RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254780374|ref|YP_003064787.1| flagellar basal body L-ring
protein [Candidatus Liberibacter asiaticus str. psy62]
         (238 letters)



>gnl|CDD|145324 pfam02107, FlgH, Flagellar L-ring protein. 
          Length = 181

 Score =  190 bits (484), Expect = 4e-49
 Identities = 65/179 (36%), Positives = 99/179 (55%), Gaps = 6/179 (3%)

Query: 60  SYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + SL++   A  LF+D RA  VGDILTV +  +  A     T  SR++S+   L    +L
Sbjct: 8   NGSLYQAGSARPLFEDRRARRVGDILTVVLSENTSASKSASTSTSRSSSI--SLGIP-TL 64

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
           FG     ++ +L      +  G GS S++  L   I   VT +L NGNL+I G +EVRVN
Sbjct: 65  FG--LGGLSLSLGASSSSSFKGSGSASQSNTLTGTITVTVTDVLPNGNLVIRGEKEVRVN 122

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
                + ++GIVRP+D+   N+VS  +IA+ARI YGG+G   +  +P    +  +++ P
Sbjct: 123 QGDEYIRLSGIVRPEDISPDNTVSSTRIADARIEYGGRGAIADAQQPGWLQRFFDSVWP 181


>gnl|CDD|32246 COG2063, FlgH, Flagellar basal body L-ring protein [Cell motility
           and secretion].
          Length = 230

 Score =  183 bits (467), Expect = 3e-47
 Identities = 81/234 (34%), Positives = 110/234 (47%), Gaps = 13/234 (5%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
             L    LL GC +   E   +P +SP+          P  G       S  + YSLW  
Sbjct: 5   YALLALGLLAGCGT---ECAKVPPLSPIVPGATVAQ-PPQPGPAPIQPGSIFQGYSLWNY 60

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
            +  LF+D RA NVGDILT+ I+ +  A   + T RSR NS       G +  G      
Sbjct: 61  GYQPLFEDRRASNVGDILTIVIQENTSASKSSSTNRSRKNST----GFGLTAVGGVLLGG 116

Query: 127 NG-----NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
           N      +          GKG   R+E L   I A V  +L NGNL+I G +EVRVN E 
Sbjct: 117 NNGGDDSSYETSSNNDFKGKGGAKRSESLTGTITATVVQVLPNGNLVIEGEKEVRVNGEK 176

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
             + V+G+VRP D+   N++S  +IA+ARI YGG+G  +E  +P    +    L
Sbjct: 177 EIIRVSGVVRPDDISGDNTISSTRIADARIEYGGRGYLSEAQQPGWLQRFFLAL 230


>gnl|CDD|30631 COG0283, Cmk, Cytidylate kinase [Nucleotide transport and
           metabolism].
          Length = 222

 Score = 28.3 bits (63), Expect = 2.0
 Identities = 20/91 (21%), Positives = 36/91 (39%), Gaps = 29/91 (31%)

Query: 135 GGASSGKGSISR--AEKLN-------LLIAAIVTAILENG----------------NLII 169
           G A SGK ++++  AEKL         +  A+  A L++G                ++  
Sbjct: 11  GPAGSGKSTVAKILAEKLGFHYLDTGAMYRAVALAALKHGVDLDDEDALVALAKELDISF 70

Query: 170 SGSQEVRVNDEIRSLNVTGIVRPQDVDAHNS 200
                V +N E    +V+  +R ++V    S
Sbjct: 71  VNDDRVFLNGE----DVSEEIRTEEVGNAAS 97


>gnl|CDD|112467 pfam03650, UPF0041, Uncharacterized protein family (UPF0041). 
          Length = 120

 Score = 27.5 bits (61), Expect = 3.1
 Identities = 14/59 (23%), Positives = 22/59 (37%), Gaps = 13/59 (22%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
           R+S +V   + LL   +    E T   Q+                   ++N DS K+SY
Sbjct: 62  RWSLVVKPKNYLLASVN-FFLECTQGAQLG------------RIANYRYQNGDSEKQSY 107


>gnl|CDD|30434 COG0085, RpoB, DNA-directed RNA polymerase, beta subunit/140 kD
           subunit [Transcription].
          Length = 1060

 Score = 26.7 bits (59), Expect = 6.3
 Identities = 13/43 (30%), Positives = 20/43 (46%), Gaps = 2/43 (4%)

Query: 161 ILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSY 203
           +   G  II+G++ V V+ E RS  V  I   +     + V Y
Sbjct: 119 MTRGGYFIINGTERVIVSQEHRSPGV--IFVEKKDKTGSKVLY 159


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.316    0.134    0.381 

Gapped
Lambda     K      H
   0.267   0.0632    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 2,737,187
Number of extensions: 135658
Number of successful extensions: 315
Number of sequences better than 10.0: 1
Number of HSP's gapped: 313
Number of HSP's successfully gapped: 6
Length of query: 238
Length of database: 6,263,737
Length adjustment: 91
Effective length of query: 147
Effective length of database: 4,297,318
Effective search space: 631705746
Effective search space used: 631705746
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 56 (25.6 bits)