RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780375|ref|YP_003064788.1| hypothetical protein CLIBASIA_01300 [Candidatus Liberibacter asiaticus str. psy62] (175 letters) >d1eexa_ c.1.19.3 (A:) Diol dehydratase, alpha subunit {Klebsiella oxytoca [TaxId: 571]} Length = 551 Score = 29.8 bits (67), Expect = 0.12 Identities = 20/84 (23%), Positives = 31/84 (36%), Gaps = 7/84 (8%) Query: 78 RVILLENHKKEYNLWFQKYDSFIMSYNKNILDIYKKMDSDSAALQLEQIDPDISSHILMR 137 V L+ F D FI Y N+ + M DS L DP++ ++ Sbjct: 47 AVTELDGKPVSD---FDLIDHFIARYGINLNRAEEVMAMDSVKLANMLCDPNVKRSEIVP 103 Query: 138 L----SPRQSSLIMSKMNPKSATM 157 L +P + ++S MN M Sbjct: 104 LTTAMTPAKIVEVVSHMNVVEMMM 127 >d1uf2a_ e.28.1.2 (A:) RDV p3 {Rice dwarf virus [TaxId: 10991]} Length = 967 Score = 26.5 bits (58), Expect = 1.5 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 14/64 (21%) Query: 98 SFIMSYNKNILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATM 157 +FI+SY K+I D + ++ DSA +P ++ H + +I S +N A M Sbjct: 43 TFIVSYAKDIYDKFMCIEHDSA------YEPSLTMHRV--------RVIYSMLNDYCAKM 88 Query: 158 ITNV 161 I+ V Sbjct: 89 ISEV 92 >d1i1ip_ d.92.1.5 (P:) Neurolysin (endopeptidase 24.16, thimet oligopeptidase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 665 Score = 25.1 bits (54), Expect = 3.2 Identities = 10/57 (17%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Query: 64 QKKVLEDLQKDIEQRVILL-ENHKKEYNLWFQKYDSFIMSYNKNILDIYKKMDSDSA 119 ++ LE K ++ + L E+ + E ++ + +NKN+ + + A Sbjct: 126 ARRYLEKSIKMGKRNGLHLSEHIRNEIKSMKKRMSELCIDFNKNLNEDDTSLVFSKA 182 >d1s4bp_ d.92.1.5 (P:) Neurolysin (endopeptidase 24.16, thimet oligopeptidase) {Human (Homo sapiens) [TaxId: 9606]} Length = 654 Score = 25.1 bits (54), Expect = 3.2 Identities = 9/47 (19%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Query: 64 QKKVLEDLQKDIEQRVILL-ENHKKEYNLWFQKYDSFIMSYNKNILD 109 + LE L K + + L ++ +K + +NKN+ + Sbjct: 115 AARYLERLIKLGRRNGLHLPRETQENIKRIKKKLSLLCIDFNKNLNE 161 >d2b5dx2 c.6.2.4 (X:1-404) Alpha-amylase AmyC {Thermotoga maritima [TaxId: 2336]} Length = 404 Score = 25.1 bits (54), Expect = 4.0 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 10/66 (15%) Query: 59 RDYLSQKKVLEDLQKDIEQRVILLENHKKE----------YNLWFQKYDSFIMSYNKNIL 108 Q+K ++K IE +E KKE Y F+K + SY+ NIL Sbjct: 66 SSRDLQEKYERHMEKLIELANKEVERTKKEHPLKHKMAKFYREHFEKILNVFRSYDGNIL 125 Query: 109 DIYKKM 114 + +KK Sbjct: 126 EGFKKY 131 >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 257 Score = 24.4 bits (52), Expect = 6.0 Identities = 14/70 (20%), Positives = 24/70 (34%) Query: 58 ERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMSYNKNILDIYKKMDSD 117 D L K + + K I + I+ H + YD F ++ +L + + S Sbjct: 129 NLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASL 188 Query: 118 SAALQLEQID 127 Q I Sbjct: 189 KKDAQASDIP 198 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.322 0.136 0.379 Gapped Lambda K H 0.267 0.0659 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 629,919 Number of extensions: 28065 Number of successful extensions: 88 Number of sequences better than 10.0: 1 Number of HSP's gapped: 88 Number of HSP's successfully gapped: 14 Length of query: 175 Length of database: 2,407,596 Length adjustment: 79 Effective length of query: 96 Effective length of database: 1,322,926 Effective search space: 127000896 Effective search space used: 127000896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.2 bits)