCC
           25196]
 gi|82410521|gb|ABB74630.1| Flagellar L-ring protein [Nitrosospira multiformis ATCC 25196]
          Length = 230

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 45/237 (18%), Positives = 88/237 (37%), Gaps = 21/237 (8%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
           R    +      L GC S          + P    + +      +            + +
Sbjct: 12  RVLGFMTGVPLALSGCVS----------LPPPAPIVHQP-----MSARAALPAPPPGNGA 56

Query: 63  LWRD--SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           +++D   + +LF D RA  +GD L + +     A   + +  ++N  +   +        
Sbjct: 57  VYQDANQYHSLFIDRRARQIGDTLVILLTERTNASKRSNSSANKNGDVSFGIPPIVFGVP 116

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   +L        +GKG  + A   +  I   V  +L N  L++SG +++ +   
Sbjct: 117 ITKKI---DLGASSSNDFAGKGEAASANNFSGTITVTVVDVLPNSYLVVSGEKQLAMTQG 173

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
              +  +G+VRP+ V   N+VS  ++A+ARI Y   G   E        +    ++P
Sbjct: 174 SEYIRFSGVVRPETV-ISNTVSSIQVADARIEYKANGYIDEAQTMGWLSRFFLTVAP 229


>gi|237752556|ref|ZP_04583036.1| flagellar basal body L-ring protein [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229376045|gb|EEO26136.1| flagellar basal body L-ring protein [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 235

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 57/220 (25%), Positives = 93/220 (42%), Gaps = 16/220 (7%)

Query: 28  IPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVD 87
            PQ+S    +  E           +  D+     S++      LF D RA+ + D++TV 
Sbjct: 21  EPQISFKPPAYVEE------LPPKEEEDNFGNPGSIFGRGDNLLFSDRRAMQLNDLVTVI 74

Query: 88  IRIDDQAVFDNQTGRSRNNSLHRKLSGG-FSLFGQQTPQMNGNLNY---------DGGGA 137
           I    QA        +  ++      G  F    Q    +   LN               
Sbjct: 75  INQTAQATSTANKNLNETSNATLTGPGITFGGPSQTIGNITNQLNNITGFGISTGQNTST 134

Query: 138 SSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDA 197
             G GS +R E     IAA +  +L+NGN  I GS+EV +N E + ++++G+VRP D+  
Sbjct: 135 FQGAGSQNRQEAFTTTIAARIIKVLQNGNYFIEGSREVLINGEKQVIHLSGVVRPNDIAR 194

Query: 198 HNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            N++    IA+A+I Y  +G          G +L+E++ P
Sbjct: 195 DNTIESRFIADAKIMYDTQGELKRNTEKGWGTKLLESVWP 234


>gi|149194488|ref|ZP_01871584.1| flagellar L-ring protein precursor H [Caminibacter mediatlanticus
           TB-2]
 gi|149135232|gb|EDM23712.1| flagellar L-ring protein precursor H [Caminibacter mediatlanticus
           TB-2]
          Length = 235

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 54/247 (21%), Positives = 99/247 (40%), Gaps = 23/247 (9%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R   ++        GC +            PM  ++          +  K  D+ +  
Sbjct: 1   MKREITLLFPLI-FYVGCATH-----------PMDPTITMTPPKYVEEMPSKTQDNIQNP 48

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRI----DDQAVFD-NQTGRSRNNSLHRKLSGG 115
            SL+ +    LF D++A  V D++TV I        QA    N+        L   +SG 
Sbjct: 49  GSLFTNG-DNLFSDTKAKKVNDVVTVLITEQIKQSSQASKKLNEANTDAGGILDASISGS 107

Query: 116 FSLFGQQTPQMNGNLNYD-----GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
               G++       ++ +           G GS  R E+    I+A +  IL NGN  I 
Sbjct: 108 AYFGGREEKLAKTGISLNLPSMNSNRTFQGSGSQQRNEQFQTTISARIVKILANGNYYIY 167

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ 230
           G++E+ V+ + + + ++G++RP+D+   N++    IA+A+I+Y  +G            +
Sbjct: 168 GTREIYVDGQKQIIKISGVIRPEDISPDNTIDSKYIADAKIAYETEGDIKRYTEQNWFAK 227

Query: 231 LIENLSP 237
               + P
Sbjct: 228 FWSAIVP 234


>gi|296274398|ref|YP_003657029.1| flagellar L-ring protein [Arcobacter nitrofigilis DSM 7299]
 gi|296098572|gb|ADG94522.1| flagellar L-ring protein [Arcobacter nitrofigilis DSM 7299]
          Length = 237

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 52/251 (20%), Positives = 98/251 (39%), Gaps = 29/251 (11%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M    F++L  + LL  C              P+   L      P   +       T   
Sbjct: 1   MRSKYFLILACAFLLNSCA-------------PVEQELKF--DKPPAQVLKPKPKVTYNK 45

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SL+     +LF D + L VGDI+ V I     +   N+   +  ++            G
Sbjct: 46  GSLYSRKGPSLFADKKDLQVGDIIQVVIDESLTSNTSNKRELTNTSAETMGGGVISPATG 105

Query: 121 QQTPQMNG--------------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGN 166
              P  +                 N +   +  GK   +  E  +  ++ I+    +NGN
Sbjct: 106 NNLPLNSTVQSVANKINSIGGVQFNSNSNSSFKGKVKANADESFSTTLSVIIEETYQNGN 165

Query: 167 LIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPP 226
             I GS+E+ ++++ + + ++G++RP D+   NS+   +IA  ++ Y   G   +++  P
Sbjct: 166 YYIKGSKEMLIDEQKQEIIISGVIRPYDISPDNSIKSSQIANLKVLYKKDGEEQDVMHQP 225

Query: 227 IGHQLIENLSP 237
            G +L++ L P
Sbjct: 226 WGTKLLKMLWP 236


>gi|134095094|ref|YP_001100169.1| basal-body outer-membrane L (lipopolysaccharide layer) ring protein
           [Herminiimonas arsenicoxydans]
 gi|166214821|sp|A4G6A8|FLGH_HERAR RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|133738997|emb|CAL62045.1| Flagellar L-ring protein precursor (Basal body L-ring protein)
           [Herminiimonas arsenicoxydans]
          Length = 223

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 96/240 (40%), Gaps = 19/240 (7%)

Query: 1   MYRYSFIVLCY-SSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M +    ++   S LL  C      I   P                       ++ +   
Sbjct: 1   MKKSLMALIVVGSFLLSACALRPDTIVNTP---------------LTARPQAASTIAPPA 45

Query: 60  SYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + ++++ + +  +F+D RA  +GD +T+ I     A     +  S+  S+       F L
Sbjct: 46  NGAIFQAAAYRPMFEDRRARLIGDTITIVINEKSSAGKQAGSAASKTGSVTASAPNVFGL 105

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
            G  T +++ + +        G  +++ +      +   V  +L NGNLI++G ++V ++
Sbjct: 106 LGSLTNRLSASGSNAIKYEDKG--AVTSSNNFISTMTVTVIDVLSNGNLIVAGEKQVSLD 163

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
                +  +G+V P  V++ N VS  ++A+A+I Y             +  +   ++ PL
Sbjct: 164 KGSEFIRFSGVVDPSTVNSGNIVSSTQVADAKIEYRTNSTVDGAEVASMLARFFLSVLPL 223


>gi|32490793|ref|NP_871047.1| flagellar basal body L-ring protein [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|31076694|sp|Q8D3F7|FLGH_WIGBR RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|25165999|dbj|BAC24190.1| flgH [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 228

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 54/237 (22%), Positives = 106/237 (44%), Gaps = 10/237 (4%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M+   +  + +  LL  C  +  +       + + ++            +F N    ++ 
Sbjct: 1   MHYLRYFAIAFLLLLSSCSVTRHKPLIEGSTTTIPNT---------PSSNFINGSIFQQD 51

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
            SL+   +  LF+D R  N+GDILTV ++ +  A   + +  SR ++ + +++    +  
Sbjct: 52  NSLY-YGYQPLFEDRRPKNIGDILTVLLQENVSASKSSSSNASRKSNANLEMNALPKIIN 110

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
           +       + + +     +GKG  S A   +  I   V  IL NGNL + G +++ +N  
Sbjct: 111 KIIGNDQLSTDINSNNGFNGKGGSSAANTFSGTITVTVIDILTNGNLKVIGEKKISINQG 170

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
             S+   GIV P+ +D +N V  + I++++I Y G G   E+ +     +L  N  P
Sbjct: 171 TESIRFYGIVNPKTIDHNNQVMSNLISDSKIEYIGDGYINEVQKMNWLQRLFLNYFP 227


>gi|149184210|ref|ZP_01862528.1| flagellar L-ring protein [Erythrobacter sp. SD-21]
 gi|148831530|gb|EDL49963.1| flagellar L-ring protein [Erythrobacter sp. SD-21]
          Length = 217

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 47/238 (19%), Positives = 94/238 (39%), Gaps = 24/238 (10%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            + +F +L     L  C++                S         L    + +    ++ 
Sbjct: 1   MKSAFCLLPIVLGLAACNAH---------------SARPAGYSAALPPASETAAVRHENG 45

Query: 62  SLWRD--SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
           ++++    +A L+  +RA  VGD++T+ +    Q          R+ S    L       
Sbjct: 46  AIFQASQGYAPLYYGNRAARVGDLVTIVLVERTQTSKSTSGSTKRDGSFGLSLPT----- 100

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
              +   + +LN  GGG+  G G  S+A  +   +   +  +  NG  ++ G + + ++ 
Sbjct: 101 --WSGIDSADLNASGGGSFKGSGDASQASSIRADLTVTIAEVRPNGTALVRGEKVMELSQ 158

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
               + ++GI+R  D+D  N +   ++A+ARISY G G      R     +    +SP
Sbjct: 159 GTEWVQLSGIIRLADIDQDNRIPSIRVADARISYSGAGSVQRASREGWLSRFFGVISP 216


>gi|262273525|ref|ZP_06051339.1| flagellar L-ring protein FlgH [Grimontia hollisae CIP 101886]
 gi|262222503|gb|EEY73814.1| flagellar L-ring protein FlgH [Grimontia hollisae CIP 101886]
          Length = 186

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 45/188 (23%), Positives = 84/188 (44%), Gaps = 6/188 (3%)

Query: 50  DFKNSDSTKKSYSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSL 108
                 +      L+  ++  ALF+D RA  VGDILT+ +    ++     T   +++ +
Sbjct: 1   MDMPVYTPDPDGGLFNANYSMALFQDRRAFRVGDILTITLDEQTRSSKKAGTSFDKSSDV 60

Query: 109 HRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLI 168
              +   F      T    G ++  G    SG  S S+   L+  I  +V  ++ NG L 
Sbjct: 61  SMGVPTLFG-----TSYPQGEVSVSGSRDFSGASSSSQQNSLSGSITVMVDEVMPNGVLR 115

Query: 169 ISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIG 228
           + G + +R+N     + ++G+VR  D+D +N VS  ++ +ARI+Y G+G   +       
Sbjct: 116 VRGEKWLRLNQGDEFIRLSGLVRVDDIDGNNQVSSQRLGDARITYSGRGALADANEAGWL 175

Query: 229 HQLIENLS 236
            +   +  
Sbjct: 176 TRFFNSSW 183


>gi|296282276|ref|ZP_06860274.1| flagellar L-ring protein precursor FlgH [Citromicrobium
           bathyomarinum JL354]
          Length = 223

 Score =  172 bits (435), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 42/239 (17%), Positives = 91/239 (38%), Gaps = 19/239 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M     + +  +  L  C            + P  ++  +       G            
Sbjct: 1   MNIRILLAIPLAMSLAACAGDTRPAGFSATLPPPPAAPMQQVAAVTYG----------ND 50

Query: 61  YSLWRD--SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
            ++++    +A L+  +RA  VGD++T+ +               R+ +    L      
Sbjct: 51  GAIYQASQGYAPLYNGTRAARVGDLVTIVLIERTSTTKATSGKTQRDGNAGLDLP----- 105

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                P   G+LN     + +G G+ ++   L   +   +  +  NG  ++ G + +  +
Sbjct: 106 --DFIPVDPGDLNASAAASFTGAGNAAQTSSLRGDLTVTIAEVRPNGTALVRGEKVMNFS 163

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
                + ++GI+R  D+DA N ++  ++A+A+I+Y GKG      +P    +    +SP
Sbjct: 164 QGEEWVQLSGIIRLSDIDADNRIASIRVADAQIAYSGKGAVQRAGKPGWLSRFFSIVSP 222


>gi|220932492|ref|YP_002509400.1| flagellar L-ring protein [Halothermothrix orenii H 168]
 gi|219993802|gb|ACL70405.1| flagellar L-ring protein [Halothermothrix orenii H 168]
          Length = 192

 Score =  172 bits (435), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 45/183 (24%), Positives = 84/183 (45%), Gaps = 7/183 (3%)

Query: 54  SDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS 113
             +   + SLW D  A++++D +   VGD++TV I  +  AV    T  S+ +++     
Sbjct: 17  PLTGADNNSLWSDESASIYEDRQEFKVGDVITVVIEENSSAVQSANTSTSQESNIDAG-- 74

Query: 114 GGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                 G           +         G   R+  +   +   +  IL  GN  I G +
Sbjct: 75  -----PGLGIFDFIKAFGFSYSDEGQADGQTQRSGIIEADLTTQIVEILPGGNFRIVGRK 129

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
            +++N E + + ++GI+RP+DV   N+V   K+AEA I + G+G  TE  +P +  +++ 
Sbjct: 130 TIKINGEEQYIKLSGIIRPEDVTLDNTVLSTKVAEASIEFEGEGIVTEKQKPGLFERIMN 189

Query: 234 NLS 236
            + 
Sbjct: 190 WIF 192


>gi|33596142|ref|NP_883785.1| flagellar basal body L-ring protein [Bordetella parapertussis
           12822]
 gi|81427445|sp|Q7WA92|FLGH_BORPA RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|33573145|emb|CAE36793.1| flagellar L-ring protein precursor [Bordetella parapertussis]
          Length = 230

 Score =  172 bits (435), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 49/208 (23%), Positives = 83/208 (39%), Gaps = 4/208 (1%)

Query: 33  PMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD---SHAALFKDSRALNVGDILTVDIR 89
            M                     S + + S+++     +  LF+D R  NVGDI+T+ + 
Sbjct: 23  AMIPPEPVVTGPLTAPPPPPPQPSARPNGSIYQPSAYGNYPLFEDRRPRNVGDIVTIVLE 82

Query: 90  IDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEK 149
               A     T  SR+ S    ++               + +  GG  ++G G  S    
Sbjct: 83  EKTNAAKGVATNTSRDGSATLGVAAAPRFMDGVIND-KLDTDISGGNTANGTGKSSANNT 141

Query: 150 LNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEA 209
               I   V  +L NGNL I+G +++ +N     +  +G+V P+ +   N+VS  ++A+A
Sbjct: 142 FTGTITTTVIGVLPNGNLQIAGEKQIAINRGSEYVRFSGVVDPRSITGSNTVSSTRVADA 201

Query: 210 RISYGGKGRTTELLRPPIGHQLIENLSP 237
           RI Y  KG   E+       +     SP
Sbjct: 202 RIEYRSKGVMDEVQTMGWLQRFFLIASP 229


>gi|167567753|ref|ZP_02360669.1| flagellar basal body L-ring protein [Burkholderia oklahomensis
           EO147]
 gi|167574704|ref|ZP_02367578.1| flagellar basal body L-ring protein [Burkholderia oklahomensis
           C6786]
          Length = 219

 Score =  172 bits (435), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 46/199 (23%), Positives = 76/199 (38%), Gaps = 7/199 (3%)

Query: 39  DENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFD 97
              +        F  + +  ++  ++    A +L  D RA   GD LTV +    QA   
Sbjct: 24  PRPDFADDDLPPFATAPAAGRAGGVFNPVSAWSLASDGRAYRPGDTLTVVLEETTQASKR 83

Query: 98  NQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI 157
             T   +      K    F         +  + +       +G G+ S+   L   I  I
Sbjct: 84  ADTRFGKKGDFEFKPGMLFGNP------LTFDSSVGVKRDFNGSGTSSQQNTLRGEITVI 137

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           V  ++  G L + G + + +N     + +TG VRP D+D +N VS  +IA ARI Y GKG
Sbjct: 138 VHQVMAGGLLQVKGEKVLALNQGEEIMRLTGYVRPADIDTNNRVSSRRIANARIKYVGKG 197

Query: 218 RTTELLRPPIGHQLIENLS 236
             ++        +      
Sbjct: 198 ALSDSNAAGWLTRFFNGPW 216


>gi|307293784|ref|ZP_07573628.1| flagellar L-ring protein [Sphingobium chlorophenolicum L-1]
 gi|306879935|gb|EFN11152.1| flagellar L-ring protein [Sphingobium chlorophenolicum L-1]
          Length = 218

 Score =  172 bits (435), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 44/180 (24%), Positives = 84/180 (46%), Gaps = 5/180 (2%)

Query: 60  SYSLWRD--SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           + S+++    +  L   +RA +VGDI+T+ +    QA   N    SR+ S+         
Sbjct: 41  NGSIFQASMGYTPLTSGARATSVGDIITIVLVERTQATKSNSADTSRDGSIALTPPSTGP 100

Query: 118 LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
           L    +     ++   G  A +GKG+ +++  LN  I   + A   NG +++ G + + +
Sbjct: 101 LSKLFSAS---DIGSSGSNAFTGKGAATQSNALNGEITVTIAATYPNGTMLVKGEKALTL 157

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N     + ++G+VR  D+   N ++  ++A+A+I Y GKG      R     +    +SP
Sbjct: 158 NRGDEFIQISGLVRQADIGPDNRIASTRVADAKIIYTGKGEIARASRQGWLQRFFSMISP 217


>gi|33601544|ref|NP_889104.1| flagellar basal body L-ring protein [Bordetella bronchiseptica
           RB50]
 gi|81431030|sp|Q7WJD2|FLGH_BORBR RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|33575980|emb|CAE33059.1| flagellar L-ring protein precursor [Bordetella bronchiseptica RB50]
          Length = 230

 Score =  172 bits (435), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 49/208 (23%), Positives = 83/208 (39%), Gaps = 4/208 (1%)

Query: 33  PMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD---SHAALFKDSRALNVGDILTVDIR 89
            M                     S + + S+++     +  LF+D R  NVGDI+T+ + 
Sbjct: 23  AMIPPEPVVTGPLTAPPPPPPQPSARPNGSIYQPSAYGNYPLFEDRRPRNVGDIVTIVLE 82

Query: 90  IDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEK 149
               A     T  SR+ S    ++               + +  GG  ++G G  S    
Sbjct: 83  EKTNAAKGVATNTSRDGSATLGVAAAPRFMDGIIND-KLDTDISGGNTANGTGKSSANNT 141

Query: 150 LNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEA 209
               I   V  +L NGNL I+G +++ +N     +  +G+V P+ +   N+VS  ++A+A
Sbjct: 142 FTGTITTTVIGVLPNGNLQIAGEKQIAINRGSEYVRFSGVVDPRSITGSNTVSSTRVADA 201

Query: 210 RISYGGKGRTTELLRPPIGHQLIENLSP 237
           RI Y  KG   E+       +     SP
Sbjct: 202 RIEYRSKGVMDEVQTMGWLQRFFLIASP 229


>gi|262276414|ref|ZP_06054223.1| flagellar L-ring protein FlgH [Grimontia hollisae CIP 101886]
 gi|262220222|gb|EEY71538.1| flagellar L-ring protein FlgH [Grimontia hollisae CIP 101886]
          Length = 263

 Score =  171 bits (434), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 42/217 (19%), Positives = 88/217 (40%), Gaps = 15/217 (6%)

Query: 21  SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD-SHAALFKDSRALN 79
               + G P  +P+       +              T  + SL+   S   L+ D++  +
Sbjct: 61  REDPVAGDPSWAPLYPVRQPEHY-------------TTATGSLFSAVSAQDLYDDTKPRS 107

Query: 80  VGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASS 139
           +GDI+TV +    QA     +  ++++ L                + N +       ++S
Sbjct: 108 IGDIVTVMLEEKTQAKKSASSDAAKSSDLSMD-PLELGGEEITIGERNLSYAAAHDNSTS 166

Query: 140 GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHN 199
           G  S  ++  ++  I+  V  ++ NGNL+I G + + +N     + ++G +RP D+   N
Sbjct: 167 GSTSADQSNSISGSISVEVVDVMSNGNLLIRGEKWLTLNTGDEYIRLSGTIRPDDITPEN 226

Query: 200 SVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +++  +I+ ARI Y G G   +        +    + 
Sbjct: 227 TIASTRISNARIQYSGTGDRQDTQDQGFLARFFNVVL 263


>gi|163783623|ref|ZP_02178612.1| flagellar L-ring protein FlgH [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881116|gb|EDP74631.1| flagellar L-ring protein FlgH [Hydrogenivirga sp. 128-5-R1-1]
          Length = 208

 Score =  171 bits (433), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 40/202 (19%), Positives = 72/202 (35%), Gaps = 3/202 (1%)

Query: 37  SLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAV 95
             D                  K   SL+       L+ ++RA   GD++ + +     AV
Sbjct: 8   PKDLKTYEKENPFPQDEYKQEKSMGSLFAGGGWTDLYGENRATKPGDLIFIYVVESINAV 67

Query: 96  FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIA 155
                   ++ +    +S  F +       +                 + +   L   +A
Sbjct: 68  ESLSNQAGKSTAFSNAISSFFGVPQNTLANLGSGAEGKFNT--KASSKVQQTGTLTTKLA 125

Query: 156 AIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGG 215
             V  +  N  ++I   + + VN   R   + GI+RP+D+D+ N+V  DKIA   I   G
Sbjct: 126 GRVVKVYPNRTMLIEAKKYIMVNGMKREFILRGIIRPEDIDSTNTVPSDKIANMEIFLDG 185

Query: 216 KGRTTELLRPPIGHQLIENLSP 237
           KG   E  +P    ++   + P
Sbjct: 186 KGYMAEGGKPGWLARIFAVIFP 207


>gi|33592482|ref|NP_880126.1| flagellar basal body L-ring protein [Bordetella pertussis Tohama I]
 gi|81425268|sp|Q7VYG3|FLGH_BORPE RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|33572128|emb|CAE41670.1| flagellar L-ring protein precursor [Bordetella pertussis Tohama I]
 gi|332381899|gb|AEE66746.1| flagellar basal body L-ring protein [Bordetella pertussis CS]
          Length = 229

 Score =  171 bits (432), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 49/208 (23%), Positives = 83/208 (39%), Gaps = 4/208 (1%)

Query: 33  PMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD---SHAALFKDSRALNVGDILTVDIR 89
            M                     S + + S+++     +  LF+D R  NVGDI+T+ + 
Sbjct: 22  AMIPPEPVVICPLTAPPPSPPQPSARPNGSIYQPSAYGNYPLFEDRRPRNVGDIVTIVLE 81

Query: 90  IDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEK 149
               A     T  SR+ S    ++               + +  GG  ++G G  S    
Sbjct: 82  EKTNAAKGVATNTSRDGSATLGVAAAPRFMDGIIND-KLDTDISGGNTANGTGKSSANNT 140

Query: 150 LNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEA 209
               I   V  +L NGNL I+G +++ +N     +  +G+V P+ +   N+VS  ++A+A
Sbjct: 141 FTGTITTTVIGVLPNGNLQIAGEKQIAINRGSEYVRFSGVVDPRSITGSNTVSSTRVADA 200

Query: 210 RISYGGKGRTTELLRPPIGHQLIENLSP 237
           RI Y  KG   E+       +     SP
Sbjct: 201 RIEYRSKGVMDEVQTMGWLQRFFLIASP 228


>gi|254255090|ref|ZP_04948407.1| Flagellar basal body L-ring protein [Burkholderia dolosa AUO158]
 gi|124899735|gb|EAY71578.1| Flagellar basal body L-ring protein [Burkholderia dolosa AUO158]
          Length = 222

 Score =  171 bits (432), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 47/202 (23%), Positives = 81/202 (40%), Gaps = 7/202 (3%)

Query: 36  SSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQA 94
                 +   F             +  +     A +L  D RA   GD+LTV+++   QA
Sbjct: 24  PGRMPADDDAFDMPAAAFEVRRGTAGGVVVPDQAWSLTSDVRAFRAGDVLTVELQESTQA 83

Query: 95  VFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLI 154
              + T   +N S+  K              +       G  +  G GS S+   L   +
Sbjct: 84  SKKSGTQIGKNGSVSVKQPNLMGSL------LPIEAELGGKRSFDGSGSSSQQNTLRGSV 137

Query: 155 AAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYG 214
             IV  ++ NG L + G + + +N    ++ + G VR  D+DA+N VS  ++A+ARI Y 
Sbjct: 138 TVIVQRVMPNGLLQVRGEKRLVLNQGEETVRLAGYVRAADIDANNRVSSQRVADARIRYS 197

Query: 215 GKGRTTELLRPPIGHQLIENLS 236
           G+G   +  +P    +   +  
Sbjct: 198 GRGSLADANQPGWLTRFFNSRW 219


>gi|260767766|ref|ZP_05876701.1| flagellar L-ring protein FlgH [Vibrio furnissii CIP 102972]
 gi|260617275|gb|EEX42459.1| flagellar L-ring protein FlgH [Vibrio furnissii CIP 102972]
 gi|315179402|gb|ADT86316.1| flagellar L-ring protein FlgH [Vibrio furnissii NCTC 11218]
          Length = 259

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 47/246 (19%), Positives = 87/246 (35%), Gaps = 27/246 (10%)

Query: 15  LFGCHSSISEI----------------------TGIPQMSPMGSSLDENNRMPFLGIDFK 52
           L GC      I                      +    +  + +  D     P     + 
Sbjct: 13  LSGCSLLPEPIETADVTQGTTVVDAVEGDKSSDSSTGLVDTLRNRTDPVAGDPAWAPIYP 72

Query: 53  NSDS---TKKSYSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSL 108
                    ++ SL+      +L+ DS+   +GDI+TV +    +A         + N  
Sbjct: 73  KDKPEHYAAETGSLFNLSRANSLYDDSKPRGIGDIITVTLNESTKAAKSADADLKKKNDA 132

Query: 109 HRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLI 168
                           + N +         SG    +++  L+  I   V  IL NGNL+
Sbjct: 133 SMDPLSVGGQELN-LGEYNFSYALKNDNKFSGSAQANQSNSLSGSITVEVIDILSNGNLV 191

Query: 169 ISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIG 228
           I G + + +N     + ++G +RP D+D  N+++ ++I+ ARI Y G G   ++  P   
Sbjct: 192 IRGEKWLSLNTGDEYIRLSGTIRPDDIDFDNTIASNRISNARIQYSGTGTNQDMQEPGFL 251

Query: 229 HQLIEN 234
            +    
Sbjct: 252 ARFFNV 257


>gi|317406198|gb|EFV86447.1| flagellar basal-body L-ring protein FlgH [Achromobacter
           xylosoxidans C54]
          Length = 230

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 51/237 (21%), Positives = 91/237 (38%), Gaps = 18/237 (7%)

Query: 4   YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSL 63
                   + L+ GC               M                     + + + S+
Sbjct: 8   RLVSSAALALLVAGCA--------------MIPPEPIVTGPTTAAPPPPPMPAAQPTGSI 53

Query: 64  WRD---SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           ++     +  LF+D R  NVGDI+T+ +     A  +  T  +R+ S    ++   S   
Sbjct: 54  YQPTTYGNYPLFEDRRPRNVGDIVTIVLNEKTNASKNVATNTNRSGSASLGITAAPSFMD 113

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                 N N +  GG  + GKG  +        I   V  ++ NGNL ++G +++ +N  
Sbjct: 114 SW-ANANLNTDAKGGNVAQGKGDSTANNAFTGTITTTVVGVMSNGNLQVAGEKQIAINRG 172

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
              +  +G+V P+ +   N+VS  ++A+ARI Y  KG   E+       +     SP
Sbjct: 173 SEYVRFSGVVDPRSITGTNTVSSTQVADARIEYRSKGVMDEVQTMGWLQRFFLIASP 229


>gi|261885251|ref|ZP_06009290.1| flagellar basal body L-ring protein [Campylobacter fetus subsp.
           venerealis str. Azul-94]
          Length = 208

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 49/206 (23%), Positives = 89/206 (43%), Gaps = 8/206 (3%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQ 99
           E           +N        SL+      LF D +A+NV DI+TV I+          
Sbjct: 2   EPPAYVEQLPSKENGIGVSSPGSLFGRGDNPLFSDRKAMNVNDIVTVVIQETANQTSKAD 61

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLN--------YDGGGASSGKGSISRAEKLN 151
               ++++         +        +  ++N          G    SG G+ +R E  N
Sbjct: 62  KTTKKDSTTSLSGGTFTTPANSALSGIANDINKISGIGFSAGGANNYSGSGTSTRNETFN 121

Query: 152 LLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARI 211
             ++A +  IL NGN  I GS+E+ +N+E + + ++G++RP D+  +N +    I++A+I
Sbjct: 122 TTVSARIIKILNNGNYFIEGSKEILINNEKQIMQISGVIRPYDISQNNQIESRYISDAKI 181

Query: 212 SYGGKGRTTELLRPPIGHQLIENLSP 237
            Y  +G        P G +++E + P
Sbjct: 182 LYKTEGDLQRATSKPWGTKVLETIWP 207


>gi|332531621|ref|ZP_08407518.1| flagellar L-ring protein [Hylemonella gracilis ATCC 19624]
 gi|332038984|gb|EGI75413.1| flagellar L-ring protein [Hylemonella gracilis ATCC 19624]
          Length = 238

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 50/234 (21%), Positives = 95/234 (40%), Gaps = 14/234 (5%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           +      + LL GC  +  +   +   +P  ++                  +   S SL+
Sbjct: 17  ALSFALGAVLLAGCTVTAPQPAKVDFATPTMAAYPSQTI-----------PAGPASGSLF 65

Query: 65  RDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT 123
           + + +   F+D RA  VGD +T+ I  +  A   + +  +R+ S+   ++    L G   
Sbjct: 66  QSATYRVGFEDRRARQVGDTVTIRIVENVSASQQSSSTANRSGSISGGITAVPGLSGGTL 125

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
            +   ++  +     SGKG  S     +  I  IV+ +L NG+L++ G +++ +N  +  
Sbjct: 126 GKF--DIGAENKSDFSGKGGTSATNTFSGSITTIVSEVLPNGHLVVVGEKQIGLNQNVDV 183

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           L  TG V P  +   + V    +A  R+   G+G   E        +    LSP
Sbjct: 184 LRFTGTVDPLAIQPGSVVLSTNVANVRVESRGRGPQYEAQTVGWLTRFFHTLSP 237


>gi|262170828|ref|ZP_06038506.1| flagellar L-ring protein FlgH [Vibrio mimicus MB-451]
 gi|261891904|gb|EEY37890.1| flagellar L-ring protein FlgH [Vibrio mimicus MB-451]
          Length = 258

 Score =  169 bits (428), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 43/257 (16%), Positives = 93/257 (36%), Gaps = 24/257 (9%)

Query: 1   MYRYSF--------------IVLCYSSLLFGCHSSISEITGIPQMS-----PMGSSLDEN 41
           M R                   +  +  + G  +  +      + +      + +  D  
Sbjct: 1   MKRLLASSLLILLSGCSLMQAPIESAETIQGTTTVDAVEGDKSESNTGLTDALRNRTDPV 60

Query: 42  NRMPFLGIDFKNSDS---TKKSYSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQAVFD 97
              P     +  +       ++ SL+   +  +++ DS+   VGDI+TV +    +A   
Sbjct: 61  ADDPAWAPIYPKAKPDHYAAETGSLFNLANANSMYDDSKPRGVGDIITVTLNESTKAAKS 120

Query: 98  NQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI 157
                 + N                    N +         +G  + +++  ++  I   
Sbjct: 121 ADADLKKKNDASMD-PLAVGGKDLTVGDYNFSYALKNDNKFTGSAAANQSNSMSGSITVE 179

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           V  +L NGNL+I G + + +N     + ++G +RP D+D  N+++ ++I+ ARI Y G G
Sbjct: 180 VIEVLANGNLVIRGEKWLTLNTGDEYIRLSGTIRPDDIDFDNTIASNRISNARIQYSGTG 239

Query: 218 RTTELLRPPIGHQLIEN 234
              ++  P    +    
Sbjct: 240 TNQDMQEPGFLARFFNV 256


>gi|103488390|ref|YP_617951.1| flagellar L-ring protein [Sphingopyxis alaskensis RB2256]
 gi|98978467|gb|ABF54618.1| flagellar L-ring protein [Sphingopyxis alaskensis RB2256]
          Length = 219

 Score =  169 bits (427), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 46/199 (23%), Positives = 81/199 (40%), Gaps = 4/199 (2%)

Query: 39  DENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDN 98
           D+     F             + S+++ ++  L    RA  VGDILT+ +     A   N
Sbjct: 24  DKLPPDAFSATMPLPPPPPPANGSIFQGAYVPLTSGGRAGQVGDILTIQLVERTAATKSN 83

Query: 99  QTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIV 158
             G  R+  +           G  +     ++   GG    GKG  S++  L+  ++  V
Sbjct: 84  AAGTQRDGDIGLSPPTT----GPLSFFNPSDIGMGGGQQFKGKGEASQSNALSGEVSVTV 139

Query: 159 TAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGR 218
            A+  NG +++ G + + +N     + ++GIVR  D+   N +   ++A A I Y GKG 
Sbjct: 140 AAVYPNGTMLVKGEKFLTLNRGDERVQISGIVRAIDISPDNRILSTRVANATIRYVGKGE 199

Query: 219 TTELLRPPIGHQLIENLSP 237
                R     +    +SP
Sbjct: 200 IARASRQGWLQRFFSMISP 218


>gi|262166279|ref|ZP_06034016.1| flagellar L-ring protein FlgH [Vibrio mimicus VM223]
 gi|262025995|gb|EEY44663.1| flagellar L-ring protein FlgH [Vibrio mimicus VM223]
          Length = 258

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 43/257 (16%), Positives = 93/257 (36%), Gaps = 24/257 (9%)

Query: 1   MYRYSF--------------IVLCYSSLLFGCHSSISEITGIPQMS-----PMGSSLDEN 41
           M R                   +  +  + G  +  +      + +      + +  D  
Sbjct: 1   MKRLLASSLLILLSGCSLMQAPIESAETIQGTTTVDAVEGDKSESNTGLTDALRNRTDPV 60

Query: 42  NRMPFLGIDFKNSDS---TKKSYSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQAVFD 97
              P     +  +       ++ SL+   +  +++ DS+   VGDI+TV +    +A   
Sbjct: 61  ADDPAWAPIYPKAKPDHYAAETGSLFNLANVNSMYDDSKPRGVGDIITVTLNESTKAAKS 120

Query: 98  NQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI 157
                 + N                    N +         +G  + +++  ++  I   
Sbjct: 121 ADADLKKKNDSKMD-PLAVGGKDLTVGDYNFSYALKNDNKFTGSAAANQSNSMSGSITVE 179

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           V  +L NGNL+I G + + +N     + ++G +RP D+D  N+++ ++I+ ARI Y G G
Sbjct: 180 VIEVLANGNLVIRGEKWLTLNTGDEYIRLSGTIRPDDIDFDNTIASNRISNARIQYSGTG 239

Query: 218 RTTELLRPPIGHQLIEN 234
              ++  P    +    
Sbjct: 240 TNQDMQEPGFLARFFNV 256


>gi|213613178|ref|ZP_03371004.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
          Length = 216

 Score =  168 bits (426), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 49/226 (21%), Positives = 90/226 (39%), Gaps = 14/226 (6%)

Query: 1   MYRYSF----IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDS 56
           M +Y+     ++    + L GC    ++        P+          P  G     + S
Sbjct: 1   MQKYALHAYPVMALMVATLTGCAWIPAK--------PLVQGA--TTAQPIPGPVPVANGS 50

Query: 57  TKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
             +S       +  LF+D R  N+GD LT+ ++ +  A   +    SR+           
Sbjct: 51  IFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVP 110

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                       ++   GG + +GKG  + +   +  +   V  +L NGNL + G +++ 
Sbjct: 111 RYLQGLFGNSRADMEASGGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIA 170

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTEL 222
           +N     +  +G+V P+ +   NSV   ++A+ARI Y G G   E 
Sbjct: 171 INQGTEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEA 216


>gi|258621052|ref|ZP_05716086.1| flagellar L-ring protein precursor [Vibrio mimicus VM573]
 gi|258625280|ref|ZP_05720188.1| flagellar L-ring protein precursor [Vibrio mimicus VM603]
 gi|258582453|gb|EEW07294.1| flagellar L-ring protein precursor [Vibrio mimicus VM603]
 gi|258586440|gb|EEW11155.1| flagellar L-ring protein precursor [Vibrio mimicus VM573]
          Length = 261

 Score =  168 bits (425), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 43/257 (16%), Positives = 93/257 (36%), Gaps = 24/257 (9%)

Query: 1   MYRYSF--------------IVLCYSSLLFGCHSSISEITGIPQMS-----PMGSSLDEN 41
           M R                   +  +  + G  +  +      + +      + +  D  
Sbjct: 4   MKRLLASSLLILLSGCSLMQAPIESAETIQGTTTVDAVEGDKSESNTGLTDALRNRTDPV 63

Query: 42  NRMPFLGIDFKNSDS---TKKSYSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQAVFD 97
              P     +  +       ++ SL+   +  +++ DS+   VGDI+TV +    +A   
Sbjct: 64  ADDPAWAPIYPKAKPDHYAAETGSLFNLANVNSMYDDSKPRGVGDIITVTLNESTKAAKS 123

Query: 98  NQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI 157
                 + N                    N +         +G  + +++  ++  I   
Sbjct: 124 ADADLKKKNDASMD-PLAVGGKDLTVGDYNFSYALKNDNKFTGSAAANQSNSMSGSITVE 182

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           V  +L NGNL+I G + + +N     + ++G +RP D+D  N+++ ++I+ ARI Y G G
Sbjct: 183 VIEVLANGNLVIRGEKWLTLNTGDEYIRLSGTIRPDDIDFDNTIASNRISNARIQYSGTG 242

Query: 218 RTTELLRPPIGHQLIEN 234
              ++  P    +    
Sbjct: 243 TNQDMQEPGFLARFFNV 259


>gi|121997316|ref|YP_001002103.1| flagellar L-ring protein [Halorhodospira halophila SL1]
 gi|121588721|gb|ABM61301.1| flagellar L-ring protein [Halorhodospira halophila SL1]
          Length = 228

 Score =  168 bits (425), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 47/220 (21%), Positives = 90/220 (40%), Gaps = 1/220 (0%)

Query: 14  LLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFK 73
           L+ GC +++         +P+     E + +    +D  +    +       +    LF+
Sbjct: 7   LIRGCAAALVAGVAAAACTPLPQEAPEPSPITAPRVDVPDDPDERTGSVFDEERSMRLFE 66

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYD 133
           D  A   GD++TV I  +        +  +R                +   +       +
Sbjct: 67  DRSARRTGDLITVVIEEEIAGDRSINSEMARQQEADMPAPQIGGEDLEIFGR-PFAFEQE 125

Query: 134 GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQ 193
           G  +  G GS  +   L   I A+V     NG+L+I G + VRV+    +L ++GIVR  
Sbjct: 126 GEASFEGGGSADQETNLTGTINAVVVDTTPNGHLVIRGEKNVRVSQGQETLRISGIVRTD 185

Query: 194 DVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           DV A+N VS +++A  ++ Y G+   ++  +P    + + 
Sbjct: 186 DVGANNEVSSNRVANMQVGYTGEEALSDSAQPGWLTRFLM 225


>gi|255747107|ref|ZP_05421052.1| flagellar L-ring protein FlgH [Vibrio cholera CIRS 101]
 gi|262161349|ref|ZP_06030459.1| flagellar L-ring protein FlgH [Vibrio cholerae INDRE 91/1]
 gi|262167780|ref|ZP_06035482.1| flagellar L-ring protein FlgH [Vibrio cholerae RC27]
 gi|262191686|ref|ZP_06049862.1| flagellar L-ring protein FlgH [Vibrio cholerae CT 5369-93]
 gi|31077183|sp|Q9KQ13|FLGH_VIBCH RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|255735509|gb|EET90909.1| flagellar L-ring protein FlgH [Vibrio cholera CIRS 101]
 gi|262023845|gb|EEY42544.1| flagellar L-ring protein FlgH [Vibrio cholerae RC27]
 gi|262028660|gb|EEY47314.1| flagellar L-ring protein FlgH [Vibrio cholerae INDRE 91/1]
 gi|262032425|gb|EEY50987.1| flagellar L-ring protein FlgH [Vibrio cholerae CT 5369-93]
 gi|327484713|gb|AEA79120.1| Flagellar L-ring protein FlgH [Vibrio cholerae LMA3894-4]
          Length = 258

 Score =  167 bits (423), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 45/257 (17%), Positives = 93/257 (36%), Gaps = 24/257 (9%)

Query: 1   MYRYSFI--------------VLCYSSLLFGCHSSISEITGIPQMS-----PMGSSLDEN 41
           M R                   +  +  + G  +  +      + +      + +  D  
Sbjct: 1   MKRLLASSLLILLSGCSLMQPPIESAETIQGTTTVDAVEGDKSESNSGLTDALRNRTDPV 60

Query: 42  NRMPFLGIDFKNSDS---TKKSYSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQAVFD 97
              P                ++ SL+   S ++++ DS+   VGDI+TV +    +A   
Sbjct: 61  AGDPAWAPIHPKGKPEHYAAETGSLFNLASSSSMYDDSKPRGVGDIITVTLNESTKAAKS 120

Query: 98  NQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI 157
                ++ N                    N +         SG  + +++  ++  I   
Sbjct: 121 ADADLNKKNDASMD-PLAVGGKDLTIGDYNFSYALKNDNKFSGSAAANQSNSMSGSITVE 179

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           V  +L NGNL+I G + + +N     + ++G +RP D+D  N+++ ++I+ ARI Y G G
Sbjct: 180 VIEVLANGNLVIRGEKWLTLNTGDEYIRLSGTIRPDDIDFDNTIASNRISNARIQYSGTG 239

Query: 218 RTTELLRPPIGHQLIEN 234
              ++  P    +    
Sbjct: 240 TNQDMQEPGFLARFFNV 256


>gi|239993576|ref|ZP_04714100.1| flagellar L-ring protein [Alteromonas macleodii ATCC 27126]
          Length = 249

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 47/249 (18%), Positives = 93/249 (37%), Gaps = 15/249 (6%)

Query: 1   MY-RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPF------------L 47
           M  R     L     L GC  ++++   + Q SP   ++ +    P              
Sbjct: 1   MKVRCHIHTLIAIFTLGGCAQTLTDEEQVVQSSPTNPNVSQRAVKPVEEEPSPGDPRYSP 60

Query: 48  GIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNN 106
                 S     + SL+   H+  L++   +  VGD++ V +    Q+         +N 
Sbjct: 61  PRMEPTSTLHVPTGSLFNPEHSVGLYERHASFKVGDMILVKLEEQTQSEKSLDFNTDKNT 120

Query: 107 SLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGN 166
           S          + G +  + +  + ++     +      ++  ++  I   VT I   GN
Sbjct: 121 SFDLS-PVTLKVGGIRIDEDDVEVEHEQDSEFASSAKTKQSNSMSGSITVYVTGITPAGN 179

Query: 167 LIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPP 226
           L+++G + + +N     +  +G VR +DVD  N+V   K+  A I Y G G   +  +  
Sbjct: 180 LLVTGEKWITMNRGKEYIRFSGEVRKKDVDESNTVLSSKVGNALIEYSGTGELQDNQQRT 239

Query: 227 IGHQLIENL 235
           +  +L    
Sbjct: 240 VIGKLFSIF 248


>gi|91776312|ref|YP_546068.1| flagellar L-ring protein [Methylobacillus flagellatus KT]
 gi|122399643|sp|Q1GZW0|FLGH_METFK RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|91710299|gb|ABE50227.1| flagellar L-ring protein [Methylobacillus flagellatus KT]
          Length = 222

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 44/198 (22%), Positives = 83/198 (41%), Gaps = 6/198 (3%)

Query: 42  NRMPFLGIDFKNSDSTKKSYSLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQT 100
            ++P        S +   S  ++  + +  L +D RA  VGD + ++I  +  A      
Sbjct: 30  TQVPNTARPAAPSQAVYNSGGIYSPATYRPLLEDKRARLVGDTIVINITENTSATKSGSN 89

Query: 101 GRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTA 160
             S++ +++  ++G F            + N     A     + +        I+A VT 
Sbjct: 90  SASKSGAVNAGITGLFG-----HNVPKASFNAASDNAYDDAAASNSRNVFTGTISATVTE 144

Query: 161 ILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTT 220
           +L NG+L++SG ++V  +     +  +G+V P  V A NSV   ++A+ARI Y       
Sbjct: 145 VLPNGHLVVSGEKQVAFDRGTEFVRFSGVVDPMYVAAGNSVPSSRVADARIEYRTNSNLD 204

Query: 221 ELLRPPIGHQLIENLSPL 238
                 I  +   + +PL
Sbjct: 205 TAQVMSILTRFFLSFAPL 222


>gi|15642193|ref|NP_231825.1| flagellar basal body L-ring protein [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121586244|ref|ZP_01676034.1| flagellar L-ring protein FlgH [Vibrio cholerae 2740-80]
 gi|121726527|ref|ZP_01679776.1| flagellar L-ring protein FlgH [Vibrio cholerae V52]
 gi|147674828|ref|YP_001217711.1| flagellar basal body L-ring protein [Vibrio cholerae O395]
 gi|153213603|ref|ZP_01948876.1| flagellar L-ring protein FlgH [Vibrio cholerae 1587]
 gi|153817116|ref|ZP_01969783.1| flagellar L-ring protein FlgH [Vibrio cholerae NCTC 8457]
 gi|153820847|ref|ZP_01973514.1| flagellar L-ring protein FlgH [Vibrio cholerae B33]
 gi|153829344|ref|ZP_01982011.1| flagellar L-ring protein FlgH [Vibrio cholerae 623-39]
 gi|183179568|ref|ZP_02957779.1| flagellar L-ring protein FlgH [Vibrio cholerae MZO-3]
 gi|227082318|ref|YP_002810869.1| flagellar L-ring protein FlgH [Vibrio cholerae M66-2]
 gi|229507729|ref|ZP_04397234.1| flagellar L-ring protein FlgH [Vibrio cholerae BX 330286]
 gi|229512076|ref|ZP_04401555.1| flagellar L-ring protein FlgH [Vibrio cholerae B33]
 gi|229513838|ref|ZP_04403300.1| flagellar L-ring protein FlgH [Vibrio cholerae TMA 21]
 gi|229519212|ref|ZP_04408655.1| flagellar L-ring protein FlgH [Vibrio cholerae RC9]
 gi|229522143|ref|ZP_04411560.1| flagellar L-ring protein FlgH [Vibrio cholerae TM 11079-80]
 gi|229524189|ref|ZP_04413594.1| flagellar L-ring protein FlgH [Vibrio cholerae bv. albensis VL426]
 gi|229607233|ref|YP_002877881.1| flagellar basal body L-ring protein [Vibrio cholerae MJ-1236]
 gi|254225804|ref|ZP_04919409.1| flagellar L-ring protein FlgH [Vibrio cholerae V51]
 gi|254849323|ref|ZP_05238673.1| flagellar basal body L-ring protein [Vibrio cholerae MO10]
 gi|298500428|ref|ZP_07010233.1| flagellar L-ring protein FlgH [Vibrio cholerae MAK 757]
 gi|226701936|sp|A5F678|FLGH_VIBC3 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|254789286|sp|C3LPJ8|FLGH_VIBCM RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|9656750|gb|AAF95339.1| flagellar L-ring protein FlgH [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121549510|gb|EAX59536.1| flagellar L-ring protein FlgH [Vibrio cholerae 2740-80]
 gi|121630980|gb|EAX63359.1| flagellar L-ring protein FlgH [Vibrio cholerae V52]
 gi|124115802|gb|EAY34622.1| flagellar L-ring protein FlgH [Vibrio cholerae 1587]
 gi|125621710|gb|EAZ50039.1| flagellar L-ring protein FlgH [Vibrio cholerae V51]
 gi|126512384|gb|EAZ74978.1| flagellar L-ring protein FlgH [Vibrio cholerae NCTC 8457]
 gi|126521639|gb|EAZ78862.1| flagellar L-ring protein FlgH [Vibrio cholerae B33]
 gi|146316711|gb|ABQ21250.1| flagellar L-ring protein FlgH [Vibrio cholerae O395]
 gi|148875185|gb|EDL73320.1| flagellar L-ring protein FlgH [Vibrio cholerae 623-39]
 gi|183012979|gb|EDT88279.1| flagellar L-ring protein FlgH [Vibrio cholerae MZO-3]
 gi|227010206|gb|ACP06418.1| flagellar L-ring protein FlgH [Vibrio cholerae M66-2]
 gi|227014090|gb|ACP10300.1| flagellar L-ring protein FlgH [Vibrio cholerae O395]
 gi|229337770|gb|EEO02787.1| flagellar L-ring protein FlgH [Vibrio cholerae bv. albensis VL426]
 gi|229341068|gb|EEO06073.1| flagellar L-ring protein FlgH [Vibrio cholerae TM 11079-80]
 gi|229343901|gb|EEO08876.1| flagellar L-ring protein FlgH [Vibrio cholerae RC9]
 gi|229349019|gb|EEO13976.1| flagellar L-ring protein FlgH [Vibrio cholerae TMA 21]
 gi|229352041|gb|EEO16982.1| flagellar L-ring protein FlgH [Vibrio cholerae B33]
 gi|229355234|gb|EEO20155.1| flagellar L-ring protein FlgH [Vibrio cholerae BX 330286]
 gi|229369888|gb|ACQ60311.1| flagellar L-ring protein FlgH [Vibrio cholerae MJ-1236]
 gi|254845028|gb|EET23442.1| flagellar basal body L-ring protein [Vibrio cholerae MO10]
 gi|297541121|gb|EFH77175.1| flagellar L-ring protein FlgH [Vibrio cholerae MAK 757]
          Length = 261

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 45/257 (17%), Positives = 93/257 (36%), Gaps = 24/257 (9%)

Query: 1   MYRYSFI--------------VLCYSSLLFGCHSSISEITGIPQMS-----PMGSSLDEN 41
           M R                   +  +  + G  +  +      + +      + +  D  
Sbjct: 4   MKRLLASSLLILLSGCSLMQPPIESAETIQGTTTVDAVEGDKSESNSGLTDALRNRTDPV 63

Query: 42  NRMPFLGIDFKNSDS---TKKSYSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQAVFD 97
              P                ++ SL+   S ++++ DS+   VGDI+TV +    +A   
Sbjct: 64  AGDPAWAPIHPKGKPEHYAAETGSLFNLASSSSMYDDSKPRGVGDIITVTLNESTKAAKS 123

Query: 98  NQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI 157
                ++ N                    N +         SG  + +++  ++  I   
Sbjct: 124 ADADLNKKNDASMD-PLAVGGKDLTIGDYNFSYALKNDNKFSGSAAANQSNSMSGSITVE 182

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           V  +L NGNL+I G + + +N     + ++G +RP D+D  N+++ ++I+ ARI Y G G
Sbjct: 183 VIEVLANGNLVIRGEKWLTLNTGDEYIRLSGTIRPDDIDFDNTIASNRISNARIQYSGTG 242

Query: 218 RTTELLRPPIGHQLIEN 234
              ++  P    +    
Sbjct: 243 TNQDMQEPGFLARFFNV 259


>gi|163856438|ref|YP_001630736.1| flagellar basal body L-ring protein [Bordetella petrii DSM 12804]
 gi|163260166|emb|CAP42468.1| flagellar basal-body L-ring protein FlgH [Bordetella petrii]
          Length = 227

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 48/207 (23%), Positives = 84/207 (40%), Gaps = 4/207 (1%)

Query: 34  MGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD---SHAALFKDSRALNVGDILTVDIRI 90
           M                     + + + S+++     +  LF+D R  NVGDI+T+ +  
Sbjct: 21  MIPPEPVVTGPVTAAPPPPPMPAAQPNGSIYQPRVYGNYPLFEDRRPRNVGDIVTIVLNE 80

Query: 91  DDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKL 150
              A  +  T   R+ ++   ++               N +  G   +SGKG  S     
Sbjct: 81  RTNAAKNVATNTDRSGNVGLGIAATPGFMDSW-ANAKLNTDASGSNKASGKGDSSANNTF 139

Query: 151 NLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEAR 210
              I   V  +L NGNL ++G +++ +N     +  +G+V P+ +   NSVS  ++A+AR
Sbjct: 140 TGTITTTVIGVLPNGNLQVAGEKQIAINRGSEYVRFSGVVDPRSITGANSVSSTQVADAR 199

Query: 211 ISYGGKGRTTELLRPPIGHQLIENLSP 237
           I Y  KG   E+       +     SP
Sbjct: 200 IEYRSKGVMDEVQTMGWLQRFFLIASP 226


>gi|226939371|ref|YP_002794444.1| FlgH1 [Laribacter hongkongensis HLHK9]
 gi|226714297|gb|ACO73435.1| FlgH1 [Laribacter hongkongensis HLHK9]
          Length = 233

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 55/243 (22%), Positives = 96/243 (39%), Gaps = 26/243 (10%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           S  V   S LL  C            M P  S + +    P        + S   + +++
Sbjct: 6   SLCVAMASLLLAACS-----------MVPPTSIVQQ----PLTARPQPQAMSRPSNGAIF 50

Query: 65  R-DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT 123
           +      L++++    +GD LTV I           T  S+N      L G  +L     
Sbjct: 51  QTAGVRPLYEEALPRMIGDTLTVVIEEKTTTSAQESTNGSKNAKADIGLPGI-NLPFTNK 109

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
                        ++SG G  + +      +   V  +L NGNL++SG ++VR+N E+  
Sbjct: 110 DLGPFTGTASASASASGSGKAAASSSFLATLTTTVIDVLPNGNLMVSGEKQVRINGELEY 169

Query: 184 LNVTGIVRPQDVDAHNS---------VSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           + ++GIV P+D+  ++          VS  ++A+ARI   G+G      +P    +    
Sbjct: 170 IRLSGIVNPRDIKPYSRDKGLQQGYYVSSTRLADARIEQQGEGNNNRFAQPGWLTRFFMT 229

Query: 235 LSP 237
           +SP
Sbjct: 230 ISP 232


>gi|297580840|ref|ZP_06942765.1| flagellar L-ring protein FlgH [Vibrio cholerae RC385]
 gi|297534666|gb|EFH73502.1| flagellar L-ring protein FlgH [Vibrio cholerae RC385]
          Length = 261

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 45/257 (17%), Positives = 93/257 (36%), Gaps = 24/257 (9%)

Query: 1   MYRYSFI--------------VLCYSSLLFGCHSSISEITGIPQMSP-----MGSSLDEN 41
           M R                   +  +  + G  +  +      + +      + +  D  
Sbjct: 4   MKRLLASSLLILLSGCSLMQPPIESAETIQGTTTVDAVEGDKSESNSGLTDVLRNRTDPV 63

Query: 42  NRMPFLGIDFKNSDS---TKKSYSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQAVFD 97
              P                ++ SL+   S ++++ DS+   VGDI+TV +    +A   
Sbjct: 64  AGDPAWAPIHPKGKPEHYAAETGSLFNLASSSSMYDDSKPRGVGDIITVTLNESTKAAKS 123

Query: 98  NQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI 157
                ++ N                    N +         SG  + +++  ++  I   
Sbjct: 124 ADADLNKKNDASMD-PLAVGGKDLTIGDYNFSYALKNDNKFSGSAAANQSNSMSGSITVE 182

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           V  +L NGNL+I G + + +N     + ++G +RP D+D  N+++ ++I+ ARI Y G G
Sbjct: 183 VIEVLANGNLVIRGEKWLTLNTGDEYIRLSGTIRPDDIDFDNTIASNRISNARIQYSGTG 242

Query: 218 RTTELLRPPIGHQLIEN 234
              ++  P    +    
Sbjct: 243 TNQDMQEPGFLARFFNV 259


>gi|313682863|ref|YP_004060601.1| flagellar l-ring protein [Sulfuricurvum kujiense DSM 16994]
 gi|313155723|gb|ADR34401.1| flagellar L-ring protein [Sulfuricurvum kujiense DSM 16994]
          Length = 238

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 49/230 (21%), Positives = 101/230 (43%), Gaps = 19/230 (8%)

Query: 17  GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSR 76
           GC + ++E    P+++       E           +  +S     SL+    + LF D +
Sbjct: 18  GCTARLTE----PEITFTPPKYVEE------MPSREEENSFVARGSLFGQGDSPLFSDHK 67

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF---------GQQTPQMN 127
           A++V D++TV I     +    +   S  ++L        S            +     N
Sbjct: 68  AMHVNDVVTVVISETASSSNVGKKALSEADTLGLNGGVFTSAGANSTVNSAVNKLNGLSN 127

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
                    + +G GS ++       ++A +  ++ NGN  I+G +E+ V+D+ + + ++
Sbjct: 128 IGFTGGSTSSYAGSGSATKNASFTTTVSARIVKVMSNGNYFITGRREIMVDDQKQIMQLS 187

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           G++RP D+D +N ++  KI++A+I Y  +G      +   G +L+E + P
Sbjct: 188 GVIRPYDIDQNNQINSAKISDAKILYANEGDVDRSTQRGWGSKLVEAVWP 237


>gi|34497162|ref|NP_901377.1| flagellar basal body L-ring protein [Chromobacterium violaceum ATCC
           12472]
 gi|81656058|sp|Q7NXC0|FLGH1_CHRVO RecName: Full=Flagellar L-ring protein 1; AltName: Full=Basal body
           L-ring protein 1; Flags: Precursor
 gi|34103019|gb|AAQ59382.1| flagellar L-ring protein flgH [Chromobacterium violaceum ATCC
           12472]
          Length = 217

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 48/189 (25%), Positives = 76/189 (40%), Gaps = 9/189 (4%)

Query: 51  FKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLH 109
            +   S  +   ++    + +L  D+RA   GD+LTV +    QA     T   + +   
Sbjct: 34  MRQQTSLPQGGGVFTAGGSLSLTSDNRAFRPGDVLTVVLEETTQASKQAGTSFGKKSGAK 93

Query: 110 RKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLII 169
              S             N  +  D     +G  S ++   L   +  +V  +L NG L +
Sbjct: 94  IGPSLI------GNTTFNAQVGIDANRDFNGSSSSTQQNALAGSLTVVVHRVLPNGLLQV 147

Query: 170 SGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGH 229
            G +++ +N     L V G VR +D+D  N VS  +IA ARI Y G G   +   P    
Sbjct: 148 KGEKQLTLNQGEEMLRVAGYVRVEDIDTDNRVSSLRIANARIGYSGSGALADANSPGWLM 207

Query: 230 QLIENLSPL 238
           +     SPL
Sbjct: 208 RFFA--SPL 214


>gi|261211319|ref|ZP_05925607.1| flagellar L-ring protein FlgH [Vibrio sp. RC341]
 gi|260839274|gb|EEX65900.1| flagellar L-ring protein FlgH [Vibrio sp. RC341]
          Length = 258

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 45/257 (17%), Positives = 92/257 (35%), Gaps = 24/257 (9%)

Query: 1   MYRYSFI--------------VLCYSSLLFGCHSSISEITGIPQ-----MSPMGSSLDEN 41
           M R                   +  +  + G  +  +      +        + +  D  
Sbjct: 1   MKRLLASSLLILLSGCSLMQPPIESAETIQGTTTVDAVEGDKSEGNSGLTDALRNRTDPV 60

Query: 42  NRMPFLGIDFKNSDS---TKKSYSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQAVFD 97
              P                ++ SL+   S ++++ DS+   VGDI+TV +    +A   
Sbjct: 61  AGDPAWAPIHPKGKPEHYAAETGSLFNLASGSSMYDDSKPRGVGDIITVTLNESTKAAKS 120

Query: 98  NQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI 157
                ++ N                    N +         SG  + +++  ++  I   
Sbjct: 121 ADADLNKKNDASMD-PLAVGGKDLTIGDYNFSYALKNDNKFSGSAAANQSNSMSGSITVE 179

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           V  +L NGNL+I G + + +N     + ++G +RP D+D  N+++ ++I+ ARI Y G G
Sbjct: 180 VIEVLANGNLVIRGEKWLTLNTGDEYIRLSGTIRPDDIDFDNTIASNRISNARIQYSGTG 239

Query: 218 RTTELLRPPIGHQLIEN 234
              ++  P    +    
Sbjct: 240 TNQDMQEPGFLARFFNV 256


>gi|262404537|ref|ZP_06081092.1| flagellar L-ring protein FlgH [Vibrio sp. RC586]
 gi|262349569|gb|EEY98707.1| flagellar L-ring protein FlgH [Vibrio sp. RC586]
          Length = 258

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 42/245 (17%), Positives = 83/245 (33%), Gaps = 26/245 (10%)

Query: 15  LFGCHSSISEITGIPQM-------------------------SPMGSSLDENNRMPFLGI 49
           L GC      I     +                         +      D+    P    
Sbjct: 13  LSGCSLVQPPIESAETIQGTTTVDAVEGDKSESNSGLTDALRNRTDPVADDPAWAPIYPK 72

Query: 50  DFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLH 109
                 + +        ++  L+ DS+   +GDI+TV +    +A         + N   
Sbjct: 73  AKPEHYAAETGSLFNLANNNNLYDDSKPRGIGDIITVTLNESTKAAKSADADLKKKNDSK 132

Query: 110 RKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLII 169
                            N +         +G  + +++  ++  I   V  +L NGNL+I
Sbjct: 133 MD-PLAVGGKDLTVGDYNFSYALKNDNKFTGSAAANQSNSMSGSITVEVIEVLANGNLVI 191

Query: 170 SGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGH 229
            G + + +N     + ++G +RP D+D  N+++ ++I+ ARI Y G G   ++  P    
Sbjct: 192 RGEKWLTLNTGDEYIRLSGTIRPDDIDFDNTIASNRISNARIQYSGTGTNQDMQEPGFLA 251

Query: 230 QLIEN 234
           +    
Sbjct: 252 RFFNV 256


>gi|34498337|ref|NP_902552.1| flagellar L-ring protein precursor flgH [Chromobacterium violaceum
           ATCC 12472]
 gi|81655149|sp|Q7NU21|FLGH2_CHRVO RecName: Full=Flagellar L-ring protein 2; AltName: Full=Basal body
           L-ring protein 2; Flags: Precursor
 gi|34104191|gb|AAQ60550.1| flagellar L-ring protein precursor flgH [Chromobacterium violaceum
           ATCC 12472]
          Length = 227

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 56/243 (23%), Positives = 100/243 (41%), Gaps = 21/243 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M     I +  + LL  C      +   P                              +
Sbjct: 1   MKSKLAITMVSALLLAACAVQEPPLVQGP----------------TTAKPQPRPVGLPAN 44

Query: 61  YSLWRD-SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            ++++  S+  +F+D+  + VGD L + I+ +       Q   +R + L   ++ G  + 
Sbjct: 45  GAIFQAASYRPMFQDAMPIQVGDTLQITIQENSSTSQSEQVTDTRTSGLSSNITAGVKIP 104

Query: 120 ----GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
               G  +     + N  G   ++GKG+   A      I   VT +L NGNL++SG + V
Sbjct: 105 FLPSGLASGLGGTSFNSSGSANNTGKGNNQVATTFVSSITVTVTDVLANGNLVVSGEKMV 164

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
           R+N +  S+ ++G+V P+DV    +VS  K+A+ARI    KG       P    ++  +L
Sbjct: 165 RINSDTESIRLSGVVNPRDVTPDRTVSSLKVADARIEQQTKGNNRLYNEPGWLSKIFMSL 224

Query: 236 SPL 238
            P+
Sbjct: 225 LPI 227


>gi|153825366|ref|ZP_01978033.1| flagellar L-ring protein FlgH [Vibrio cholerae MZO-2]
 gi|229528801|ref|ZP_04418191.1| flagellar L-ring protein FlgH [Vibrio cholerae 12129(1)]
 gi|149741050|gb|EDM55119.1| flagellar L-ring protein FlgH [Vibrio cholerae MZO-2]
 gi|229332575|gb|EEN98061.1| flagellar L-ring protein FlgH [Vibrio cholerae 12129(1)]
          Length = 261

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 45/257 (17%), Positives = 92/257 (35%), Gaps = 24/257 (9%)

Query: 1   MYRYSFI--------------VLCYSSLLFGCHSSISEITGIPQMS-----PMGSSLDEN 41
           M R                   +  +    G  +  +      + +      + +  D  
Sbjct: 4   MKRLLASSLLILLSGCSLMQPPIESAETTQGTTTVDAVEGDKSESNSGLTDALRNRTDPV 63

Query: 42  NRMPFLGIDFKNSDS---TKKSYSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQAVFD 97
              P                ++ SL+   S ++++ DS+   VGDI+TV +    +A   
Sbjct: 64  AGDPAWAPIHPKGKPEHYAAETGSLFNLASSSSMYDDSKPRGVGDIITVTLNESTKAAKS 123

Query: 98  NQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI 157
                ++ N                    N +         SG  + +++  ++  I   
Sbjct: 124 ADADLNKKNDASMD-PLAVGGKDLTIGDYNFSYALKNDNKFSGSAAANQSNSMSGSITVE 182

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           V  +L NGNL+I G + + +N     + ++G +RP D+D  N+++ ++I+ ARI Y G G
Sbjct: 183 VIEVLANGNLVIRGEKWLTLNTGDEYIRLSGTIRPDDIDFDNTIASNRISNARIQYSGTG 242

Query: 218 RTTELLRPPIGHQLIEN 234
              ++  P    +    
Sbjct: 243 TNQDMQEPGFLARFFNV 259


>gi|327398482|ref|YP_004339351.1| Flagellar L-ring protein [Hippea maritima DSM 10411]
 gi|327181111|gb|AEA33292.1| Flagellar L-ring protein [Hippea maritima DSM 10411]
          Length = 231

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 55/242 (22%), Positives = 96/242 (39%), Gaps = 18/242 (7%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
            +     +    LL GC +S  E                              + T    
Sbjct: 1   MKRLIAGIAVVVLLSGCTTSNVER------------KYTEMPEYVKEQPSLKPNITHNEG 48

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLW ++   +F D +A  VGDI+T+ ++   Q+V  + T  SR  S    LS    + G+
Sbjct: 49  SLWNNTADNMFSDIKARQVGDIVTIIVKEQAQSVNSSSTKTSRATSSQSGLSTLLGMQGK 108

Query: 122 QTPQMN------GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
              ++N        ++     + +G G      +L   I A V  +L N  L I G ++V
Sbjct: 109 ILQRLNAVAGASNMMDTSSSSSFNGSGENKVNNELTATITARVVKVLPNHKLFIRGEKQV 168

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
             N +  ++ +TGI+    + + N++  + I++A+I Y GKG  +         +L   L
Sbjct: 169 YTNGDENTIILTGIIDEYQITSDNTIDSNYISDAKIFYNGKGIVSSTRNEGWLTKLWNLL 228

Query: 236 SP 237
            P
Sbjct: 229 RP 230


>gi|289549016|ref|YP_003474004.1| flagellar L-ring protein [Thermocrinis albus DSM 14484]
 gi|289182633|gb|ADC89877.1| flagellar L-ring protein [Thermocrinis albus DSM 14484]
          Length = 223

 Score =  165 bits (418), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 93/237 (39%), Gaps = 15/237 (6%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +    ++    +L  C   +  +      +P      + +      I           
Sbjct: 1   MGKGVMWLIGLLLMLVSCAQKVVSVEEYEARNPYPGQTQQVHYSSMGSIMP--------- 51

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
                +   +L+ D++A  VGD++ V +     AV       SR+ +    ++  F +  
Sbjct: 52  ----SEGFVSLYSDTKARRVGDVIYVLLVESLNAVESVANQTSRSATFKEGVASLFGISK 107

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
               Q++            G G   ++  ++  +A  V  +  NG+++I   +    N+ 
Sbjct: 108 DVLDQLSAQGGGQMST--KGSGKFQQSAVISTRMAGRVMKVYPNGSMLIEAKKNFYWNNV 165

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            R + + G+VR +D+DA N+VS DKIA   +   G+G T +   P    +L+  + P
Sbjct: 166 SREMVLRGVVRGEDIDATNTVSSDKIANLEVIVEGRGFTVDGGNPGWLARLLAKVLP 222


>gi|260222471|emb|CBA32068.1| Flagellar L-ring protein 1 [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 229

 Score =  165 bits (417), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 41/193 (21%), Positives = 81/193 (41%), Gaps = 3/193 (1%)

Query: 46  FLGIDFKNSDSTKKSYSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR 104
                  +  S   + S+++  +    F+D RA  VGD +T+ I  +  A   + +  +R
Sbjct: 38  VPAAPIASVVSKPANGSIYQTAAFRPAFEDRRARLVGDAVTIQIVENVTASQKSTSTVNR 97

Query: 105 NNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN 164
           N S+   ++           ++N  +        SGKG    A   +  I A V   L N
Sbjct: 98  NTSIDSAITALPDQTLAGLGKLN--IGAATNNNFSGKGGTESANTFSGSITATVMETLPN 155

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           G+L+++G +++ VN  +  L  +G + P+ +   + +S  ++A  R+   G+G   E   
Sbjct: 156 GHLVVAGEKQIGVNQNVDVLRFSGTIDPRMLQPGSIISSTQVANVRVESRGRGAQGEAQT 215

Query: 225 PPIGHQLIENLSP 237
                +   +  P
Sbjct: 216 VGWLSRFFLSFQP 228


>gi|329901233|ref|ZP_08272758.1| Flagellar L-ring protein FlgH [Oxalobacteraceae bacterium IMCC9480]
 gi|327549165|gb|EGF33757.1| Flagellar L-ring protein FlgH [Oxalobacteraceae bacterium IMCC9480]
          Length = 224

 Score =  165 bits (417), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 93/239 (38%), Gaps = 20/239 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R    VL   S+  GC  + + I   P +                    +       +
Sbjct: 5   MMRLC-SVLLLVSVFSGCAVTPTTIVSRPAI----------------PAAPRPLPLAASN 47

Query: 61  YSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            ++++  ++  LF+D RA  +GD LT+ I     A        S++ S +  +   F   
Sbjct: 48  GAIFQTAAYRPLFEDRRARLIGDTLTITINEKTTAGKAGAASSSKSGSANLAVPKLFGAP 107

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
              T  +    N  GG     KG+ +     N  I   V  +L NG L++SG +++ ++ 
Sbjct: 108 TTTTADLA--FNATGGNKYDDKGAATSNNNFNGTIGVTVVDVLANGYLVVSGEKQIGLDR 165

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
               +  +G+V P  +   N+V+  ++A+AR+ Y             +  +   ++ PL
Sbjct: 166 GTEFIRFSGVVNPDFIVGGNNVASTQVADARVEYRTNTHIDPAEMMGLLTRFFLSVIPL 224


>gi|109899122|ref|YP_662377.1| flagellar L-ring protein [Pseudoalteromonas atlantica T6c]
 gi|109701403|gb|ABG41323.1| flagellar L-ring protein [Pseudoalteromonas atlantica T6c]
          Length = 247

 Score =  164 bits (416), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 43/245 (17%), Positives = 92/245 (37%), Gaps = 14/245 (5%)

Query: 4   YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFL------GIDFKN---- 53
              ++L    L+  C + +S    +   SP   ++ +    P          +F+     
Sbjct: 3   IRVLMLSVMFLVTACSTPVSNEEQVIASSPTNPNVKQRAIQPTKTEIERGNPEFRPVRVD 62

Query: 54  --SDSTKKSYSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR 110
                   + SL+  D+   L++ +    VGD++ V++     +       R ++ +   
Sbjct: 63  PFPAVKVPTGSLFDPDNLVGLYQRNNRYRVGDMILVELAEKTSSKKTLNYSRDKSGNFTL 122

Query: 111 KLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
                 +   Q       N +++            +   L   +   V  I+ NGNL+++
Sbjct: 123 DPVTVKAGPLQINGD-KLNADFEQENEFDSSAETKQDNSLEGDVTVYVLEIMPNGNLLVA 181

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ 230
           G + + +N     +  +G +RP D+   N+VS  K+  +RI + GKG   +     +  +
Sbjct: 182 GEKWMTLNKGEEFIRFSGEIRPTDISNDNTVSSVKVGNSRIEFSGKGEQQDNQESSLLGK 241

Query: 231 LIENL 235
           L   L
Sbjct: 242 LFGIL 246


>gi|311105938|ref|YP_003978791.1| flagellar L-ring protein [Achromobacter xylosoxidans A8]
 gi|310760627|gb|ADP16076.1| flagellar L-ring protein [Achromobacter xylosoxidans A8]
          Length = 214

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 52/227 (22%), Positives = 90/227 (39%), Gaps = 18/227 (7%)

Query: 14  LLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD---SHAA 70
           L+ GC               M                   +   + + S+++     +  
Sbjct: 2   LVAGCA--------------MIPPEPIVTGPTTAAPPPPAAPMAQPTGSIYQPTTYGNYP 47

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           LF+D R  NVGDI+T+ +     A  +  T  +R+ S    ++   S         N N 
Sbjct: 48  LFEDRRPRNVGDIVTIVLNEKTNASKNVATNTNRSGSASLGIAAAPSFMDSW-ANANLNT 106

Query: 131 NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIV 190
           +  GG  S GKG  +        I   V  ++ NGNL ++G +++ +N     +  +G+V
Sbjct: 107 DAKGGNVSQGKGDSTANNAFTGTITTTVVGVMSNGNLQVAGEKQIAINRGSEFVRFSGVV 166

Query: 191 RPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            P+ +   N+VS  ++A+ARI Y  KG   E+       +     SP
Sbjct: 167 DPRSITGTNTVSSTQVADARIEYRSKGVMDEVQTMGWLQRFFLIASP 213


>gi|253998485|ref|YP_003050548.1| flagellar L-ring protein [Methylovorus sp. SIP3-4]
 gi|253985164|gb|ACT50021.1| flagellar L-ring protein [Methylovorus sp. SIP3-4]
          Length = 228

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 45/233 (19%), Positives = 90/233 (38%), Gaps = 24/233 (10%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR- 65
           ++   +  L  C  +                       P     +  S     + +++  
Sbjct: 19  LLAAGALTLSACTPTSITQG------------------PLTTKPYPASARPPTNGAIYNV 60

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
            ++  LF+D RA  +GD L ++I  +  A   N +  S+  S+   ++  F      +P 
Sbjct: 61  AAYRPLFEDRRARLIGDTLMINITENTSATKANGSSASKKGSVDSSVTASFG-----SPV 115

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
                N     + +   + + +      IA  V  +L NG L++ G ++V ++     + 
Sbjct: 116 PRAAFNSASDLSYTDAAAANASNVFTGSIAVTVLDVLPNGYLVVGGEKQVALDKGTEFVR 175

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           ++G+V P  + A N+V   ++A+ARI Y    R    L   I  +   +  PL
Sbjct: 176 LSGVVNPDTITAANTVPSTRVADARIEYRTNSRVDAALVTSILSRFFLSFIPL 228


>gi|126445308|ref|YP_001061249.1| flagellar basal body L-ring protein [Burkholderia pseudomallei 668]
 gi|134280650|ref|ZP_01767360.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 305]
 gi|167725933|ref|ZP_02409169.1| flagellar basal body L-ring protein [Burkholderia pseudomallei
           DM98]
 gi|254182891|ref|ZP_04889484.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 1655]
 gi|254299683|ref|ZP_04967132.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 406e]
 gi|125657221|gb|ABN48709.1| flagellar basal body L-ring protein [Burkholderia pseudomallei]
 gi|126224799|gb|ABN88304.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 668]
 gi|134247672|gb|EBA47756.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 305]
 gi|157809608|gb|EDO86778.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 406e]
 gi|184213425|gb|EDU10468.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 1655]
          Length = 218

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 51/237 (21%), Positives = 84/237 (35%), Gaps = 23/237 (9%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R    +   +  L  C S                     +           + +  +S
Sbjct: 1   MMRILLALTGLAC-LGACASIEP---------------PRPDFADDDLPPIATAPAAGRS 44

Query: 61  YSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
             ++    A +L  D RA   GD LTV +    QA     T   +N  +  K    F   
Sbjct: 45  GGVFNAVTAWSLASDGRAYRPGDTLTVTLEETTQASKRADTKFGKNGDMAVKPGVLFG-- 102

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                 +  + ++       G GS S+   L   I  IV  +L  G L + G + + +N 
Sbjct: 103 ----SAIPFDSSFGAKRNFDGGGSSSQQNTLRGEITVIVNQVLAGGLLQVKGEKVLSLNQ 158

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
               + ++G VR  D+D +N VS  ++A ARI Y GKG  ++        +   +  
Sbjct: 159 GEEVMRLSGYVRQADIDTNNRVSSRRLANARIKYVGKGALSDSNSAGWLTRFFNSPW 215


>gi|313200560|ref|YP_004039218.1| flagellar l-ring protein [Methylovorus sp. MP688]
 gi|312439876|gb|ADQ83982.1| flagellar L-ring protein [Methylovorus sp. MP688]
          Length = 230

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 45/233 (19%), Positives = 90/233 (38%), Gaps = 24/233 (10%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR- 65
           ++   +  L  C  +                       P     +  S     + +++  
Sbjct: 21  LLAAGALTLSACTPTSITQG------------------PLTTKPYPASARPPTNGAIYNV 62

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
            ++  LF+D RA  +GD L ++I  +  A   N +  S+  S+   ++  F      +P 
Sbjct: 63  AAYRPLFEDRRARLIGDTLMINITENTSATKANGSSASKKGSVDSSVTASFG-----SPL 117

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
                N     + +   + + +      IA  V  +L NG L++ G ++V ++     + 
Sbjct: 118 PRAAFNSASDLSYTDAAAANASNVFTGSIAVTVLDVLPNGYLVVGGEKQVALDKGTEFVR 177

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           ++G+V P  + A N+V   ++A+ARI Y    R    L   I  +   +  PL
Sbjct: 178 LSGVVNPDTITAANTVPSTRVADARIEYRTNSRVDAALVTSILSRFFLSFIPL 230


>gi|293605006|ref|ZP_06687402.1| flagellar L-ring protein [Achromobacter piechaudii ATCC 43553]
 gi|292816611|gb|EFF75696.1| flagellar L-ring protein [Achromobacter piechaudii ATCC 43553]
          Length = 229

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 48/208 (23%), Positives = 83/208 (39%), Gaps = 4/208 (1%)

Query: 33  PMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD---SHAALFKDSRALNVGDILTVDIR 89
            M                       + + S+++     +  LF+D R  NVGDI+T+ + 
Sbjct: 22  AMIPPEPIVTGPTTAAPPPPPMPMAQPTGSIYQPTTYGNYPLFEDRRPRNVGDIVTIVLN 81

Query: 90  IDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEK 149
               A  +  T  +R  S    ++   S         N N +  GG  + GKG  +    
Sbjct: 82  ERTNASKNVATNTNRTGSATLGIAAAPSFMDSWAG-ANLNTDAKGGNVAQGKGDSTANNA 140

Query: 150 LNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEA 209
               I   V  ++ NGNL ++G +++ +N     +   G+V P+ +   N+VS  ++A+A
Sbjct: 141 FTGTITTTVVGVMSNGNLQVAGEKQIAINRGSEYVRFAGVVDPRSITGTNTVSSTQVADA 200

Query: 210 RISYGGKGRTTELLRPPIGHQLIENLSP 237
           RI Y  KG   E+       +     SP
Sbjct: 201 RIEYRSKGVMDEVQTMGWLQRFFLLASP 228


>gi|224823773|ref|ZP_03696882.1| flagellar L-ring protein [Lutiella nitroferrum 2002]
 gi|224604228|gb|EEG10402.1| flagellar L-ring protein [Lutiella nitroferrum 2002]
          Length = 227

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 58/234 (24%), Positives = 95/234 (40%), Gaps = 16/234 (6%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M+R        + LL  C S        P                        +   +  
Sbjct: 1   MFRRVMGGTALACLLGACSSVSPTAVSGP--------------TTVRPGYALANLENRNQ 46

Query: 61  YSLWRDSHAAL-FKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG-GFSL 118
             ++R   A L F+   A  +GDI+ ++I         + T  SR N+L     G G S+
Sbjct: 47  GGIFRAGSAHLLFEQQSARYIGDIVKIEIAESLSGSNKSGTSGSRKNALKVAGPGAGSSM 106

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
            G      + +++  G  + SGKG  + +  L   +AA V  IL NGNL+++G + +  +
Sbjct: 107 TGLLKWIFDIDVDASGSDSFSGKGENTNSNVLKGKLAASVINILPNGNLVVAGEKSIAQH 166

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
               +L  +G+V P D+ A N VS D +A+AR   GG+G   +        Q +
Sbjct: 167 GNSNTLRFSGVVSPNDIKAGNLVSSDNVADARFELGGRGLVADSNSRSWMQQFL 220


>gi|302392937|ref|YP_003828757.1| flagellar L-ring protein [Acetohalobium arabaticum DSM 5501]
 gi|302205014|gb|ADL13692.1| flagellar L-ring protein [Acetohalobium arabaticum DSM 5501]
          Length = 195

 Score =  162 bits (411), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 52/177 (29%), Positives = 87/177 (49%), Gaps = 8/177 (4%)

Query: 60  SYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
           + SL+ DS++  + + +A   GDILTV I     A     T   ++N ++          
Sbjct: 27  AASLYEDSNSP-YGEHKAAEAGDILTVMISESSTADQQASTETGQSNEVNVG-------P 78

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
           G            +   +SS  GS S++  L   +   VT +L NGNL I G++E+ VN 
Sbjct: 79  GAGELDFVKLFRLNQEDSSSADGSTSQSGSLTAQMTVQVTEVLPNGNLKIEGTKEITVNA 138

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           E++ + V GIVRP+D+   N+V+  KIA ++I Y G+G   +   P +  +++    
Sbjct: 139 EMQKIEVEGIVRPEDITISNTVNSTKIANSKIKYVGEGAIGDRQEPGLLTKVLNVFF 195


>gi|167576665|ref|ZP_02369539.1| flagellar basal body L-ring protein [Burkholderia thailandensis
           TXDOH]
          Length = 218

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 52/237 (21%), Positives = 84/237 (35%), Gaps = 23/237 (9%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R    +   +  L  C S                     +           + +  +S
Sbjct: 1   MMRILLALTWLAC-LGACTSIEP---------------PRPDFADDDLPPLATASAAGRS 44

Query: 61  YSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
             ++    A +L  D RA   GD LTV +    QA     T   +N  +  K    F   
Sbjct: 45  GGVFNAVTAWSLASDGRAYRPGDTLTVTLEETTQASKRADTKFGKNGDMAVKPGVLFG-- 102

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                 +  + ++       G GS S+   L   I  IV  +L  G L + G + + +N 
Sbjct: 103 ----SAVPFDSSFGAKRNFDGGGSSSQQNTLRGEITVIVNQVLAGGLLQVKGEKVLSLNQ 158

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
               + ++G VR  D+D +N VS  +IA ARI Y GKG  ++        +   +  
Sbjct: 159 GEEVMRLSGYVRQADIDTNNRVSSRRIANARIKYVGKGALSDSNSAGWLTRFFNSPW 215


>gi|90408391|ref|ZP_01216553.1| Flagellar basal body L-ring protein [Psychromonas sp. CNPT3]
 gi|90310484|gb|EAS38607.1| Flagellar basal body L-ring protein [Psychromonas sp. CNPT3]
          Length = 252

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 47/241 (19%), Positives = 88/241 (36%), Gaps = 17/241 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEIT------------GIPQMSPMGSSLDENNRMPFLG 48
           M +   I +    L++GC S +  I                Q++            P+  
Sbjct: 1   MIKKLVIAISI-VLMWGCTSLMDPINAVGKKVQQKEDKSQRQVTSSTEDHSPTADDPYYA 59

Query: 49  I--DFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN 105
                +N+++   + SL+    A  L+       +GD +TV ++    A     +  +  
Sbjct: 60  PIDPSRNAEAILVTGSLFNSETAHDLYNYETTFQLGDSITVLLKEKAVATKSATSTLASA 119

Query: 106 NSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENG 165
            +                 ++   L    G    G    +++  L   I   +  IL NG
Sbjct: 120 TNYKLDPIQVPGGPMTVNGKV-VELGMKQGQDFDGAADSAQSHSLTARITVSIVEILNNG 178

Query: 166 NLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           NL + G + + +N+    +  TGIVRP D+   NSV   ++A +RI + G G   ++   
Sbjct: 179 NLKVRGEKWLVINNGKEYIRFTGIVRPSDITEKNSVESYQVANSRIEFSGTGDHADIQTQ 238

Query: 226 P 226
            
Sbjct: 239 G 239


>gi|114800335|ref|YP_758989.1| flagellar L-ring protein FlgH [Hyphomonas neptunium ATCC 15444]
 gi|114740509|gb|ABI78634.1| flagellar L-ring protein FlgH [Hyphomonas neptunium ATCC 15444]
          Length = 239

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 64/201 (31%), Positives = 109/201 (54%), Gaps = 6/201 (2%)

Query: 43  RMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGR 102
              + G   +  D   ++ SLW  +  AL    RA  VGD+LTV + ++DQA   +   R
Sbjct: 38  YAGYPGAVPEPVDPNIQNASLWETAPTALLSMRRAKEVGDLLTVVVEMNDQASLQSSLSR 97

Query: 103 SRNNSLHRKLSGGFSLF------GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAA 156
           +R++S    +   F L             ++  ++     + +G G+++RAEK+   +AA
Sbjct: 98  NRDSSDDMNVEALFGLPEWANGVLPGGASLSPGVDVSRNSSQNGSGAVNRAEKVTFTLAA 157

Query: 157 IVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGK 216
            V  +  NGNLII G Q+ RV++E+R L V+G++R QD+   N+V+YDKIA+A+++Y   
Sbjct: 158 RVIGVEPNGNLIIHGYQQTRVSNEVRYLTVSGVIRAQDITRMNAVTYDKIADAKLAYVSN 217

Query: 217 GRTTELLRPPIGHQLIENL